Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS).

Størrelse: px
Starte visningen fra side:

Download "Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS)."

Transkript

1 Teori til elevforløb på Institut for Biokemi og Molekylærbiologi på Syddansk Universitet: Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS). Peter Windfeldt 1, Christian Gothard Rix 2, Søren Andersen 3 og Ann Zahle Andersen 4 Stor tak til Peter Højrup og Karin Hjernø, hvis kapitler i bogen Proteiner oprensning og karakterisering 5 har dannet grundlag for denne tekst. 1 Nordfyns Gymnasium, Højagervej 25, 5471 Søndersø, Danmark, 2 Rødkilde Gymnasium, Rødkildevej Vejle, Danmark, 3 Protein Research Group, Syddansk Universitet, Campusvej 55, 5230 Odense M, Danmark, 4 Outreach Koordinator på Institut for Biokemi og Molekylærbiologi, Syddansk Universitet, 5 Redaktion Vivi Kielberg og Leif Rasmussen, udgivet af Gyldendal, 4. udgave, 1. oplag, ISBN

2 Indhold Kernestof som behandles i øvelsen på SDU... 3 Biologi A... 3 Bioteknologi A... 3 Supplerende stof... 3 Kort introduktion til det samlede forløb... 4 Generel indledning omkring proteiner fra bakterier... 4 Kort om proteiner og deres opbygning Baggrund og teori til:... 6 Forberedelse af proteinblanding, SDS-gel... 6 Coomassie farvning af Proteiner i SDS gel... 6 Udvælgelse af protein og fordøjelse med trypsin... 6 Oprensning og opkoncentrering af peptider... 8 Massespektrometri (MS)... 9 Principperne og apparaturet... 9 Videre analyse af proteinet: Øvelsesopgave 1: Identifikation af insulintype ved MALDI MS Spørgsmål a Spørgsmål b Andre massespektrometriske metoder Isotoper: Øvelsesopgave 2: Molekylebestemmelse ud fra massespektrometri Litteraturliste

3 Kernestof som behandles i øvelsen på SDU Biologi A Opbygning og biologisk betydning af proteiner og nukleinsyrer. Eksempler på anvendt bioteknologi, herunder bioinformatik. Eksempler på undersøgelses- og analysemetoder samt statistisk resultatbehandling inden for biokemi. Supplerende stof Biologien som videnskabsfag, herunder molekylærbiologi og bioteknologi Bioteknologi A Udvalgte uorganiske forbindelser og de organiske stofklasser (aminosyrer) Biokemiske forbindelser med særlig vægt på deres struktur og egenskaber (proteiner) Eksperimentelle arbejdsmetoder der anvendes inden for bioteknologi, herunder, elektroforese, separations- og Oprensningsmetoder. Supplerende stof Forsknings- og anvendelsesaspekter 3

4 Kort introduktion til det samlede forløb Den metode, som i skal benytte kaldes Peptide mass fingerprinting, løst oversat; Peptid masse fingeraftryk (PMF). Metoden danner grundlag for moderne proteomics, idet den tillader identifikation og karakterisering af store som små proteiner, samt deres foldning og modifikationer. Vi vil anvende PMF, i dens simpleste form, til at identificere et protein fra en kompleks proteinblanding. Identifikation af et protein i en kompleks blanding af tusinder af proteiner og andre cellekomponenter er ikke nogen triviel opgave. Heldigvis består et protein af lineære kæder af aminosyrer, som kan skæres op i et antal mindre dele (peptider), som er lettere at karakterisere. Den viden man således opnår om peptiderne, er proteinets peptid masse mønster eller proteinfingeraftryk. Proteinets fingeraftryk er som regel unikt og man kan så ved hjælp af databaser over hundredtusindvis af proteinfingeraftryk identificere det protein, man oprindeligt skar i stykker. PMF oversigt. Proteinet oprenses fra en 1D gel, skæres i peptider, som massebestemmes ved MALDI-MS. Derefter sammenlignes peptid masse mønsteret med forudsagte skæringsmønstre in en database. Resultatet fra databasen er en liste med proteiner, rangeret efter hvor godt peptid masse mønsteret passer med proteinets forudsagte mønster. I vores tilfælde vil vi skære vores oprensede protein med enzymet trypsin. Derefter måles masserne af vores peptider ultra nøjagtigt ved hjælp af MALDI-MS. Den store styrke ved MALDI- MS er, at man kan analysere meget, meget små mængder protein (få nanogram), som ikke ville kunne spores på andre måder. Derfor kan vi nøjes med at oprense meget små mængder protein fra en gel. Efter at vores peptidstørrelser er bestemte, kan vi sammenligne masserne med forudsagte protein fingeraftryk i en database over kendte proteiner og derved finde ud af specifikt hvilket protein, vi har i vores prøve. Generel indledning omkring proteiner fra bakterier I øvelsen på SDU arbejdes der med at identificere forskellige proteiner fra forskellige bakteriestammer. Der findes et utal af forskellige proteiner i bakterierne, hvor nogle af 4

5 proteinerne er generelle proteiner, som langt de fleste bakterier danner, f.eks. generelle nedbrydningsenzymer og membranproteiner som Na + /K + pumper og Ca 2+ pumper. Andre proteiner vil være specifikke for den enkelte bakterie og vil derfor være et slags fingeraftryk for den enkelte bakteriestamme. Bakterier kan også anvendes til at producere store mængder af et protein der stammer fra en anden organisme, og i så fald vil der være store mængder af netop det protein i prøven. Kort om proteiner og deres opbygning. Proteiner består af kæder af aminosyrer og betegnes også som et peptid. De forskellige aminosyrer er opbygget omkring et centralt C-atom hvortil der er bundet en aminogruppe (-NH 2 ), et hydrogenatom (H) og en carboxylsyregruppe (-COOH). På den sidste af det centrale C-atoms fire bindinger sidder den gruppe, som varierer fra aminosyre til aminosyre og betegnes molekylets radikal (R). Det er det varierende radikal, som giver de enkelte aminosyrer deres specielle egenskaber (ikke polære hydrofobe, polære hydrofile, positivt ladede og negativt ladede radikaler). Sammensætningen af proteinets primærstruktur (rækkefølgen af aminosyrer i proteinet) har stor betydning, for hvordan proteinet danner forskellige bindinger, dels i proteinmolekylets egen struktur og herigennem foldning og dels i bindinger til andre molekyler, som f.eks. enzymers specifikke binding til substratet. Forskellige proteiner har igennem sin specifikke primærstruktur særlige bindinger mellem molekylets forskellige områder, hvilket betegnes som sekundærstruktur. To almindelige sekundærstrukturer er alpha-helix (α-helix) og beta-foldeblade (β-sheet). Den sekundære struktur er sammen med proteinets andre bindinger med til at danne proteinets overordnede form, den tertiære struktur, som er forskellige bindinger mellem de forskellige radikaler (disulfidbinding, ionbinding, hydrogenbindinger og hydrofobe lommer). Samlet set vil det enkelte protein danne en specifik foldning og dermed rummelig struktur, som er specielt for det enkelte protein. (se Figur 1) Figur 1 Proteinet trypsin. Enzym som benyttes til at klippe denaturerede proteiner i mindre peptidkæder. Trypsin indeholder både α-helix (spiraler i figuren) og β-foldeblade (brede pile i figuren) Kilde 5

