Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS).

Størrelse: px
Starte visningen fra side:

Download "Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS)."

Transkript

1 Teori til elevforløb på Institut for Biokemi og Molekylærbiologi på Syddansk Universitet: Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS). Peter Windfeldt 1, Christian Gothard Rix 2, Søren Andersen 3 og Ann Zahle Andersen 4 Stor tak til Peter Højrup og Karin Hjernø, hvis kapitler i bogen Proteiner oprensning og karakterisering 5 har dannet grundlag for denne tekst. 1 Nordfyns Gymnasium, Højagervej 25, 5471 Søndersø, Danmark, 2 Rødkilde Gymnasium, Rødkildevej Vejle, Danmark, 3 Protein Research Group, Syddansk Universitet, Campusvej 55, 5230 Odense M, Danmark, 4 Outreach Koordinator på Institut for Biokemi og Molekylærbiologi, Syddansk Universitet, 5 Redaktion Vivi Kielberg og Leif Rasmussen, udgivet af Gyldendal, 4. udgave, 1. oplag, ISBN

2 Indhold Kernestof som behandles i øvelsen på SDU... 3 Biologi A... 3 Bioteknologi A... 3 Supplerende stof... 3 Kort introduktion til det samlede forløb... 4 Generel indledning omkring proteiner fra bakterier... 4 Kort om proteiner og deres opbygning Baggrund og teori til:... 6 Forberedelse af proteinblanding, SDS-gel... 6 Coomassie farvning af Proteiner i SDS gel... 6 Udvælgelse af protein og fordøjelse med trypsin... 6 Oprensning og opkoncentrering af peptider... 8 Massespektrometri (MS)... 9 Principperne og apparaturet... 9 Videre analyse af proteinet: Øvelsesopgave 1: Identifikation af insulintype ved MALDI MS Spørgsmål a Spørgsmål b Andre massespektrometriske metoder Isotoper: Øvelsesopgave 2: Molekylebestemmelse ud fra massespektrometri Litteraturliste

3 Kernestof som behandles i øvelsen på SDU Biologi A Opbygning og biologisk betydning af proteiner og nukleinsyrer. Eksempler på anvendt bioteknologi, herunder bioinformatik. Eksempler på undersøgelses- og analysemetoder samt statistisk resultatbehandling inden for biokemi. Supplerende stof Biologien som videnskabsfag, herunder molekylærbiologi og bioteknologi Bioteknologi A Udvalgte uorganiske forbindelser og de organiske stofklasser (aminosyrer) Biokemiske forbindelser med særlig vægt på deres struktur og egenskaber (proteiner) Eksperimentelle arbejdsmetoder der anvendes inden for bioteknologi, herunder, elektroforese, separations- og Oprensningsmetoder. Supplerende stof Forsknings- og anvendelsesaspekter 3

4 Kort introduktion til det samlede forløb Den metode, som i skal benytte kaldes Peptide mass fingerprinting, løst oversat; Peptid masse fingeraftryk (PMF). Metoden danner grundlag for moderne proteomics, idet den tillader identifikation og karakterisering af store som små proteiner, samt deres foldning og modifikationer. Vi vil anvende PMF, i dens simpleste form, til at identificere et protein fra en kompleks proteinblanding. Identifikation af et protein i en kompleks blanding af tusinder af proteiner og andre cellekomponenter er ikke nogen triviel opgave. Heldigvis består et protein af lineære kæder af aminosyrer, som kan skæres op i et antal mindre dele (peptider), som er lettere at karakterisere. Den viden man således opnår om peptiderne, er proteinets peptid masse mønster eller proteinfingeraftryk. Proteinets fingeraftryk er som regel unikt og man kan så ved hjælp af databaser over hundredtusindvis af proteinfingeraftryk identificere det protein, man oprindeligt skar i stykker. PMF oversigt. Proteinet oprenses fra en 1D gel, skæres i peptider, som massebestemmes ved MALDI-MS. Derefter sammenlignes peptid masse mønsteret med forudsagte skæringsmønstre in en database. Resultatet fra databasen er en liste med proteiner, rangeret efter hvor godt peptid masse mønsteret passer med proteinets forudsagte mønster. I vores tilfælde vil vi skære vores oprensede protein med enzymet trypsin. Derefter måles masserne af vores peptider ultra nøjagtigt ved hjælp af MALDI-MS. Den store styrke ved MALDI- MS er, at man kan analysere meget, meget små mængder protein (få nanogram), som ikke ville kunne spores på andre måder. Derfor kan vi nøjes med at oprense meget små mængder protein fra en gel. Efter at vores peptidstørrelser er bestemte, kan vi sammenligne masserne med forudsagte protein fingeraftryk i en database over kendte proteiner og derved finde ud af specifikt hvilket protein, vi har i vores prøve. Generel indledning omkring proteiner fra bakterier I øvelsen på SDU arbejdes der med at identificere forskellige proteiner fra forskellige bakteriestammer. Der findes et utal af forskellige proteiner i bakterierne, hvor nogle af 4

5 proteinerne er generelle proteiner, som langt de fleste bakterier danner, f.eks. generelle nedbrydningsenzymer og membranproteiner som Na + /K + pumper og Ca 2+ pumper. Andre proteiner vil være specifikke for den enkelte bakterie og vil derfor være et slags fingeraftryk for den enkelte bakteriestamme. Bakterier kan også anvendes til at producere store mængder af et protein der stammer fra en anden organisme, og i så fald vil der være store mængder af netop det protein i prøven. Kort om proteiner og deres opbygning. Proteiner består af kæder af aminosyrer og betegnes også som et peptid. De forskellige aminosyrer er opbygget omkring et centralt C-atom hvortil der er bundet en aminogruppe (-NH 2 ), et hydrogenatom (H) og en carboxylsyregruppe (-COOH). På den sidste af det centrale C-atoms fire bindinger sidder den gruppe, som varierer fra aminosyre til aminosyre og betegnes molekylets radikal (R). Det er det varierende radikal, som giver de enkelte aminosyrer deres specielle egenskaber (ikke polære hydrofobe, polære hydrofile, positivt ladede og negativt ladede radikaler). Sammensætningen af proteinets primærstruktur (rækkefølgen af aminosyrer i proteinet) har stor betydning, for hvordan proteinet danner forskellige bindinger, dels i proteinmolekylets egen struktur og herigennem foldning og dels i bindinger til andre molekyler, som f.eks. enzymers specifikke binding til substratet. Forskellige proteiner har igennem sin specifikke primærstruktur særlige bindinger mellem molekylets forskellige områder, hvilket betegnes som sekundærstruktur. To almindelige sekundærstrukturer er alpha-helix (α-helix) og beta-foldeblade (β-sheet). Den sekundære struktur er sammen med proteinets andre bindinger med til at danne proteinets overordnede form, den tertiære struktur, som er forskellige bindinger mellem de forskellige radikaler (disulfidbinding, ionbinding, hydrogenbindinger og hydrofobe lommer). Samlet set vil det enkelte protein danne en specifik foldning og dermed rummelig struktur, som er specielt for det enkelte protein. (se Figur 1) Figur 1 Proteinet trypsin. Enzym som benyttes til at klippe denaturerede proteiner i mindre peptidkæder. Trypsin indeholder både α-helix (spiraler i figuren) og β-foldeblade (brede pile i figuren) Kilde 5