6 Baggrund og teori til: Forberedelse af proteinblanding, SDS-gel En af de udfordringer, der er ved at undersøge og isolere forskellige proteiner, er netop de forskellige proteiners foldning og rummelige struktur. Den første forberedelse af proteinblandingen i den praktiske laboratorieøvelse er derfor at opbryde den rummelige struktur (denaturere), sådan at proteinerne kun adskiller sig ved forskellige længder af deres aminosyrekæder. Et protein denatureres, når det koges i en opløsning af SDS (natrium dodecylsylfat, har samme funktion som alm. sæbe) og β-merkaptoethanol (som er et kemisk stof der bryder disulfid broer). Her bliver både den sekundære og den tertiære struktur af proteinet ødelagt, fordi hydrogen- og svovlbindingerne brydes og molekylet udfoldes (se Figur 2). Proteinerne vil samtidig, fordi SDS bindes til det, få maskeret og udjævnet de ladningsforskelle, der skyldes de forskellige aminosyrers radikaler. Resultatet bliver, at proteinerne nu er jævnt negativt ladede over hele deres aminosyrekæde og derfor kan adskilles efter længde vha. elektroforese. Det vil sige at proteinblandingen separeres på en gel ved at sætte en spænding hen over gelen som trækker de negativt ladede proteiner hen imod karrets anode (+) og dermed separerer dem efter størrelse (på samme måde som DNA separeres). Figur 2 Protein denatureres ved kogning med SDS. Herved foldes proteinet ud og de naturlige ladninger maskeres, sådan at proteinet får en jævn ladning i hele sin udstrækning. Baseret på figur i L. Rasmussen mfl. (2010) Proteiner oprensning og karakterisering. Gyldendal 4. udgave, 1. oplag. Coomassie farvning af Proteiner i SDS gel Efter at have adskilt de forskellige bakterieproteiner efter størrelse, skal proteinerne gøres synlige, dette gøres ved at farve gelen med et farvestof der hedder Coomassie Brilliant Blue. Gelen der nu indeholder de separerede proteiner placeres i et kar med Coomassie, der trænger ind i gelen og binder stærkt til proteinerne. Efterfølgende affarves selve gelen, men farven der er bundet til proteinerne bliver, således at proteinerne nu træder frem på gelen som tydelige blå bånd. Den samlede mængde af bånd og hvordan de fordeler sig i gelen vil, som tidligere nævnt være specifikt for den enkelte bakteriestamme og herigennem afspejle bakteriens individuelle egenskaber (se Figur 3) Udvælgelse af protein og fordøjelse med trypsin Når proteinerne på gelen er farvede, kan der nu udvælges et eller flere bånd på gelen, som hver udelukkende indeholder proteiner af præcis samme længde. Efter udvælgelse af det bånd (og 6

7 dermed protein) man ønsker at undersøge, skæres båndet fysisk ud af gelen med en skalpel og proteinet, der er fanget i gelen, viderebehandles. Proteinet skal klippes i mindre stykker (peptider), for at peptid masse fordelingen kan give det fingeraftryk som vi bruger til at identificere proteinet. Dette gøres ved hjælp af enzymet trypsin, der specifikt klipper efter aminosyrerne lysin (forkortes Lys eller K) og arginin (forkortes Arg eller R). Der er dog en undtagelse i forhold til skæring. Hvis aminosyren ved siden af R eller K er Prolin (forkortes Pro eller P) så skærer trypsin ikke aminosyrekæden. Proteinet klippes/fordøjes efter samme princip som ved klipning af DNA med restriktionsenzymer (f.eks. EcoRI). Klipningen af proteinet med trypsin medfører en masse mindre peptider i størrelsesordnen Da (ca aminosyrer pr peptid). I denne protokol oprenses proteinet ikke inden det skæres, vi skærer det simpelthen inde i gelen og de mindre peptider diffunderer så ud i den omkringliggende væske (se Figur 3). Figur 3 Trypsin fordøjelse af udvalgt protein: 1) Et bånd udvælges fra SDS gelen og skæres ud med en skalpel. 2) Båndet skæres i mindre stykker for at få en større overflade på gelstykkerne. 3) Gelstykkerne vaskes flere gange i en acetonitril/vand blanding. Lige inden enzymet trypsin tilsættes, skrumpes gelen ekstra meget med 100% acetonitril, således at gelen kan opsuge så meget enzymblanding som muligt når det tilsættes. 4) Trypsin diffunderer ind i gelen og skærer proteinet i mindre peptider, som diffunderer ud af gelen og nu befinder sig i den vandige fase (i væsken). I det følgende forklares protokollen kort: 1) Man udvælger et bånd som principielt kun indeholder en slags protein. Dette bånd skæres ud af gelen. 7

8 2) Gelklumpen der nu indeholder det ønskede protein skæres i mindre stykker, så man får en større overflade. Dette er vigtigt, idet det skal være let at diffundere ind og ud af gelklumperne. 3) Gelklumperne vaskes i acetonitril, som er et organisk opløsningsmiddel, der skrumper gelen og dermed presser buffer, salte og coomassie farve ud af gelstykkerne (som når man vrider en svamp). Buffer og salte erstattes så af rent vand og acetonitril. Når gelklumperne er vasket 2 gange skrumpes de til sidst med 100% acetonitril, således at de er klar til at opsuge enzymet trypsin. 4) Trypsin tilsættes i en vandig buffer, som så opsuges af gelstykkerne, der svulmer op igen. Trypsin fordøjer vores protein, og de resulterende peptider diffunderer ud af gelstykkerne. Oprensning og opkoncentrering af peptider Når trypsin har skåret proteinet til peptider, findes peptiderne nu i den skæringsbuffer, der er omkring gelstykkerne, men denne væske indeholder også salte og andre stoffer, som vil forurene vores massespektrum. Derudover ønsker vi at have vores petider i et noget mindre væskevolumen, som vi så kan analysere. Derfor skal peptiderne nu oprenses og opkoncentreres. Dette gør vi på en μ-søjle (mikro-søjle, se Figur 4, venstre). Figur 4 Venstre: Hjemmelavet μ-søjle. Højre: Target plade hvorpå peptiderne sættes i en dråbe, efter oprensning og opkoncentrering. En μ-søjle er et meget tyndt rør, hvori der er en lille bitte smule materiale, der binder proteiner og holder dem tilbage, så man kan sortere peptiderne fra den væske de findes i. Protokollen beskrives kort i det følgende. Oprensning af peptider (illustreres i figur 5): 1) Peptiderne tilsættes til søjlen og fordi de hellere vil binde søjlematerialet end den vandige fase de er i, tilbageholdes de i søjlematerialet. 2) søjlen vaskes i en vandig opløsning af myresyre, der sikrer at peptiderne bliver siddende imens urenheder og salte vaskes væk. 3) peptiderne elueres, det betyder, at vi nu skyller peptiderne ud af søjlen ved at tilsætte noget, de hellere vil være i end søjlematerialet. I dette tilfælde er det opløsningsmidlet acetonitril (som vi 8

9 også brugte før til at skrumpe vores gel) iblandet vores matrix (beskrives under afsnittet Massespektrometri). Figur 5 Udsnit af den del af søjlen som indeholder søjlematerialet. Se forklaringerne på punkts 1-3 i teksten herover. Det 3. trin i protokollen, elueringen forgår direkte ud på MALDI target pladen, se figur 4 (højre). Der afsættes små dråber af peptidet, der nu er opløst i acetonitril og matrix i cirklerne på pladen, og efter at disse er tørret ind, kan prøverne behandles i massespektrometeret. Massespektrometri (MS) Principperne og apparaturet Når vi v.h.a. SDS har fået isoleret det ønskede protein og skåret det i peptider v.h.a. trypsin, er opgaven nu at få identificeret, hvilket protein vi har med at gøre. Hertil benytter vi massespektrometri, som er en meget følsom metode, hvor der kan arbejdes med prøvestørrelser på ned til picomol (10-12 mol). Derfor kan den ud over identifikation af proteiner også bruges til fx påvisning af pesticider i drikkevand og dopinganalyser. 9

10 Figur 6 Princippet i MALDI. Figur kopieret fra Rasmussen mfl. (2010) Proteiner oprensning og karakterisering. Gyldendal 4. udgave, 1. oplag Metoden bygger på, at molekylet under meget lavt tryk og ved høj temperatur bringes på gasform og dernæst ioniseres. I dette tilfælde bringes peptiderne på gasform ved at de indlejres i nogle krystaller, som absorberer laserens energi og omdanner den til varme når man skyder på peptiderne med en laser (se Figur 6 og 7). Idet matrixmolekylerne optager energien fra laseren eksploderer matrix krystallerne og slynger peptiderne ud i ioniseringskammerets vakuum. Her fordamper resten af matrix fra peptiderne og efterlader peptidet med en eller flere positive ladninger. Figur 7 Matrix (gul) med peptider (rød) indlejrede. Matrix eksploderes af laserens energi, således at peptiderne kommer op at svæve (kommer på gasfase) og får en positiv ladning. Figur venligst stillet til rådighed af Peter Højrup (professor ved Institut for Biokemi og Molekylærbiologi, SDU) Den kemiske ændring der sker med peptiderne, kan beskrives som følger: X (matrix) + M (prøve) + laser XH + + X + MH + 10

11 Herefter accelereres de ladede peptider ved at de udsættes for en spænding i flyverøret (se Figur 6), som trækker i deres positive ladning. Princippet er, at jo større et molekyle er, des lavere bliver dets hastighed, hvis det bliver trukket i med samme spænding. Det vil sige, at analysatoren (flyverøret) separerer de dannede ioner efter deres masse/ladningsforhold (m/z). Når de rammer detektoren, registreres deres flyvetid, og deres masse over ladning (m/z) beregnes. Resultatet vises i et spektrum hvor ioner (MH + ) med en bestemt m/z værdi vises som toppe med forskellig højde/intensitet (alt efter hyppigheden af ionen). MH + ionerne kaldes molekylærionerne. Peptidernes molekylær ioners (MH + ) vægt er præcis den, som kan beregnes ud fra deres aminosyresammensætning + 1 Dalton, (1 Dalton er vægten af en proton) som stammer fra den positive ladning peptidet modtog fra matrix. Ud over MH + ionen kan der også være række andre ioner som stammer fra at peptidet (eller hvad der nu analyseres) brydes op under ioniseringen (altså i ionkilden, se Figur 7). Disse ioner kan anvendes til at bestemme stoffets sammensætning, på samme måde som vi kan bestemme et protein ud fra dettes peptidsammensætning (se spektrum i Figur 8). Metoden kan ses live på nedenstående link, så du kan danne dig et overblik over metoden. Link 1 viser MS mere generelt, hvor ionerne afbøjes i deres bane og ud fra denne afbøjning identificeres, mens link 2 viser ideen i time-of-flight (TOF) som MALDI benytter sig af: 1. MS mere generelt (7,59 min) 2. TOF metoden (0,43 min) Videre analyse af proteinet: Når man ved hjælp af MALDI MS har fundet den eksakte molekylevægt på peptiderne sin peptidblanding, så kan denne data overføres til en række internetbaserede databaser, hvor der ligger information om utroligt mange molekyler, heriblandt proteiner. Så samholder man sin peptidsammensætning med databasen over teoretiske peptidstørrelser, som er beregnet ud fra kendskabet til proteinernes aminosyresekvens. På denne måde sammenligner man informationerne om sit eget protein (dettes peptid masse mønster), med databasen over alle kendte peptider på samme måde som man vil bruge et fingeraftryk i en forbryderdatabase. og her fra stammer så navnet på metoden: Peptid masse fingeraftryk (PMF) Hvis det er et helt ukendt protein man analyserer, altså et der ikke er sekventeret eller annoteret 6 endnu, er det stadigt muligt at få oplysninger om primær-, sekundær- og tertiær struktur, hydrofobe- samt hydrofile områder i molekylet og en masse mere, hvilket kan bringe en på sporet af nøjagtigt hvilket protein, man har isoleret og analyseret. Eller, informationerne kan give fingerpeg om, hvad det ukendte protein evt. kan have for funktion i en celle eller et organ. Dette kan være interessant f.eks. i forbindelse med giftstoffer eller udvikling af lægemidler. 6 Annoteret betyder at man ud fra Proteinets DNA sekvens har kategoriseret det som værende et bestemt protein, baseret på at dets sekvens ligner allerede kendte sekvenser fra undersøgte proteiner. 11

12 Øvelsesopgave 1: Identifikation af insulintype ved MALDI MS Følgende er et MALDI MS massespektrum fra et ukendt insulin. Ud fra vores teoretiske viden om insulins protein sekvens i forskellige organismer, kan vi identificere hvilket insulin der er tale om. Spørgsmål a Herunder er listet 4 rå aminosyre sekvenser på 4 insuliner. Skær insulinerne med trypsin (efter R og K, men ikke efter KP eller RP) og identificer dem i forhold til tabellerne med peptid sekvenser herunder. 1) MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN Insulinsekvens stammer fra 2) MAPPQHLCGSHLVDALYLVCGDRGFFYNPKGIVDQCCHRPCDIFDLQNYCN Insulinsekvens stammer fra 3) MALWMQCLPLVLVLLFSTPNTEALANQHLCGSHLVEALYLVCGDRGFFYYPKIKRDIEQAMG Insulinsekvens stammer fra 4) MAALWLQSVSLLVLLIVSWPGSQAFTPPQHLCGSHLVDALYLVCGDRGFFYNPKRDVDPLMG FLPPKADGAAGAGGENEVAEFAFKDQMEMMVKRGIVEQCCHKPCNIPVLQNYCN Insulinsekvens stammer fra Sekvenser af peptider skåret med Trypsin: > insulin - cod (TORSK) Område i sekvens MH+ Sekvens GFFYNPK GIVDQCCHRPCDIFDLQNYCN MAPPQHLCGSHLVDALYLVCGDR > insulin - Xenopus (FRØ) Område i sekvens MH+ Sekvens R IK DIEQAMG GFFYYPK MALWMQCLPLVLVLLFSTPNTEALANQHLCGSHLVEALYLVCGDR 12

13 > insulin - Micropterus salmoides (KARPE) Område i sekvens MH+ Sekvens R R GFFYNPK DQMEMMVK DVDPLMGFLPPK ADGAAGAGGENEVAEFAFK GIVEQCCHKPCNIPVLQNYCN MAALWLQSVSLLVLLIVSWPGSQAFTPPQHLCGSHLVDALYLVCGDR > insulin - Homo sapiens (MENNESKE) Område i sekvens MH+ Sekvens R R TR MALWMR GFFYTPK GIVEQCCTSICSLYQLENYCN EAEDLQVGQVELGGGPGAGSLQPLALEGSLQK LLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGER Spørgsmål b Hvilket dyr stammer nedenstående insulinspektrum fra: 13

14 Figur 8 Masse spektrum optaget med MALDI MS Spektret stammer fra: Andre massespektrometriske metoder Ved anvendelse af det MALDI-MS apparatur der bruges i vores forsøg, kan man ikke måle molekyler der er meget mindre end 500 Da. Men der findes andre typer massespektrometri, som typisk bruges i kemien til at identificere strukturen af ukendte eller nysyntetiserede kemiske stoffer (f.eks. aktive stoffer til nye lægemidler). Denne type massespektrometri frembringer en anden type spektre hvor toppene typisk ligger indenfor 150 Da. Som eksempel på et spektrum kan vi se på methanol (CH 3 OH), som er vist på Figur 9, og vi vil koncentrere os om de vigtigste toppe i spektret: 14