6 Baggrund og teori til: Forberedelse af proteinblanding, SDS-gel En af de udfordringer, der er ved at undersøge og isolere forskellige proteiner, er netop de forskellige proteiners foldning og rummelige struktur. Den første forberedelse af proteinblandingen i den praktiske laboratorieøvelse er derfor at opbryde den rummelige struktur (denaturere), sådan at proteinerne kun adskiller sig ved forskellige længder af deres aminosyrekæder. Et protein denatureres, når det koges i en opløsning af SDS (natrium dodecylsylfat, har samme funktion som alm. sæbe) og β-merkaptoethanol (som er et kemisk stof der bryder disulfid broer). Her bliver både den sekundære og den tertiære struktur af proteinet ødelagt, fordi hydrogen- og svovlbindingerne brydes og molekylet udfoldes (se Figur 2). Proteinerne vil samtidig, fordi SDS bindes til det, få maskeret og udjævnet de ladningsforskelle, der skyldes de forskellige aminosyrers radikaler. Resultatet bliver, at proteinerne nu er jævnt negativt ladede over hele deres aminosyrekæde og derfor kan adskilles efter længde vha. elektroforese. Det vil sige at proteinblandingen separeres på en gel ved at sætte en spænding hen over gelen som trækker de negativt ladede proteiner hen imod karrets anode (+) og dermed separerer dem efter størrelse (på samme måde som DNA separeres). Figur 2 Protein denatureres ved kogning med SDS. Herved foldes proteinet ud og de naturlige ladninger maskeres, sådan at proteinet får en jævn ladning i hele sin udstrækning. Baseret på figur i L. Rasmussen mfl. (2010) Proteiner oprensning og karakterisering. Gyldendal 4. udgave, 1. oplag. Coomassie farvning af Proteiner i SDS gel Efter at have adskilt de forskellige bakterieproteiner efter størrelse, skal proteinerne gøres synlige, dette gøres ved at farve gelen med et farvestof der hedder Coomassie Brilliant Blue. Gelen der nu indeholder de separerede proteiner placeres i et kar med Coomassie, der trænger ind i gelen og binder stærkt til proteinerne. Efterfølgende affarves selve gelen, men farven der er bundet til proteinerne bliver, således at proteinerne nu træder frem på gelen som tydelige blå bånd. Den samlede mængde af bånd og hvordan de fordeler sig i gelen vil, som tidligere nævnt være specifikt for den enkelte bakteriestamme og herigennem afspejle bakteriens individuelle egenskaber (se Figur 3) Udvælgelse af protein og fordøjelse med trypsin Når proteinerne på gelen er farvede, kan der nu udvælges et eller flere bånd på gelen, som hver udelukkende indeholder proteiner af præcis samme længde. Efter udvælgelse af det bånd (og 6

7 dermed protein) man ønsker at undersøge, skæres båndet fysisk ud af gelen med en skalpel og proteinet, der er fanget i gelen, viderebehandles. Proteinet skal klippes i mindre stykker (peptider), for at peptid masse fordelingen kan give det fingeraftryk som vi bruger til at identificere proteinet. Dette gøres ved hjælp af enzymet trypsin, der specifikt klipper efter aminosyrerne lysin (forkortes Lys eller K) og arginin (forkortes Arg eller R). Der er dog en undtagelse i forhold til skæring. Hvis aminosyren ved siden af R eller K er Prolin (forkortes Pro eller P) så skærer trypsin ikke aminosyrekæden. Proteinet klippes/fordøjes efter samme princip som ved klipning af DNA med restriktionsenzymer (f.eks. EcoRI). Klipningen af proteinet med trypsin medfører en masse mindre peptider i størrelsesordnen Da (ca aminosyrer pr peptid). I denne protokol oprenses proteinet ikke inden det skæres, vi skærer det simpelthen inde i gelen og de mindre peptider diffunderer så ud i den omkringliggende væske (se Figur 3). Figur 3 Trypsin fordøjelse af udvalgt protein: 1) Et bånd udvælges fra SDS gelen og skæres ud med en skalpel. 2) Båndet skæres i mindre stykker for at få en større overflade på gelstykkerne. 3) Gelstykkerne vaskes flere gange i en acetonitril/vand blanding. Lige inden enzymet trypsin tilsættes, skrumpes gelen ekstra meget med 100% acetonitril, således at gelen kan opsuge så meget enzymblanding som muligt når det tilsættes. 4) Trypsin diffunderer ind i gelen og skærer proteinet i mindre peptider, som diffunderer ud af gelen og nu befinder sig i den vandige fase (i væsken). I det følgende forklares protokollen kort: 1) Man udvælger et bånd som principielt kun indeholder en slags protein. Dette bånd skæres ud af gelen. 7

8 2) Gelklumpen der nu indeholder det ønskede protein skæres i mindre stykker, så man får en større overflade. Dette er vigtigt, idet det skal være let at diffundere ind og ud af gelklumperne. 3) Gelklumperne vaskes i acetonitril, som er et organisk opløsningsmiddel, der skrumper gelen og dermed presser buffer, salte og coomassie farve ud af gelstykkerne (som når man vrider en svamp). Buffer og salte erstattes så af rent vand og acetonitril. Når gelklumperne er vasket 2 gange skrumpes de til sidst med 100% acetonitril, således at de er klar til at opsuge enzymet trypsin. 4) Trypsin tilsættes i en vandig buffer, som så opsuges af gelstykkerne, der svulmer op igen. Trypsin fordøjer vores protein, og de resulterende peptider diffunderer ud af gelstykkerne. Oprensning og opkoncentrering af peptider Når trypsin har skåret proteinet til peptider, findes peptiderne nu i den skæringsbuffer, der er omkring gelstykkerne, men denne væske indeholder også salte og andre stoffer, som vil forurene vores massespektrum. Derudover ønsker vi at have vores petider i et noget mindre væskevolumen, som vi så kan analysere. Derfor skal peptiderne nu oprenses og opkoncentreres. Dette gør vi på en μ-søjle (mikro-søjle, se Figur 4, venstre). Figur 4 Venstre: Hjemmelavet μ-søjle. Højre: Target plade hvorpå peptiderne sættes i en dråbe, efter oprensning og opkoncentrering. En μ-søjle er et meget tyndt rør, hvori der er en lille bitte smule materiale, der binder proteiner og holder dem tilbage, så man kan sortere peptiderne fra den væske de findes i. Protokollen beskrives kort i det følgende. Oprensning af peptider (illustreres i figur 5): 1) Peptiderne tilsættes til søjlen og fordi de hellere vil binde søjlematerialet end den vandige fase de er i, tilbageholdes de i søjlematerialet. 2) søjlen vaskes i en vandig opløsning af myresyre, der sikrer at peptiderne bliver siddende imens urenheder og salte vaskes væk. 3) peptiderne elueres, det betyder, at vi nu skyller peptiderne ud af søjlen ved at tilsætte noget, de hellere vil være i end søjlematerialet. I dette tilfælde er det opløsningsmidlet acetonitril (som vi 8