15 1. Den mest intense top har en m/z på 31, og de andre toppe er afbilledet relativt til denne. 2. Toppen på m/z 32 er vores molekylar-ion (M + ): CH 3 OH Denne ion er ustabil og vil fragmenteres på to måder og bliver til: m/z 15 CH 3 + og m/z 31 CH 2 OH + 4. Sidstnævnte ion kan igen fragmenteres og blive til: m/z 29 CHO + Dvs at et massespektrum giver informationer om, hvilke atomer eller atomgrupper, der indgår i molekylet samt stoffets molare masse. Figur 9 Methanols massespektrum, fra NIST Chemistry WebBook (http://webbook.nist.gov/chemistry) Isotoper: Et massespektrum kan også give information om et molekyle består af atomer, der findes som forskellige isotoper, og vi vil her kigge på et simpelt molekyle som HCL (se Figur 10) Man ser her 4 toppe på trods af, at det er et ret simpelt molekyle, der er analyseret, hvilket skyldes, at massespektrometeret kan skelne mellem ioner, der består af forskellige isotoper af samme grundstof. I dette tilfælde er det klor, der er tale om, da det i naturen findes som en blanding af isotoperne 35 Cl og 37 Cl i forholdet 3:1. Når man kigger på spektret, ser man derfor den mest intense top som m/z 36 (M + ), der skyldes H 35 Cl, som er ca. 3 gange så stor som m/z 38, der skyldes H 37 Cl. Den hyppigst forekommende isotop benyttes altid til beregning af M +. Hvis man slår den molare masse op for HCL så angives den til 36,461 g/mol, altså ikke som hverken 15

16 36 eller 38 g/mol. Det skyldes, at den molare masse angives som en middelværdi af de to isotopers masser i forhold til deres forekomst i naturen. Figur 10 Hydrogenchlorids (HCl) massesketrum (http://webbook.nist.gov/chemistry) Øvelsesopgave 2: Molekylebestemmelse ud fra massespektrometri Ud fra nedenstående spektrum, Figur 11, samt Figur 12 (hvor man ser typiske ionserier for en række funktionelle grupper), skal du forsøge at tyde spektret og angive hvilket molekyle, som er blevet analyseret vha. MS: Figur 11 Ukendt stof?? (http://webbook.nist.gov/chemistry) 16

17 Figur 12 Tabellen viser ionserier for en række funktionelle grupper, som består af en basision samt andre typiske toppe. Tabel kopieret fra S.U. Pedersen mfl. (2003) Spektroskopi molekylernes fingeraftryk. Kemiforlaget. 1. udgave, 1. oplag Litteraturliste L. Rasmussen mfl. (2010) Proteiner oprensning og karakterisering. Gyldendal 4. udgave, 1. oplag. K.C. Torp (2007) Biokemibogen liv, funktion, molekyle. Nucleus 1.udgave, 1. oplag. S.U. Pedersen mfl. (2003) Spektroskopi molekylernes fingeraftryk. Kemiforlaget. 1. udgave, 1. oplag. Billeder Animationer SDS-page 17

Intra- og intermolekylære bindinger.

Intra- og intermolekylære bindinger. Intra- og intermolekylære bindinger. Dipol-Dipol bindinger Londonbindinger ydrogen bindinger ydrofil ydrofob 1. Tilstandsformer... 1 2. Dipol-dipolbindinger... 2 3. Londonbindinger... 2 4. ydrogenbindinger....

Læs mere

Undervisningsbeskrivelse for STX 2m Kemi B

Undervisningsbeskrivelse for STX 2m Kemi B Undervisningsbeskrivelse for STX 2m Kemi B Termin Afslutning i juni skoleår 13/14 Institution Marie Kruses Skole Uddannelse Fag og niveau Lærer(e) Hold STX Kemi A valgfag Hasse Bonde Rasmussen 3gKE Denne

Læs mere

Bioteknologi A. Studentereksamen. Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares.

Bioteknologi A. Studentereksamen. Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares. Bioteknologi A Studentereksamen Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares. frs111-btk/a-31052011 Tirsdag den 31. maj 2011 kl. 9.00-14.00

Læs mere

BIOZYMER ØVELSE 2 OPRENSNING AF PROTEINER

BIOZYMER ØVELSE 2 OPRENSNING AF PROTEINER BIOZYMER ØVELSE 2 OPRENSNING AF PROTEINER FAGLIG BAGGRUND Det forudsættes, at den grundlæggende teori bag rekombinant protein ekspression og proteinopresning er bekendt. For dette henvises til undervisningsmateriale

Læs mere

Biotechnology Explorer

Biotechnology Explorer Biotechnology Explorer Oprensning af genomisk DNA fra plantemateriale Manual Katalog nr. 166-5005EDU explorer.bio-rad.com Oversat og bearbejdet af Birgit Sandermann Justesen, Nærum Gymnasium, februar 2009

Læs mere

Isolering af DNA fra løg

Isolering af DNA fra løg Isolering af DNA fra løg Formål: At afprøve en metode til isolering af DNA fra et levende væv. At anvende enzymer.. Indledning: Isolering af DNA fra celler er første trin i mange molekylærbiologiske undersøgelser.

Læs mere

Grundstoffer og det periodiske system

Grundstoffer og det periodiske system Grundstoffer og det periodiske system Gør rede for atomets opbygning. Definer; atom, grundstof, isotop, molekyle, ion. Beskriv hvorfor de enkelte grundstoffer er placeret som de er i Det Periodiske System.

Læs mere

Brombærsolcellen - introduktion

Brombærsolcellen - introduktion #0 Brombærsolcellen - introduktion Solceller i lommeregneren, solceller på hustagene, solceller til mobiltelefonen eller solceller til den bærbare computer midt ude i regnskoven- Solcellen har i mange

Læs mere

nano-science center københavns universitet BROMBÆRSOLCELLEN Introduktion, teori og beskrivelse

nano-science center københavns universitet BROMBÆRSOLCELLEN Introduktion, teori og beskrivelse nano-science center københavns universitet BROMBÆRSOLCELLEN Introduktion, teori og beskrivelse I dette hæfte kan du læse baggrunden for udviklingen af brombærsolcellen og hvordan solcellen fungerer. I

Læs mere

Salte, Syre og Baser

Salte, Syre og Baser Salte, Syre og Baser Fysik/Kemi Rapport 4/10 2011 MO Af Lukas Rønnow Klarlund 9.y Indholdsfortegnelse: Formål s. 2 Salte og Ioner s. 3 Syrer og Baser s. 5 phværdi s. 5 Neutralisation s. 6 Kunklusion s.

Læs mere

Madkemi Kulhydrater: er en gruppe af organiske stoffer der består af kul, hydrogen og oxygen (de sidste to i forholdet 2:1, ligesom H 2

Madkemi Kulhydrater: er en gruppe af organiske stoffer der består af kul, hydrogen og oxygen (de sidste to i forholdet 2:1, ligesom H 2 Madkemi Kulhydrater: er en gruppe af organiske stoffer der består af kul, hydrogen og oxygen (de sidste to i forholdet 2:1, ligesom H 2 O); derfor navnet kulhydrat (hydro: vand (græsk)). fælles for sukkermolekylerne

Læs mere

Væskers bevægelse i kapillarrør

Væskers bevægelse i kapillarrør Væskers bevægelse i kapillarrør Morten Christensen & Adam Cohen Simonsen Januar 2011 Indledning Denne øvelsesvejledning beskriver 1 øvelse, der er en del af det tilbud der gives til Gymnasie-, HF- og HTXklasser

Læs mere

Spørgsmål 1. Øvelse: Kobber plus dibrom. Teori: Atomers opbygning.