9 også brugte før til at skrumpe vores gel) iblandet vores matrix (beskrives under afsnittet Massespektrometri). Figur 5 Udsnit af den del af søjlen som indeholder søjlematerialet. Se forklaringerne på punkts 1-3 i teksten herover. Det 3. trin i protokollen, elueringen forgår direkte ud på MALDI target pladen, se figur 4 (højre). Der afsættes små dråber af peptidet, der nu er opløst i acetonitril og matrix i cirklerne på pladen, og efter at disse er tørret ind, kan prøverne behandles i massespektrometeret. Massespektrometri (MS) Principperne og apparaturet Når vi v.h.a. SDS har fået isoleret det ønskede protein og skåret det i peptider v.h.a. trypsin, er opgaven nu at få identificeret, hvilket protein vi har med at gøre. Hertil benytter vi massespektrometri, som er en meget følsom metode, hvor der kan arbejdes med prøvestørrelser på ned til picomol (10-12 mol). Derfor kan den ud over identifikation af proteiner også bruges til fx påvisning af pesticider i drikkevand og dopinganalyser. 9

10 Figur 6 Princippet i MALDI. Figur kopieret fra Rasmussen mfl. (2010) Proteiner oprensning og karakterisering. Gyldendal 4. udgave, 1. oplag Metoden bygger på, at molekylet under meget lavt tryk og ved høj temperatur bringes på gasform og dernæst ioniseres. I dette tilfælde bringes peptiderne på gasform ved at de indlejres i nogle krystaller, som absorberer laserens energi og omdanner den til varme når man skyder på peptiderne med en laser (se Figur 6 og 7). Idet matrixmolekylerne optager energien fra laseren eksploderer matrix krystallerne og slynger peptiderne ud i ioniseringskammerets vakuum. Her fordamper resten af matrix fra peptiderne og efterlader peptidet med en eller flere positive ladninger. Figur 7 Matrix (gul) med peptider (rød) indlejrede. Matrix eksploderes af laserens energi, således at peptiderne kommer op at svæve (kommer på gasfase) og får en positiv ladning. Figur venligst stillet til rådighed af Peter Højrup (professor ved Institut for Biokemi og Molekylærbiologi, SDU) Den kemiske ændring der sker med peptiderne, kan beskrives som følger: X (matrix) + M (prøve) + laser XH + + X + MH + 10

11 Herefter accelereres de ladede peptider ved at de udsættes for en spænding i flyverøret (se Figur 6), som trækker i deres positive ladning. Princippet er, at jo større et molekyle er, des lavere bliver dets hastighed, hvis det bliver trukket i med samme spænding. Det vil sige, at analysatoren (flyverøret) separerer de dannede ioner efter deres masse/ladningsforhold (m/z). Når de rammer detektoren, registreres deres flyvetid, og deres masse over ladning (m/z) beregnes. Resultatet vises i et spektrum hvor ioner (MH + ) med en bestemt m/z værdi vises som toppe med forskellig højde/intensitet (alt efter hyppigheden af ionen). MH + ionerne kaldes molekylærionerne. Peptidernes molekylær ioners (MH + ) vægt er præcis den, som kan beregnes ud fra deres aminosyresammensætning + 1 Dalton, (1 Dalton er vægten af en proton) som stammer fra den positive ladning peptidet modtog fra matrix. Ud over MH + ionen kan der også være række andre ioner som stammer fra at peptidet (eller hvad der nu analyseres) brydes op under ioniseringen (altså i ionkilden, se Figur 7). Disse ioner kan anvendes til at bestemme stoffets sammensætning, på samme måde som vi kan bestemme et protein ud fra dettes peptidsammensætning (se spektrum i Figur 8). Metoden kan ses live på nedenstående link, så du kan danne dig et overblik over metoden. Link 1 viser MS mere generelt, hvor ionerne afbøjes i deres bane og ud fra denne afbøjning identificeres, mens link 2 viser ideen i time-of-flight (TOF) som MALDI benytter sig af: 1. MS mere generelt (7,59 min) 2. TOF metoden (0,43 min) Videre analyse af proteinet: Når man ved hjælp af MALDI MS har fundet den eksakte molekylevægt på peptiderne sin peptidblanding, så kan denne data overføres til en række internetbaserede databaser, hvor der ligger information om utroligt mange molekyler, heriblandt proteiner. Så samholder man sin peptidsammensætning med databasen over teoretiske peptidstørrelser, som er beregnet ud fra kendskabet til proteinernes aminosyresekvens. På denne måde sammenligner man informationerne om sit eget protein (dettes peptid masse mønster), med databasen over alle kendte peptider på samme måde som man vil bruge et fingeraftryk i en forbryderdatabase. og her fra stammer så navnet på metoden: Peptid masse fingeraftryk (PMF) Hvis det er et helt ukendt protein man analyserer, altså et der ikke er sekventeret eller annoteret 6 endnu, er det stadigt muligt at få oplysninger om primær-, sekundær- og tertiær struktur, hydrofobe- samt hydrofile områder i molekylet og en masse mere, hvilket kan bringe en på sporet af nøjagtigt hvilket protein, man har isoleret og analyseret. Eller, informationerne kan give fingerpeg om, hvad det ukendte protein evt. kan have for funktion i en celle eller et organ. Dette kan være interessant f.eks. i forbindelse med giftstoffer eller udvikling af lægemidler. 6 Annoteret betyder at man ud fra Proteinets DNA sekvens har kategoriseret det som værende et bestemt protein, baseret på at dets sekvens ligner allerede kendte sekvenser fra undersøgte proteiner. 11

12 Øvelsesopgave 1: Identifikation af insulintype ved MALDI MS Følgende er et MALDI MS massespektrum fra et ukendt insulin. Ud fra vores teoretiske viden om insulins protein sekvens i forskellige organismer, kan vi identificere hvilket insulin der er tale om. Spørgsmål a Herunder er listet 4 rå aminosyre sekvenser på 4 insuliner. Skær insulinerne med trypsin (efter R og K, men ikke efter KP eller RP) og identificer dem i forhold til tabellerne med peptid sekvenser herunder. 1) MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN Insulinsekvens stammer fra 2) MAPPQHLCGSHLVDALYLVCGDRGFFYNPKGIVDQCCHRPCDIFDLQNYCN Insulinsekvens stammer fra 3) MALWMQCLPLVLVLLFSTPNTEALANQHLCGSHLVEALYLVCGDRGFFYYPKIKRDIEQAMG Insulinsekvens stammer fra 4) MAALWLQSVSLLVLLIVSWPGSQAFTPPQHLCGSHLVDALYLVCGDRGFFYNPKRDVDPLMG FLPPKADGAAGAGGENEVAEFAFKDQMEMMVKRGIVEQCCHKPCNIPVLQNYCN Insulinsekvens stammer fra Sekvenser af peptider skåret med Trypsin: > insulin - cod (TORSK) Område i sekvens MH+ Sekvens GFFYNPK GIVDQCCHRPCDIFDLQNYCN MAPPQHLCGSHLVDALYLVCGDR > insulin - Xenopus (FRØ) Område i sekvens MH+ Sekvens R IK DIEQAMG GFFYYPK MALWMQCLPLVLVLLFSTPNTEALANQHLCGSHLVEALYLVCGDR 12

13 > insulin - Micropterus salmoides (KARPE) Område i sekvens MH+ Sekvens R R GFFYNPK DQMEMMVK DVDPLMGFLPPK ADGAAGAGGENEVAEFAFK GIVEQCCHKPCNIPVLQNYCN MAALWLQSVSLLVLLIVSWPGSQAFTPPQHLCGSHLVDALYLVCGDR > insulin - Homo sapiens (MENNESKE) Område i sekvens MH+ Sekvens R R TR MALWMR GFFYTPK GIVEQCCTSICSLYQLENYCN EAEDLQVGQVELGGGPGAGSLQPLALEGSLQK LLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGER Spørgsmål b Hvilket dyr stammer nedenstående insulinspektrum fra: 13