Spørgsmål 1. Øvelse: Kobber plus dibrom. Teori: Atomers opbygning. Spørgsmål 1. Øvelse: Kobber plus dibrom. Atomers opbygning. Atomets struktur. Det periodiske system. Betydning af hovedgrupperne. Ædelgassernes elektronstruktur i den yderste skal. Dannelse af ioner og

Læs mere

Oste-kemi. Størstedelen af proteinerne i mælken findes som små kugleformede samlinger, kaldet miceller.

Oste-kemi. Størstedelen af proteinerne i mælken findes som små kugleformede samlinger, kaldet miceller. Man behøver ikke at sætte sig ind i de mere tekniske eller kemiske forhold for at lave ost selv, men for dem som gerne vil vide mere om hvad der grundlæggende sker ved forvandlingen af mælk til ost, så

Læs mere

May the force be with you

May the force be with you May the force be with you Esben Thormann, Department of Chemistry, Surface Chemistry, Royal Institute of Technology, Stockholm. Adam C. Simonsen og Ole G. Mouritsen, MEMPHYS-Center for Biomembran fysik,

Læs mere

IONER OG SALTE. Et stabilt elektronsystem kan natrium- og chlor-atomerne også få, hvis de reagerer kemisk med hinanden:

IONER OG SALTE. Et stabilt elektronsystem kan natrium- og chlor-atomerne også få, hvis de reagerer kemisk med hinanden: IONER OG SALTE INDLEDNING Når vi i daglig tale bruger udtrykket salt, mener vi altid køkkensalt, hvis kemiske navn er natriumchlorid, NaCl. Der findes imidlertid mange andre kemiske forbindelser, som er

Læs mere

Redoxprocessernes energiforhold

Redoxprocessernes energiforhold Bioteknologi 2, Tema 3 Opgave 8 Redoxprocessernes energiforhold Dette link uddyber energiforholdene i redoxprocesser. Stofskiftet handler jo netop om at der bindes energi i de organiske stoffer ved de

Læs mere

Alkohol. Hvad bruger man alkohol til?... 2. Hvad er alkohol... 2. Destilation... 5. Hvordan fremstilles ethanol... 6. Denaturering...

Alkohol. Hvad bruger man alkohol til?... 2. Hvad er alkohol... 2. Destilation... 5. Hvordan fremstilles ethanol... 6. Denaturering... Alkohol Indhold Hvad bruger man alkohol til?... 2 Hvad er alkohol... 2 Destilation... 5 Hvordan fremstilles ethanol... 6 Denaturering... 7 Forbrænding af ethanol... 7 Nedbrydning af ethanol og tømmermænd...

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Vinter 2014 Institution 414 Københavns VUC Uddannelse Fag og niveau Lærer(e) Hold HF Kemi B Anja Skaar Jacobsen

Læs mere

Brugsanvisning IVD Matrix HCCA-portioned

Brugsanvisning IVD Matrix HCCA-portioned Brugsanvisning IVD Matrix HCCA-portioned Rendyrket matrixsubstans til matrix-assisteret-laser-desorption-ionisering time-of-flight-massespektrometri (MALDI-TOF-MS). CARE- produkterne er designet til at

Læs mere

KEMI Vigtig baggrundsviden for biologer

KEMI Vigtig baggrundsviden for biologer KEMI Vigtig baggrundsviden for biologer af Niels Roholt Århus Akademi 1994 For at forstå, hvordan en levende organisme fungerer, må man vide noget om sammensætningen af stofferne i protoplasma og de ændringer,

Læs mere

Side 1 af 7. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. December 2013.

Side 1 af 7. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. December 2013. Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) December 2013 Skive Tekniske Gymnasium HTX Kemi B Trine Rønfeldt

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Hold Termin hvori undervisningen afsluttes: Maj-juni 2012 ZBC

Læs mere

Tag dine gener om halsen. Isoler dit eget DNA, og lav et halssmykke ud af det.

Tag dine gener om halsen. Isoler dit eget DNA, og lav et halssmykke ud af det. Samarbejde mellem gymnasier og Aarhus Universitet Bioteknologiske eksperimenter Tag dine gener om halsen. Isoler dit eget DNA, og lav et halssmykke ud af det. Denne øvelse er baseret på øvelseskittet:

Læs mere

Kemi. Formål og perspektiv

Kemi. Formål og perspektiv Kemi Formål og perspektiv Formålet med undervisningen er, at eleverne skal få kendskab til forskellige stoffers kemiske egenskaber og til processer og lovmæssigheder. Vejen dertil går gennem aktiv iagttagelse

Læs mere

Mundtlige eksamensopgaver

Mundtlige eksamensopgaver Mundtlige eksamensopgaver Kemi C 3ckecmh11308 Grundstoffer og det periodiske system Øvelse: Kobber + dibrom Spørgsmål 1 Forklar hvordan et atom er opbygget og hvad isotoper er. Grundstofferne er ordnet

Læs mere

Stamoplysninger til brug ved prøver til gymnasiale uddannelser

Stamoplysninger til brug ved prøver til gymnasiale uddannelser Studieretningsplan Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Hold Termin hvori undervisningen afsluttes: maj 2013 Teknisk Gymnasium

Læs mere

NATURFAG Fysik/kemi Folkeskolens afsluttende prøver Terminsprøve 2009/10

NATURFAG Fysik/kemi Folkeskolens afsluttende prøver Terminsprøve 2009/10 NATURFAG Fysik/kemi Folkeskolens afsluttende prøver Terminsprøve 2009/10 Elevens navn: CPR-nr.: Skole: Klasse: Tilsynsførendes navn: 1 Tilstandsformer Tilstandsformer Opgave 1.1 Alle stoffer har 3 tilstandsformer.

Læs mere

Spørgsmål 1 Carbonhydrider

Spørgsmål 1 Carbonhydrider Nedenstående spørgsmål er med forbehold for censors godkendelse Spørgsmål 1 Carbonhydrider Der ønskes en gennemgang af udvalgte carbonhydriders opbygning og kemiske egenskaber. Du skal inddrage øvelsen:

Læs mere

Biologisk rensning Fjern opløst organisk stof fra vand

Biologisk rensning Fjern opløst organisk stof fra vand Spildevandscenter Avedøre Biologisk rensning Fjern opløst organisk stof fra vand Øvelse I Formål: På renseanlægget renses et mekanisk, biologisk og kemisk. I den biologiske rensning på renseanlægget benyttes

Læs mere

Exoterme og endoterme reaktioner (termometri)

Exoterme og endoterme reaktioner (termometri) AKTIVITET 10 (FAG: KEMI) NB! Det er i denne øvelse ikke nødvendigt at udføre alle forsøgene. Vælg selv hvilke du/i vil udføre er du i tvivl så spørg. Hvis du er interesseret i at måle varmen i et af de

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj-juni 2014 Institution Uddannelse Fag og niveau Lærer Hold VUC Skive-Viborg HFe Kemi C Maria Ji Sigby-Clausen

Læs mere

Det lyder enkelt, men for at forstå hvilket ærinde forskerne er ude i, er det nødvendigt med et indblik i, hvordan celler udvikles og specialiseres.

Det lyder enkelt, men for at forstå hvilket ærinde forskerne er ude i, er det nødvendigt med et indblik i, hvordan celler udvikles og specialiseres. Epigenetik Men hvad er så epigenetik? Ordet epi er af græsk oprindelse og betyder egentlig ved siden af. Genetik handler om arvelighed, og hvordan vores gener videreføres fra generation til generation.