14 Figur 8 Masse spektrum optaget med MALDI MS Spektret stammer fra: Andre massespektrometriske metoder Ved anvendelse af det MALDI-MS apparatur der bruges i vores forsøg, kan man ikke måle molekyler der er meget mindre end 500 Da. Men der findes andre typer massespektrometri, som typisk bruges i kemien til at identificere strukturen af ukendte eller nysyntetiserede kemiske stoffer (f.eks. aktive stoffer til nye lægemidler). Denne type massespektrometri frembringer en anden type spektre hvor toppene typisk ligger indenfor 150 Da. Som eksempel på et spektrum kan vi se på methanol (CH 3 OH), som er vist på Figur 9, og vi vil koncentrere os om de vigtigste toppe i spektret: 14

15 1. Den mest intense top har en m/z på 31, og de andre toppe er afbilledet relativt til denne. 2. Toppen på m/z 32 er vores molekylar-ion (M + ): CH 3 OH Denne ion er ustabil og vil fragmenteres på to måder og bliver til: m/z 15 CH 3 + og m/z 31 CH 2 OH + 4. Sidstnævnte ion kan igen fragmenteres og blive til: m/z 29 CHO + Dvs at et massespektrum giver informationer om, hvilke atomer eller atomgrupper, der indgår i molekylet samt stoffets molare masse. Figur 9 Methanols massespektrum, fra NIST Chemistry WebBook (http://webbook.nist.gov/chemistry) Isotoper: Et massespektrum kan også give information om et molekyle består af atomer, der findes som forskellige isotoper, og vi vil her kigge på et simpelt molekyle som HCL (se Figur 10) Man ser her 4 toppe på trods af, at det er et ret simpelt molekyle, der er analyseret, hvilket skyldes, at massespektrometeret kan skelne mellem ioner, der består af forskellige isotoper af samme grundstof. I dette tilfælde er det klor, der er tale om, da det i naturen findes som en blanding af isotoperne 35 Cl og 37 Cl i forholdet 3:1. Når man kigger på spektret, ser man derfor den mest intense top som m/z 36 (M + ), der skyldes H 35 Cl, som er ca. 3 gange så stor som m/z 38, der skyldes H 37 Cl. Den hyppigst forekommende isotop benyttes altid til beregning af M +. Hvis man slår den molare masse op for HCL så angives den til 36,461 g/mol, altså ikke som hverken 15

16 36 eller 38 g/mol. Det skyldes, at den molare masse angives som en middelværdi af de to isotopers masser i forhold til deres forekomst i naturen. Figur 10 Hydrogenchlorids (HCl) massesketrum (http://webbook.nist.gov/chemistry) Øvelsesopgave 2: Molekylebestemmelse ud fra massespektrometri Ud fra nedenstående spektrum, Figur 11, samt Figur 12 (hvor man ser typiske ionserier for en række funktionelle grupper), skal du forsøge at tyde spektret og angive hvilket molekyle, som er blevet analyseret vha. MS: Figur 11 Ukendt stof?? (http://webbook.nist.gov/chemistry) 16

17 Figur 12 Tabellen viser ionserier for en række funktionelle grupper, som består af en basision samt andre typiske toppe. Tabel kopieret fra S.U. Pedersen mfl. (2003) Spektroskopi molekylernes fingeraftryk. Kemiforlaget. 1. udgave, 1. oplag Litteraturliste L. Rasmussen mfl. (2010) Proteiner oprensning og karakterisering. Gyldendal 4. udgave, 1. oplag. K.C. Torp (2007) Biokemibogen liv, funktion, molekyle. Nucleus 1.udgave, 1. oplag. S.U. Pedersen mfl. (2003) Spektroskopi molekylernes fingeraftryk. Kemiforlaget. 1. udgave, 1. oplag. Billeder Animationer SDS-page 17

Analyse af proteiner Øvelsesvejledning

Analyse af proteiner Øvelsesvejledning Center for Undervisningsmidler, afdeling København Analyse af proteiner Øvelsesvejledning Formål At separere og analysere proteiner i almindelige fødevarer ved brug af gelelektroforese. Teori Alle dele

Læs mere

Intra- og intermolekylære bindinger.

Intra- og intermolekylære bindinger. Intra- og intermolekylære bindinger. Dipol-Dipol bindinger Londonbindinger ydrogen bindinger ydrofil ydrofob 1. Tilstandsformer... 1 2. Dipol-dipolbindinger... 2 3. Londonbindinger... 2 4. ydrogenbindinger....

Læs mere

Biotechnology Explorer. Protein Fingerprinting

Biotechnology Explorer. Protein Fingerprinting Biotechnology Explorer Protein Fingerprinting Instruktionsmanual Katalognummer 166-0100EDU explorer.bio-rad.com Delene i dette kit er sendt i seperate æsker. Opbevar proteinstandarderne i fryseren, ved

Læs mere

Teknikken er egentlig meget simpel og ganske godt illustreret på animationen shell 4-5.

Teknikken er egentlig meget simpel og ganske godt illustreret på animationen shell 4-5. Fysikken bag Massespektrometri (Time Of Flight) Denne note belyser kort fysikken bag Time Of Flight-massespektrometeret, og desorptionsmetoden til frembringelsen af ioner fra vævsprøver som er indlejret

Læs mere

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013 Proteiner: en introduktion Modul 1; F13 Rolf Andersen, 18/2-2013 4 facts om proteiner Proteiner udgør én af de vigtigste stofgrupper i vores organisme; de varetager en lang række forskellige funktioner.

Læs mere

Selvsamlende enkeltlag elevvejledning

Selvsamlende enkeltlag elevvejledning Nano ScienceCenter,KøbenhavnsUniversitet Selvsamlende enkeltlag elevvejledning Fremstilling af enkeltlag på sølv Formål I dette forsøg skal du undersøge, hvordan vand hæfter til en overflade af henholdsvis

Læs mere

PCR (Polymerase Chain Reaction): Opkopiering af DNA

PCR (Polymerase Chain Reaction): Opkopiering af DNA PCR (Polymerase Chain Reaction): Opkopiering af DNA PCR til at opkopiere bestemte DNA-sekvenser i en prøve er nu en af genteknologiens absolut vigtigste værktøjer. Peter Rugbjerg, Biotech Academy PCR (Polymerase

Læs mere

BIOTEKNOLOGI HØJT NIVEAU

BIOTEKNOLOGI HØJT NIVEAU STUDETEREKSAME 2006 2006-BT-2 BIOTEKOLOGI HØJT IVEAU Onsdag den 16. august 2006 kl. 9.00 14.00 Sættet består af 1 stor og 2 små opgaver. Alle hjælpemidler tilladt. STOR OPGAVE 1. Myoglobin A. Den røde

Læs mere

Protein syntese. return

Protein syntese. return Protein syntese. I artiklen redegøres for principperne i, hvordan octapeptidet SCHTFGDI kan syntetiseres. Som yderligere illustration heraf kan peptidet opbygges og visualiseres i Chem3D-Pro. Herved kan

Læs mere

Er der flere farver i sort?

Er der flere farver i sort? Er der flere farver i sort? Hvad er kromatografi? Kromatografi benyttes inden for mange forskellige felter og forskningsområder og er en anvendelig og meget benyttet analytisk teknik. Kromatografi bruges

Læs mere

Elektroforese. Navne: Rami Kassim Kaddoura Roman Averin Safa Sarac Magnus Høegh Jensen Frederik Gaarde Lindskov

Elektroforese. Navne: Rami Kassim Kaddoura Roman Averin Safa Sarac Magnus Høegh Jensen Frederik Gaarde Lindskov Elektroforese Navne: Rami Kassim Kaddoura Roman Averin Safa Sarac Magnus Høegh Jensen Frederik Gaarde Lindskov Klasse: 1.4 Fag: Biologi Vejleder: Brian Christensen Skole: Roskilde tekniske gymnasium, Htx

Læs mere

Studienummer: MeDIS Exam 2015. Husk at opgive studienummer ikke navn og cpr.nr. på alle ark, der skal medtages i bedømmelsen

Studienummer: MeDIS Exam 2015. Husk at opgive studienummer ikke navn og cpr.nr. på alle ark, der skal medtages i bedømmelsen MeDIS Exam 2015 Titel på kursus: Uddannelse: Semester: Videregående biokemi og medicinudvikling Bachelor i Medis 5. semester Eksamensdato: 26-01-2015 Tid: kl. 09.00-11.00 Bedømmelsesform 7-trin Vigtige

Læs mere

Isolering af DNA fra løg

Isolering af DNA fra løg Isolering af DNA fra løg Formål: At afprøve en metode til isolering af DNA fra et levende væv. At anvende enzymer.. Indledning: Isolering af DNA fra celler er første trin i mange molekylærbiologiske undersøgelser.

Læs mere

Fysikken bag hverdagens materialer.

Fysikken bag hverdagens materialer. Fysikken bag hverdagens materialer. Carsten Svaneborg, Lektor Institut for Fysik, Kemi og Farmaci Syddansk Universitetet Campusvej 55, 5320 Odense M zqex@sdu.dk Http://www.zqex.dk Oversigt Intro hverdagens

Læs mere

EKSAMENSSPØRGSMÅL Kemi C december 2016 Helsingør. Spørgsmål 1. Grundstoffer og det periodiske system

EKSAMENSSPØRGSMÅL Kemi C december 2016 Helsingør. Spørgsmål 1. Grundstoffer og det periodiske system EKSAMENSSPØRGSMÅL Kemi C december 2016 Helsingør Øvelse: Opløsningsmidlers egenskaber Spørgsmål 1 Grundstoffer og det periodiske system Forklar hvordan et atom er opbygget og hvad isotoper er. Grundstofferne

Læs mere

På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men

På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men skrevet hvorfra de er taget. De tre bøger, hvorfra illustrationerne

Læs mere

Proteinkarakterisering ved massespektrometri

Proteinkarakterisering ved massespektrometri Proteinkarakterisering ved massespektrometri - fra fødevarer til kræftforskning Af Mette Rindom Nørrelykke, Hans Peter Sørensen og Hans Christian Beck, Teknologisk Institut Viden om proteiner er vigtig

Læs mere

DNA origami øvelse 2013. DNA origami øvelse

DNA origami øvelse 2013. DNA origami øvelse DNA origami øvelse Introduktion I denne øvelse bruger vi DNA origami teknikken til at samle en tavle af DNA med dimensioner på 70 nm x 100 nm. Tavlen dannes af et langt enkeltstrenget DNA molekyle, der

Læs mere

Fremstilling af ferrofluids

Fremstilling af ferrofluids Fremstilling af ferrofluids Eksperiment 1: Fremstilling af ferrofluids - Elevvejledning Formål I dette eksperiment skal du fremstille nanopartikler af magnetit og bruge dem til at lave en magnetisk væske,

Læs mere

Undervisningsbeskrivelse for STX 2m Kemi B

Undervisningsbeskrivelse for STX 2m Kemi B Undervisningsbeskrivelse for STX 2m Kemi B Termin Afslutning i juni skoleår 13/14 Institution Marie Kruses Skole Uddannelse Fag og niveau Lærer(e) Hold STX Kemi A valgfag Hasse Bonde Rasmussen 3gKE Denne

Læs mere

Formål At analysere for myosin i muskelvæv fra fisk ved brug af western blotting

Formål At analysere for myosin i muskelvæv fra fisk ved brug af western blotting Center for Undervisningsmidler, afdeling København Western blotting Øvelsesvejledning Formål At analysere for myosin i muskelvæv fra fisk ved brug af western blotting Teori Proteomik er studiet af celleproteiners

Læs mere

Salte, Syre og Baser

Salte, Syre og Baser Salte, Syre og Baser Fysik/Kemi Rapport 4/10 2011 MO Af Lukas Rønnow Klarlund 9.y Indholdsfortegnelse: Formål s. 2 Salte og Ioner s. 3 Syrer og Baser s. 5 phværdi s. 5 Neutralisation s. 6 Kunklusion s.

Læs mere

Regnskovens hemmeligheder

Regnskovens hemmeligheder Center for Undervisningsmidler, afdeling København Regnskovens hemmeligheder Øvelsesvejledning Formål Et gen for et kræfthelbredende protein er blevet fundet i nogle mystiske blade i regnskoven. Forskere

Læs mere

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et:

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: F2011-Opgave 1. En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: Forward primer: 5 CC ATG GGT ATG AAG CTT TGC AGC CTT

Læs mere

Grundstoffer og det periodiske system

Grundstoffer og det periodiske system Grundstoffer og det periodiske system Gør rede for atomets opbygning. Definer; atom, grundstof, isotop, molekyle, ion. Beskriv hvorfor de enkelte grundstoffer er placeret som de er i Det Periodiske System.

Læs mere

Øvelser 10. KlasseCenter Vesthimmerland Kaj Mikkelsen

Øvelser 10. KlasseCenter Vesthimmerland Kaj Mikkelsen Indholdsfortegnelse Indholdsfortegnelse... 1 Bygning af et glucosemolekyle... 2 Bygning af et poly- sakkarid.... 3 Påvisning af glukose (1)... 4 Påvisning af glucose (2)... 5 Påvisning af disakkarider....

Læs mere

KROMATOGRAFI GENERELT OM GASKROMATOGRAFI

KROMATOGRAFI GENERELT OM GASKROMATOGRAFI KROMATOGRAFI Kromatografi betyder egentlig farvetegning, men ordet bruges nu om en række analysemetoder, som alle bygger på det princip, at forskellige stoffer har forskellig bindingsevne til en given

Læs mere

KEMI C. Videooversigt

KEMI C. Videooversigt KEMI C Videooversigt Afstemning og mængdeberegning... 2 Atomer og det periodiske system... 2 Forsøgsfilm... 2 Ioner og salte... 3 Molekyler... 3 Opløsninger og tilstandsformer... 3 Organisk kemi... 3 Redoxreaktioner...