Læs mere

Klavs Thormod og Tina Haahr Andersen

Klavs Thormod og Tina Haahr Andersen Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin juni 2013 Institution Uddannelse Fag og niveau Lærer(e) Hold VUF - Voksenuddannelsescenter Frederiksberg gsk

Læs mere

Forord. Undervisere kan bruge arket ved først at kontakte pierre@naae.dk og få et skriftligt tilsagn.

Forord. Undervisere kan bruge arket ved først at kontakte pierre@naae.dk og få et skriftligt tilsagn. Forord Dette hjælpeark til mol og molberegninger er lavet af til brug på Nørre Åby Efterskole. Man er som studerende/elev meget velkommen til at hente og bruge arket. Undervisere kan bruge arket ved først

Læs mere

Syrer, baser og salte

Syrer, baser og salte Molekyler Atomer danner molekyler (kovalente bindinger) ved at dele deres elektroner i yderste elektronskal. Dette sker for at opnå en stabil tilstand. En stabil tilstand er når molekylerne på nogle tidspunkter

Læs mere

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj 2015 Institution VUC Vestegnen Uddannelse HF Fag og niveau Lærer(e) Hold Kemi C Susanne Brunsgaard Hansen

Læs mere

Årsplan Skoleåret 2014/2015 Fysik/Kemi Nedenfor følger i rækkefølge undervisningsplaner for skoleåret 14/15. Skolens del og slutmål følger

Årsplan Skoleåret 2014/2015 Fysik/Kemi Nedenfor følger i rækkefølge undervisningsplaner for skoleåret 14/15. Skolens del og slutmål følger Årsplan Skoleåret 2014/2015 Fysik/Kemi Nedenfor følger i rækkefølge undervisningsplaner for skoleåret 14/15. Skolens del og slutmål følger folkeskolens fællesmål slut 2009. 1 Årsplan FAG: Fysik/kemi KLASSE:

Læs mere

Kemi Lærebog: H. Mygind, Kemi 2000 A-niveau 1 & 2

Kemi Lærebog: H. Mygind, Kemi 2000 A-niveau 1 & 2 Molekylær Biomedicin A 1. semester Seneste revision: september 2004 Kemi Lærebog: H. Mygind, Kemi 2000 A-niveau 1 & 2 1) Genkende det periodiske system og de vigtigste grundstoffer. 2) Angive vigtige salte,

Læs mere

Eksamensspørgsmål Kemi C, 2015, Kec124 (NB).

Eksamensspørgsmål Kemi C, 2015, Kec124 (NB). Eksamensspørgsmål Kemi C, 2015, Kec124 (NB). 1 Molekylmodeller og det periodiske system 2 Molekylmodeller og elektronparbindingen 3 Molekylmodeller og organiske stoffer 4 Redoxreaktioner, spændingsrækken

Læs mere

Livets molekylære kode

Livets molekylære kode 4. ÅR R. 2 / 2006 Livets molekylære kode -kemi og biologi mødes D livets molekylære kode D findes i alle levende organismer og indeholder koden til organismen informationer, der afgør om organismen er

Læs mere

Kemi Kulhydrater og protein

Kemi Kulhydrater og protein Kemi Kulhydrater og protein Formål: Formålet med forsøget er at vise hvordan man kan påvise protein, fedtstof, simple sukkerarter eller stivelse i forskellige fødevarer. Samtidig kan man få en fornemmelse

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj-juni 2014 Institution Vuc Vejle Uddannelse Fag og niveau Lærer(e) Hold Hf Naturvidenskabelig faggruppe

Læs mere

Opgave: Du skal udfylde de manglende felter ud fra den information der er givet

Opgave: Du skal udfylde de manglende felter ud fra den information der er givet pgave 1a.01 Brug af det periodiske system pgave: Du skal udfylde de manglende felter ud fra den information der er givet Eks: I rubrik 1 kendte vi grundstof nummeret (nr. 11). Ved brug af det periodiske

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Hold Termin hvori undervisningen afsluttes: maj-juni 2014 Marie

Læs mere

Læringsmål i fysik - 9. Klasse

Læringsmål i fysik - 9. Klasse Læringsmål i fysik - 9. Klasse Salte, syrer og baser Jeg ved salt er et stof der er opbygget af ioner. Jeg ved at Ioner i salt sidder i et fast mønster, et iongitter Jeg kan vise og forklare at salt, der

Læs mere

Proteinelektroforese af GFP Suppleringskit til pglo

Proteinelektroforese af GFP Suppleringskit til pglo Proteinelektroforese af GFP Suppleringskit til pglo Katalognummer nr. 166 0013EDU www.bio rad.com Oversat og bearbejdet af Birgit Sandermann Justesen, Nærum Gymnasium, Nærum Hovedgade 30, 2850 Nærum Birgitjustesen@gmail.com

Læs mere

Studieplan for Naturvidenskabelig Faggruppe, 2015-16

Studieplan for Naturvidenskabelig Faggruppe, 2015-16 Studieplan for Naturvidenskabelig Faggruppe, 2015-16 Forløb 1: Intro & Metode Introduktion til Naturvidenskabelig Faggruppe, naturvidenskabelig metode og til fagene. Hvordan arbejder man naturvidenskabeligt?

Læs mere

Grønlandsk kartoffelavl uden pesticider men med gavnlige antifungale bakterier

Grønlandsk kartoffelavl uden pesticider men med gavnlige antifungale bakterier Grønlandsk kartoffelavl uden pesticider men med gavnlige antifungale bakterier Peter Stougaard og Charlotte Frydenlund Michelsen* Institut for Plante- og Miljøvidenskab Sektion for Genetik og Mikrobiologi

Læs mere

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Hold Termin hvori undervisningen afsluttes: maj-juni 2015 Marie

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Årstid/årstal Institution Sommer 2015 VUF - Voksenuddannelsescenter Frederiksberg Uddannelse Hf/hfe/hhx/htx/stx/gsk/

Læs mere

Membranen sladrer om membranpumpers funktion

Membranen sladrer om membranpumpers funktion Emneord: Biofysik og membranpumper Membranen sladrer om membranpumpers funktion Na + /K + -pumpen findes i alle cellemembraner fra dyr og holder styr på fordelingen af natrium og kalium på hver side af

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Termin hvori undervisningen afsluttes: Maj-juni 2012 ZBC Ringsted

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Aug 2014- dec 2014 Institution VUC Hvidovre Uddannelse Fag og niveau Lærer(e) Hold Flex-kemi C Kemi C Mohammed

Læs mere

Eksamensspørgsma l kemi C, 2015, kec324 (CHT)

Eksamensspørgsma l kemi C, 2015, kec324 (CHT) Oversigt Sp. 1 og 2 Ioner og Ionforbindelser Sp. 3, 4 og 5 Molekylforbindelser Sp. 6 Kemisk mængdeberegning Sp. 7 Koncentration i en opløsning Sp. 8 og 9 Organisk kemi Sp. 10 og 11 Syrer og baser Sp. 12

Læs mere

Syv transmembrane receptorer

Syv transmembrane receptorer Syv transmembrane receptorer Receptoren som kommunikationscentral Cellemembranen definerer grænsen mellem en celles indre og ydre miljø, der er meget forskelligt. Det er essentielt for cellens funktion

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Grundvandskemi Geokemi i vand ved lavt tryk og lav temperatur

Grundvandskemi Geokemi i vand ved lavt tryk og lav temperatur G01 1 Grundvandskemi Geokemi i vand ved lavt tryk og lav temperatur Søren Munch Kristiansen smk@geo.au.dk Geokemi i vand ved lavt tryk og lav temperatur G01 2 G01 3 Undervisningsplan G01 4 Forelæsning

Læs mere

Indholdsfortegnelse. Rengøring af huset. 1. Desinfektion af huset. 2. Tågedesinfektion 3. Vandsystemet. 4. Desinfektion af udenomsarealer..