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Termin Maj-juni 2016 Institution Favrskov Gymnasium Uddannelse Fag og niveau Lærer Hold stx Kemi A Trille Hertz Quist 3 kea Oversigt over gennemførte undervisningsforløb Titel

Læs mere

Det sure, det salte, det basiske Ny Prisma Fysik og kemi 9 - kapitel 1 Skole: Navn: Klasse:

Det sure, det salte, det basiske Ny Prisma Fysik og kemi 9 - kapitel 1 Skole: Navn: Klasse: Det sure, det salte, det basiske Ny Prisma Fysik og kemi 9 - kapitel 1 Skole: Navn: Klasse: Opgave 1 Den kemiske formel for køkkensalt er NaCl. Her er en række udsagn om køkkensalt. Sæt kryds ved sandt

Læs mere

Eksamensnummer. Multiple choice opgaver. Side 1 af 10. Hvert svar vægtes 1 point 1.1 A 1.2 E 1.3 C 1.4 B 2.1 F 2.2 C 2.3 D 3 D 4 E

Eksamensnummer. Multiple choice opgaver. Side 1 af 10. Hvert svar vægtes 1 point 1.1 A 1.2 E 1.3 C 1.4 B 2.1 F 2.2 C 2.3 D 3 D 4 E Multiple choice opgaver. Hvert svar vægtes 1 point Opgave Svar 1.1 A 1.2 E 1.3 C 1.4 B 2.1 F 2.2 C 2.3 D 3 D 4 E 5 C 6 B 7 B 8 C 9 B 10 E 11.1 A 11.2 A 11.3 I 12 E 13 E 14 A 15 A 16.1 K 16.2 A 16.3 M Side

Læs mere

Teori Hvis en aminosyre bringes til at reagere med natriumhydroxid, dannes et natriumsalt: NH 2

Teori Hvis en aminosyre bringes til at reagere med natriumhydroxid, dannes et natriumsalt: NH 2 Øvelser om aminosyrer og peptider Øvelse 2 Identifikation af et aminosyrehydrochlorid Formål Forsøgets formål er at undersøge et af tre forskellige aminosyrehydrochlorider, som udleveres til klassen. Identifikationen

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Termin hvori undervisningen afsluttes: maj-juni 2010 Københavns

Læs mere

Eksperimentelle øvelser, øvelse nummer 3 : Røntgenstråling målt med Ge-detektor

Eksperimentelle øvelser, øvelse nummer 3 : Røntgenstråling målt med Ge-detektor Modtaget dato: (forbeholdt instruktor) Godkendt: Dato: Underskrift: Eksperimentelle øvelser, øvelse nummer 3 : Røntgenstråling målt med Ge-detektor Kristian Jerslev, Kristian Mads Egeris Nielsen, Mathias

Læs mere

Brombærsolcellen - introduktion

Brombærsolcellen - introduktion #0 Brombærsolcellen - introduktion Solceller i lommeregneren, solceller på hustagene, solceller til mobiltelefonen eller solceller til den bærbare computer midt ude i regnskoven- Solcellen har i mange

Læs mere

Oversigt med forklaring over forskellige begreber

Oversigt med forklaring over forskellige begreber Oversigt med forklaring over forskellige begreber fra www.michaelfynsk.dk Til dette dokument tilhører en mappe med filer bl.a..exe-,.pdf- og.jpg-filer. Side 1 af 19 Indholdsfortegnelse Brintbinding (hydrogenbinding)

Læs mere

Reaktionsmekanisme: 3Br 2 + 3H 2 O. 5Br - + BrO 3 - + 6H + Usandsynligt at alle 12 reaktantpartikler støder sammen samtidig. ca.

Reaktionsmekanisme: 3Br 2 + 3H 2 O. 5Br - + BrO 3 - + 6H + Usandsynligt at alle 12 reaktantpartikler støder sammen samtidig. ca. Reaktionsmekanisme: 5Br - + BrO 3 - + 6H + 3Br 2 + 3H 2 O Usandsynligt at alle 12 reaktantpartikler støder sammen samtidig ca. 10 23 partikler Reaktionen foregår i flere trin Eksperimentel erfaring: Max.

Læs mere

Undervisningsbeskrivelse for STX 2t Kemi C

Undervisningsbeskrivelse for STX 2t Kemi C Undervisningsbeskrivelse for STX 2t Kemi C Termin Afslutning i juni skoleår 14/15 Institution Marie Kruses Skole Uddannelse Fag og niveau Lærer(e) Hold STX Kemi C Hasse Bonde Rasmussen 2t ke Denne undervisningsbeskrivelse

Læs mere

Spørgsmål 1 Den kemiske reaktion

Spørgsmål 1 Den kemiske reaktion Spørgsmål 1 Den kemiske reaktion Med udgangspunkt i eksperimentet Fyrfadslys ønskes der en gennemgang af modellen reaktionskemaet. Du skal endvidere inddrage forskellige typer af kemiske reaktioner i din

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Termin hvori undervisningen afsluttes: maj-juni 2012 Københavns

Læs mere

nano-science center københavns universitet BROMBÆRSOLCELLEN Introduktion, teori og beskrivelse

nano-science center københavns universitet BROMBÆRSOLCELLEN Introduktion, teori og beskrivelse nano-science center københavns universitet BROMBÆRSOLCELLEN Introduktion, teori og beskrivelse I dette hæfte kan du læse baggrunden for udviklingen af brombærsolcellen og hvordan solcellen fungerer. I

Læs mere

Bioteknologi A. Studentereksamen. Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares.

Bioteknologi A. Studentereksamen. Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares. Bioteknologi A Studentereksamen Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares. frs111-btk/a-31052011 Tirsdag den 31. maj 2011 kl. 9.00-14.00

Læs mere

Atomer er betegnelsen for de kemisk mindste dele af grundstofferne.

Atomer er betegnelsen for de kemisk mindste dele af grundstofferne. Atomets opbygning Atomer er betegnelsen for de kemisk mindste dele af grundstofferne. Guldatomet (kemiske betegnelse: Au) er f.eks. det mindst stykke metal, der stadig bærer navnet guld, det kan ikke yderlige

Læs mere

Faget bidrager til at give eleverne forudsætninger for ansvarlig og kritisk stillingtagen til anvendelse og udvikling af bioteknologi.

Faget bidrager til at give eleverne forudsætninger for ansvarlig og kritisk stillingtagen til anvendelse og udvikling af bioteknologi. Bioteknologi A 1. Identitet og formål 1.1 Identitet Bioteknologi er teknologisk udnyttelse af biologiske systemer til forskning, analyse, produktion og sygdomsbehandling. Bioteknologi tager udgangspunkt

Læs mere

Undervisningsbeskrivelse for STX 1m Kemi B

Undervisningsbeskrivelse for STX 1m Kemi B Undervisningsbeskrivelse for STX 1m Kemi B Termin Afslutning i juni skoleår 15/16 Institution Marie Kruses Skole Uddannelse Fag og niveau Lærer(e) Hold STX Kemi B Hasse Bonde Rasmussen 1mKe Denne undervisningsbeskrivelse

Læs mere

Oliekemi - intro til organisk kemi. Fødevarekemi - organisk kemi - del af SO (Sundhed) Salte - Ioner, opløselighed, mængdeberegninger og blandinger.

Oliekemi - intro til organisk kemi. Fødevarekemi - organisk kemi - del af SO (Sundhed) Salte - Ioner, opløselighed, mængdeberegninger og blandinger. Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin August 2014-maj 2015 Institution Københavns tekniske Skole - Vibenhus Uddannelse Fag og niveau Lærer(e) Hold

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Termin hvori undervisningen afsluttes: maj-juni, 2012 Skive

Læs mere

BIOZYMER ØVELSE 2 OPRENSNING AF PROTEINER

BIOZYMER ØVELSE 2 OPRENSNING AF PROTEINER BIOZYMER ØVELSE 2 OPRENSNING AF PROTEINER FAGLIG BAGGRUND Det forudsættes, at den grundlæggende teori bag rekombinant protein ekspression og proteinopresning er bekendt. For dette henvises til undervisningsmateriale

Læs mere

Undervisningsbeskrivelse for STX 1m Kemi B

Undervisningsbeskrivelse for STX 1m Kemi B Undervisningsbeskrivelse for STX 1m Kemi B Termin Afslutning i juni skoleår 14/15 Institution Marie Kruses Skole Uddannelse Fag og niveau Lærer(e) Hold STX Kemi B Hasse Bonde Rasmussen 1mKe Denne undervisningsbeskrivelse

Læs mere

Side 1 af 8. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. Maj 2013.