Indholdsfortegnelse. Rengøring af huset. 1. Desinfektion af huset. 2. Tågedesinfektion 3. Vandsystemet. 4. Desinfektion af udenomsarealer.. Indholdsfortegnelse Rengøring af huset. 1 Desinfektion af huset. 2 Tågedesinfektion 3 Vandsystemet. 4 Desinfektion af udenomsarealer.. 5 Forrum. 6 Fodersiloer.. 7 Diverse opgaver. 8 Udregningsskema.. 9

Læs mere

Indhold. Forord. 11 Forfattere og reviewere. 13. 1 Kemi. 15. 3 Proteiner. 47. 4 Kulhydrater. 62. 2 Cellen. 39. Cytoplasma... 42 Resume...

Indhold. Forord. 11 Forfattere og reviewere. 13. 1 Kemi. 15. 3 Proteiner. 47. 4 Kulhydrater. 62. 2 Cellen. 39. Cytoplasma... 42 Resume... Oversigt Forord. Forfattere og reviewere. 3 Kemi. 5 Cellen. 39 3 Proteiner. 47 4 Kulhydrater. 6 5 Lipider. 75 6 Membranstruktur og membrantransport. 93 7 Osmose og væskeelektrolytbalancen. 07 Enzymer.

Læs mere

Nr 1. Fra gen til protein

Nr 1. Fra gen til protein Nr 1 Fra gen til protein Med udgangspunkt i vedlagte illustrationer bedes du besvare følgende: Hvordan er sammenhængen mellem DNA ets nukleotider og proteinets aminosyrer? Beskriv hvad der sker ved henholdsvis

Læs mere

Hæld 25 ml NaOH(aq) op i et bægerglas. Observer væsken. Er den gennemsigtig? Hvilke ioner er der i ionsuppen?

Hæld 25 ml NaOH(aq) op i et bægerglas. Observer væsken. Er den gennemsigtig? Hvilke ioner er der i ionsuppen? Fældningsreaktion (som erstatning for titrering af saltvand) Opløs 5 g CuSO 4 i 50 ml vand Opløses saltet? Følger det teorien? Hvilke ioner er der i ionsuppen? Hæld 25 ml NaOH(aq) op i et bægerglas. Observer

Læs mere

TEMAOVERSIGT OG FORSLAG TIL OPBYGNING AF UNDERVISNINGSFORLØB

TEMAOVERSIGT OG FORSLAG TIL OPBYGNING AF UNDERVISNINGSFORLØB TEMAOVERSIGT OG FORSLAG TIL OPBYGNING AF UNDERVISNINGSFORLØB TEMA / FAG / LEKTIONER ER DIN SUNDHED DIT EGET VALG? Kultur & Samfund s.4 Opgaver s.17 Samfundsfag Sundheds- og seksualundervisning 2 lektioner

Læs mere

Artikel 2: Kulhydratkemi

Artikel 2: Kulhydratkemi Artikel 2: Kulhydratkemi Kulhydrater dannes i planter ved hjælp af fotosyntese og er en vigtig kilde til ernæring for mennesket. Navnet kulhydrat dækker over en række forskellige sukkerarter, som inddeles

Læs mere

Mad, motion og blodsukker

Mad, motion og blodsukker Mad, motion og blodsukker Opgaven I skal have idrætsdag på skolen, og der er forskellige formiddags-aktiviteter, I kan vælge mellem: 1. I skal løbe 8 km i moderat tempo. Efter en kort pause skal I sprinte

Læs mere

Anvendt BioKemi: Blod som et kemisk system, Struktur af blod

Anvendt BioKemi: Blod som et kemisk system, Struktur af blod Anvendt BioKemi: Struktur 1) MM1 Intro: Terminologi, Enheder Math/ biokemi : Kemiske ligninger, syre, baser, buffer Små / Store molekyler: Aminosyre, proteiner 2) MM2 Anvendelse: blod som kemiske systemer

Læs mere

UNDERSØGELSE AF JORDRESPIRATION

UNDERSØGELSE AF JORDRESPIRATION UNDERSØGELSE AF JORDRESPIRATION Formål 1. At bestemme omsætningen af organisk stof i jordbunden ved at måle respirationen med en kvantitative metode. 2. At undersøge respirationsstørrelsen på forskellige

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj/juni 13/14 Institution Herning HF og VUC Uddannelse Fag og niveau Lærer(e) Hold Hf Naturvidenskabelig

Læs mere

Helge Mygind Ole Vesterlund Niel sen Vibeke A xelsen. Notatark

Helge Mygind Ole Vesterlund Niel sen Vibeke A xelsen. Notatark BASISKEMI C Helge Mygind Ole Vesterlund Niel sen Vibeke A xelsen Notatark HAAse & Søns forlag Helge Mygind, Ole Vesterlund Nielsen og Vibeke Axelsen: Basiskemi C. Notatark forfatterne og Haase & Søns Forlag

Læs mere

Eksamensopgaverne offentliggøres selvfølgelig med det forbehold, at censor kan komme med ændringsforslag.

Eksamensopgaverne offentliggøres selvfølgelig med det forbehold, at censor kan komme med ændringsforslag. VUC Århus, 17. maj. 2011 Kære alle kursister på holdene ke02da1c (kemi C flex, helårsholdet) og ke05da1c (kemi C flex, halvårsholdet) På de næste mange sider vil I kunne se Jeres kommende eksamensopgaver

Læs mere

Dansk Naturvidenskabsfestival d. 26. - 30. september 2011

Dansk Naturvidenskabsfestival d. 26. - 30. september 2011 Dansk Naturvidenskabsfestival d. 26. - 30. september 2011 Velkommen til Odense Tekniske Gymnasium side 1 Fysik Show side 2 Mordgåde side 3 Kemi i hverdagen side 4 Mikroskopisk liv side 5 PhysiQue Du Soleil

Læs mere

TEORETISKE MÅL FOR EMNET:

TEORETISKE MÅL FOR EMNET: TEORETISKE MÅL FOR EMNET: Kendskab til organiske forbindelser Kende alkoholen ethanol samt enkelte andre simple alkoholer Vide, hvad der kendetegner en alkohol Vide, hvordan alkoholprocenter beregnes;

Læs mere

Klavs Thormod og Tina Haahr Andersen

Klavs Thormod og Tina Haahr Andersen Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin december 2013 Institution Uddannelse Fag og niveau Lærer(e) VUF - Voksenuddannelsescenter Frederiksberg gsk

Læs mere

DNA ANALYSE Sct. Jørgensgade 22, 1. tv

DNA ANALYSE Sct. Jørgensgade 22, 1. tv DNA ANALYSE Sct. Jørgensgade 22, 1. tv Rapport dato 1. september 2015 Vurdering Analysen viser unormale forekomster af skimmelsvamp, hvilket indikerer tegn på fugtskadede bygningsdele i lejligheden. Der

Læs mere

Manual til Bakteriemysteriet

Manual til Bakteriemysteriet Manual til Bakteriemysteriet SPILLETS FORMÅL Dette spil er udviklet med et overordnet tema og en række minispil. Formålet med spillet er at udvikle et IT-læringsmiljø om multiresistens, som skal illustrere,

Læs mere

Til denne udfordring kan du eksperimentere med forsøg 4.2 i kemilokalet. Forsøg 4.2 handler om kuliltens påvirkning af kroppens blod.

Til denne udfordring kan du eksperimentere med forsøg 4.2 i kemilokalet. Forsøg 4.2 handler om kuliltens påvirkning af kroppens blod. Gå op i røg Hvilke konsekvenser har rygning? Udfordringen Denne udfordring handler om nogle af de skader, der sker på kroppen, hvis man ryger. Du kan arbejde med, hvordan kulilten fra cigaretter påvirker

Læs mere

3.g Titel 7 Infektionsbiologi, antibiotika, allergi og autoimmune sygdomme/diabetes

3.g Titel 7 Infektionsbiologi, antibiotika, allergi og autoimmune sygdomme/diabetes Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin August 2014 juni 2016 Institution Københavns tekniske Skole Htx-Vibenhus Uddannelse Htx Fag og niveau Valgfag

Læs mere

Emulgatorer - fedt at stabilisere Emulgatorer anvendes bl.a. i 2. ÅRGANG NR. 1 / 2003

Emulgatorer - fedt at stabilisere Emulgatorer anvendes bl.a. i 2. ÅRGANG NR. 1 / 2003 2. ÅRGANG NR. 1 / 2003 Emulgatorer - fedt at stabilisere Emulgatorer anvendes bl.a. i iscreme sorbet slik tyggegummi milk shake mælkedrikke piskeskum/kunstfløde margarine mayonnaise dressing snacks brød

Læs mere

Titel: OPLØSELIGHEDEN AF KOBBER(II)SULFAT. Litteratur: Klasse: Dato: Ark 1 af. Helge Mygind, Kemi 2000 A-niveau 1, s. 290-292 8/9-2008/OV

Titel: OPLØSELIGHEDEN AF KOBBER(II)SULFAT. Litteratur: Klasse: Dato: Ark 1 af. Helge Mygind, Kemi 2000 A-niveau 1, s. 290-292 8/9-2008/OV Fag: KEMI Journal nr. Titel: OPLØSELIGHEDEN AF KOBBER(II)SULFAT Navn: Litteratur: Klasse: Dato: Ark 1 af Helge Mygind, Kemi 2000 A-niveau 1, s. 290-292 8/9-2008/OV Formålet er at bestemme opløseligheden

Læs mere

Lys på (kvante-)spring: fra paradox til præcision

Lys på (kvante-)spring: fra paradox til præcision Lys på (kvante-)spring: fra paradox til præcision Metrologidag, 18. maj, 2015, Industriens Hus Lys og Bohrs atomteori, 1913 Kvantemekanikken, 1925-26 Tilfældigheder, usikkerhedsprincippet Kampen mellem

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Juni 2013/2014 Institution Marie Kruses Skole Uddannelse Fag og niveau Lærer(e) Stx Biologi A Ditte H. Carlsen

Læs mere

Eksperimenter: Forsøg med natron (journal) Propan-1-ol og propan-2-ol s kogepunkter (journal)

Eksperimenter: Forsøg med natron (journal) Propan-1-ol og propan-2-ol s kogepunkter (journal) Undervisningsbeskrivelse for 2g (Pia Lassen) Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin maj-juni 12/13 Institution Thisted Gymnasium og FH Uddannelse stx Fag og niveau Kemi B

Læs mere

Modul 3-5: Fremstilling af mini-raketter

Modul 3-5: Fremstilling af mini-raketter Modul 3-5 Modul 3-5: Fremstilling af mini-raketter En rumrakets hovedmotor forsynes ofte med en blanding af hydrogen og oxygen. ESA s store Ariane 5 raket forbrænder således ca. 270 liter oxygen og 40

Læs mere

Syrer, baser og salte

Syrer, baser og salte Syrer, baser og salte Navn: Indholdsfortegnelse: Ion begrebet... 2 Ætsning af Mg bånd med forskellige opløsninger... 5 Elektrolyse af forskellige opløsninger... 7 Påvisning af ioner i forskellige opløsninger

Læs mere

Maple. Skærmbilledet. Vi starter med at se lidt nærmere på opstartsbilledet i Maple. Værktøjslinje til indtastningsområdet. Menulinje.

Maple. Skærmbilledet. Vi starter med at se lidt nærmere på opstartsbilledet i Maple. Værktøjslinje til indtastningsområdet. Menulinje. Maple Dette kapitel giver en kort introduktion til hvordan Maple 12 kan benyttes til at løse mange af de opgaver, som man bliver mødt med i matematiktimerne på HHX. Skærmbilledet Vi starter med at se lidt

Læs mere

Noter til kemi A-niveau

Noter til kemi A-niveau Noter til kemi A-niveau Grundlæggende kemi til opgaveregning 2.0 Af Martin Sparre INDHOLD 2 Indhold 1 Kemiske ligevægte 3 1.1 En simpel kemisk ligevægt.................... 3 1.2 Forskydning af ligevægte.....................

Læs mere

Titel 1 Biologi: Forskellige økosystemers struktur, celler og deres opbygning, fotosyntese og respiration

Titel 1 Biologi: Forskellige økosystemers struktur, celler og deres opbygning, fotosyntese og respiration Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Sommer 2015 Vestegnen HF & VUC Uddannelse HF Fag og niveau Naturvidenskabelig faggruppe Lærer(e)

Læs mere

Undervisningsbeskrivelse. Termin maj-juni 12/13. Uddannelse. Inger Klit Schierup (IS) Oversigt over gennemførte undervisningsforløb

Undervisningsbeskrivelse. Termin maj-juni 12/13. Uddannelse. Inger Klit Schierup (IS) Oversigt over gennemførte undervisningsforløb Undervisningsbeskrivelse Termin maj-juni 12/13 Institution Favrskov Gymnasium Uddannelse Fag og niveau Lærer Hold stx Biologi B Inger Klit Schierup (IS) 3biB1 Oversigt over gennemførte undervisningsforløb

Læs mere

Fra spild til penge brug enzymer

Fra spild til penge brug enzymer Fra spild til penge brug enzymer Køreplan 01005 Matematik 1 - FORÅR 2010 Denne projektplan er udarbejdet af Per Karlsson og Kim Knudsen, DTU Matematik, i samarbejde med Jørgen Risum, DTU Food. 1 Introduktion

Læs mere

Konjugering af Alexa Fluor 488 til Insulin

Konjugering af Alexa Fluor 488 til Insulin Konjugering af Alexa Fluor 488 til Insulin Modul 2 Projekt i Kemi Institut for Natur, Systemer og Modeller Roskilde Universitetscenter Juni 2007 Skrevet af: Simon Hockenhull Vejleder: Søren Hvidt Abstract

Læs mere

Billeder af cellens molekylære univers

Billeder af cellens molekylære univers 8 Billeder af cellens molekylære univers Hver enkelt levende celle består af tusindvis af biologiske makromolekyler. Om du er menneske, mus, svamp eller bakterie, så er mange af de biologiske molekyler

Læs mere

UNDERVISNINGSBESKRIVELSE

UNDERVISNINGSBESKRIVELSE UNDERVISNINGSBESKRIVELSE Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj-juni, 14/15 Institution Horsens HF og VUC Uddannelse Hfe Fag og niveau Biologi C Lærer(e) Hold Mark Goldsmith

Læs mere

MODUL 3 OG 4: UDFORSKNING AF RUMMET

MODUL 3 OG 4: UDFORSKNING AF RUMMET MODUL 3 OG 4: UDFORSKNING AF RUMMET Hubble Space Telescope International Space Station MODUL 3 - ET SPEKTRALT FINGERAFTRYK EM-STRÅLINGS EGENSKABER Elektromagnetisk stråling kan betragtes som bølger og

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin maj-juni 2012 Bemærk: Denne undervisningsbeskrivelse er 2g indholdet. For 2t er det derfor titel 8-14. For

Læs mere