Side 1 af 8. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. Maj 2013. Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Maj 2013 Skive Tekniske Gymnasium HTX Kemi B Helle Ransborg

Læs mere

Biologi A stx, juni 2010

Biologi A stx, juni 2010 Biologi A stx, juni 2010 1. Identitet og formål 1.1. Identitet Biologi er læren om det levende og om samspillet mellem det levende og det omgivende miljø. Biologi er et naturvidenskabeligt fag med vægt

Læs mere

Spørgsmål 1. Øvelse: Kobber plus dibrom. Teori: Atomers opbygning.

Spørgsmål 1. Øvelse: Kobber plus dibrom. Teori: Atomers opbygning. Spørgsmål 1. Øvelse: Kobber plus dibrom. Atomers opbygning. Atomets struktur. Det periodiske system. Betydning af hovedgrupperne. Ædelgassernes elektronstruktur i den yderste skal. Dannelse af ioner og

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin August 2011-maj 2013 Institution Københavns tekniske Skole - Vibenhus Uddannelse Fag og niveau Lærer(e) Hold

Læs mere

1. Grundstoffer i mennesket og opbygningen af grundstoffernes periodesystem, herunder gennemgang af eksperimentet: Neutralisation

1. Grundstoffer i mennesket og opbygningen af grundstoffernes periodesystem, herunder gennemgang af eksperimentet: Neutralisation Overskrifter til kemispørgsmål, Kemi C 2012 1. Grundstoffer i mennesket og opbygningen af grundstoffernes periodesystem, herunder gennemgang af eksperimentet: Neutralisation 2. Grundstoffer i mennesket

Læs mere

Af lektor Pernille Harris

Af lektor Pernille Harris Af lektor Pernille Harris 58 59 Forståelse af hvordan biologiske molekyler, som for eksempel proteiner, fungerer og spiller sammen, er en vigtig del af den biokemiske forskning. En betydelig brik i dette

Læs mere

Fysikforløb nr. 6. Atomfysik

Fysikforløb nr. 6. Atomfysik Fysikforløb nr. 6. Atomfysik I uge 8 begynder vi på atomfysik. Derfor får du dette kompendie, så du i god tid, kan begynde, at forberede dig på emnet. Ideen med dette kompendie er også, at du her får en

Læs mere

Biokemi Udforsk livets kerne med en uddannelse i biokemi på Københavns Universitet

Biokemi Udforsk livets kerne med en uddannelse i biokemi på Københavns Universitet det natur- og biovidenskabelige fakultet københavns universitet Biokemi Udforsk livets kerne med en uddannelse i biokemi på Københavns Universitet Biokemi 1 kemi bioteknologi bioinformatik laboratoriearbejde

Læs mere

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer)

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer) Elevvejledning til det Virtuelle Kræftlaboratorium Det Virtuelle Kræftlaboratorium stiller krav til en grundig forståelse af det centrale dogme inden for molekylærbiologien, hvordan DNA oversættes til

Læs mere

Folkeskolens afgangsprøve Maj-juni 2006 Fysik / kemi - Facitliste

Folkeskolens afgangsprøve Maj-juni 2006 Fysik / kemi - Facitliste Folkeskolens afgangsprøve Maj-juni 2006 1/25 Fk5 Opgave 1 / 20 (Opgaven tæller 5 %) I den atommodel, vi anvender i skolen, er et atom normalt opbygget af 3 forskellige partikler: elektroner, neutroner

Læs mere

1. Atomteorien - samt øvelsen: Best af molarmasse for lightergas

1. Atomteorien - samt øvelsen: Best af molarmasse for lightergas Eksamensspørgsmål revideret 7/6 NW 1. Atomteorien - samt øvelsen: Best af molarmasse for lightergas Bilag: Det periodisk system. Du skal fortælle om atomets opbygning, om isotoper og naturligvis om begrebet

Læs mere

BIOTEKNOLOGI HØJT NIVEAU

BIOTEKNOLOGI HØJT NIVEAU STUDENTEREKSAMEN 2007 2007-BT-1 BITEKNLGI HØJT NIVEAU Torsdag den 31. maj 2007 kl. 9.00 14.00 Sættet består af 1 stor og 2 små opgaver samt 1 bilag i 2 eksemplarer. Det ene eksemplar af bilaget afleveres

Læs mere

Redoxprocessernes energiforhold

Redoxprocessernes energiforhold Bioteknologi 2, Tema 3 Opgave 8 Redoxprocessernes energiforhold Dette link uddyber energiforholdene i redoxprocesser. Stofskiftet handler jo netop om at der bindes energi i de organiske stoffer ved de

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj-juni 2015 Institution Herning Hf og VUC Uddannelse Fag og niveau Lærer(e) Hold HFe Kemi C Nis Bærentsen

Læs mere

10. juni 2016 Kemi C 325

10. juni 2016 Kemi C 325 Grundstoffer og Det Periodiske System Spørgsmål 1 Forklar hvordan et atom er opbygget og hvad isotoper er. Forklar hvad der forstås med begrebet grundstoffer kontra kemiske forbindelser. Atomer er placeret

Læs mere

Guldbog Kemi C Copyright 2016 af Mira Backes og Christian Bøgelund.

Guldbog Kemi C Copyright 2016 af Mira Backes og Christian Bøgelund. Guldbog Kemi C Copyright 2016 af Mira Backes og Christian Bøgelund. Alle rettigheder forbeholdes. Mekanisk, fotografisk eller elektronisk gengivelse af denne bog eller dele heraf er uden forfatternes skriftlige

Læs mere

[BESØGSSERVICE INSTITUT FOR MOLEKYLÆRBIOLOGI OG GENETIK, AU]

[BESØGSSERVICE INSTITUT FOR MOLEKYLÆRBIOLOGI OG GENETIK, AU] Enzymkinetik INTRODUKTION Enzymer er biologiske katalysatorer i alle levende organismer som er essentielle for liv. Selektivt og effektivt katalyserer enzymerne kemiske reaktioner som ellers ikke ville

Læs mere

Madkemi Kulhydrater: er en gruppe af organiske stoffer der består af kul, hydrogen og oxygen (de sidste to i forholdet 2:1, ligesom H 2

Madkemi Kulhydrater: er en gruppe af organiske stoffer der består af kul, hydrogen og oxygen (de sidste to i forholdet 2:1, ligesom H 2 Madkemi Kulhydrater: er en gruppe af organiske stoffer der består af kul, hydrogen og oxygen (de sidste to i forholdet 2:1, ligesom H 2 O); derfor navnet kulhydrat (hydro: vand (græsk)). fælles for sukkermolekylerne

Læs mere

Velkommen. Studieleder. Der er mulighed for at købe mad i kantinen Praktisk øvelse Stjepan Kracun - postdoc Andreas Blennow - Lektor

Velkommen. Studieleder. Der er mulighed for at købe mad i kantinen Praktisk øvelse Stjepan Kracun - postdoc Andreas Blennow - Lektor Velkommen Tom Hamborg Nielsen Studieleder Dias 1 Aktivitet Ansvarlig 9.30-9.45 Intro til Biologi-Bioteknologi-studiet Tom Hamborg Nielsen lektor 9.45-10.15 Forelæsning: intro til Enzymer Tom Hamborg Nielsen

Læs mere

Side 1 af 7. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. December 2013.

Side 1 af 7. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. December 2013. Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) December 2013 Skive Tekniske Gymnasium HTX Kemi B Trine Rønfeldt

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Termin hvori undervisningen afsluttes: maj-juni, 2012 Skive

Læs mere

Deoxyribonukleinsyre

Deoxyribonukleinsyre DNAs Forunderlige struktur Ved Rebecca E.-Sørensen stud.scient i medicinalkemi ved Aarhus Universitet Deoxyribonukleinsyre Strukturen af DNA findes af James D. Watson og Francis H. Crick i 1953 1 Nuklein

Læs mere

Hurtigt overblik Strækker sig fra biokemi og cellelære til sundhed og økologi.

Hurtigt overblik Strækker sig fra biokemi og cellelære til sundhed og økologi. Bioteknologi BioAktivator 1. udgave, 2014 ISBN 13 9788761635846 Forfatter(e) Troels Wolf, Henrik Falkenberg, Peder K. Gasbjerg, Henning Troelsen, Annette Balle Sørensen, Chris Østergaard, Bodil Junker

Læs mere

Brugsanvisning IVD Matrix HCCA-portioned

Brugsanvisning IVD Matrix HCCA-portioned Brugsanvisning IVD Matrix HCCA-portioned Rendyrket matrixsubstans til matrix-assisteret-laser-desorption-ionisering time-of-flight-massespektrometri (MALDI-TOF-MS). CARE- produkterne er designet til at

Læs mere

katalysatorer f i g u r 1. Livets undfangelse på et celluært plan.

katalysatorer f i g u r 1. Livets undfangelse på et celluært plan. Fra det øjeblik vi bliver undfanget i livmoderen til vi lukker øjnene for sidste gang, er livet baseret på katalyse. Livets undfangelse sker gennem en række komplicerede kemiske reaktioner og for at disse

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Sommer 2015 Institution 414 Københavns VUC Uddannelse Fag og niveau Lærer(e) Hold Stx Kemi B Merete Tryde

Læs mere

Side 1 af 7. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. Maj 2014.

Side 1 af 7. Undervisningsbeskrivelse. Stamoplysninger til brug ved prøver til gymnasiale uddannelser. Termin. Maj 2014. Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Maj 2014 Skive Tekniske Gymnasium HTX Kemi B Trine Rønfeldt

Læs mere

Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser

Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj/juni 2016 Institution Uddannelse Fag og niveau Lærer(e) Hold HF & VUC Nordsjælland - Helsingør HF enkeltfag

Læs mere

Oste-kemi. Størstedelen af proteinerne i mælken findes som små kugleformede samlinger, kaldet miceller.

Oste-kemi. Størstedelen af proteinerne i mælken findes som små kugleformede samlinger, kaldet miceller. Man behøver ikke at sætte sig ind i de mere tekniske eller kemiske forhold for at lave ost selv, men for dem som gerne vil vide mere om hvad der grundlæggende sker ved forvandlingen af mælk til ost, så

Læs mere

Projekt 4.10. Minamata-katastrofen. En modellering af ligevægt mellem lineær vækst og eksponentiel henfald

Projekt 4.10. Minamata-katastrofen. En modellering af ligevægt mellem lineær vækst og eksponentiel henfald Projekt 4.10. Minamata-katastrofen. En modellering af ligevægt mellem lineær vækst og eksponentiel henfald Der findes mange situationer, hvor en bestemt størrelse ændres som følge af vekselvirkninger med

Læs mere

1. Formål, fag og læringsmål

1. Formål, fag og læringsmål Den fagspecifikke del af STUDIEORDNINGEN for BACHELORUDDANNELSEN i BIOKEMI ved det Naturvidenskabelige fakultet Københavns Universitet (version 31/8 2009) 1. Formål, fag og læringsmål Bacheloruddannelsen

Læs mere

DNA-smykke Simpel ekstraktion af DNA fra kindceller fra mennesket, som er velegnet til at bruge i et halssmykke

DNA-smykke Simpel ekstraktion af DNA fra kindceller fra mennesket, som er velegnet til at bruge i et halssmykke 145678 John Schollar and Dean Madden National Centre for Biotechnology Education, University of Reading Science and Technology Centre, Earley Gate, Reading RG6 6BZ UK E: J.W.Schollar@reading.ac.uk Simpel

Læs mere

Undersøgelse af lyskilder

Undersøgelse af lyskilder Felix Nicolai Raben- Levetzau Fag: Fysik 2014-03- 21 1.d Lærer: Eva Spliid- Hansen Undersøgelse af lyskilder bølgelængde mellem 380 nm til ca. 740 nm (nm: nanometer = milliardnedel af en meter), samt at

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Hold Termin hvori undervisningen afsluttes: maj-juni 2014 Københavns

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj-juni 10/11 Institution Herning Hf og VUC Uddannelse Fag og niveau Lærer(e) Hold HFe Kemi C Flemming Madsen

Læs mere

Biotechnology Explorer

Biotechnology Explorer Biotechnology Explorer Oprensning af genomisk DNA fra plantemateriale Manual Katalog nr. 166-5005EDU explorer.bio-rad.com Oversat og bearbejdet af Birgit Sandermann Justesen, Nærum Gymnasium, februar 2009

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin August 2012-maj 2013 Institution Københavns tekniske Skole - Vibenhus Uddannelse Fag og niveau Lærer(e) Hold

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Termin hvori undervisningen afsluttes: maj-juni, 2013 Skive

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Termin hvori undervisningen afsluttes: maj-juni, 2013 Skive

Læs mere

Oxidationstal og elektronparbindinger December 2015

Oxidationstal og elektronparbindinger December 2015 idationstal og elektronparbindinger December 2015 idationstal og elektronparbindinger I redokemi findes en række simple regler, som gør det muligt at bestemme oidationstal for et atom i en kemisk forbindelse,

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Årstid/årstal Institution Maj-juni 2015 VUF - Voksenuddannelsescenter Frederiksberg Uddannelse Hf/hfe/hhx/htx/stx/gsk

Læs mere

Ernæring, fordøjelse og kroppen

Ernæring, fordøjelse og kroppen Ernæring, fordøjelse og kroppen Modul 4 Kernestof a) Kost & fordøjelse b) Kroppens opbygning & motion Mål med modulet Ernæring og fordøjelse At give kursisten vished om næringsstoffers energiindhold, herunder

Læs mere

Analyse af benzoxazinoider i brød

Analyse af benzoxazinoider i brød Analyse af benzoxazinoider i brød Øvelsesvejledning til kemi-delen af øvelsen. Af Stine Krogh Steffensen, Institut for Agroøkologi, AU Eleven har forberedt før øvelsen: 1. Eleven har udfyldt skemaet herunder

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin August 2013- Juni 2014 Institution Københavns Tekniske Skole - Vibenhus HTX Uddannelse Fag og niveau Lærere

Læs mere

Mundtlige eksamensopgaver

Mundtlige eksamensopgaver Mundtlige eksamensopgaver Kemi C 3ckecmh11308 Grundstoffer og det periodiske system Øvelse: Kobber + dibrom Spørgsmål 1 Forklar hvordan et atom er opbygget og hvad isotoper er. Grundstofferne er ordnet

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj-juni 2015 Institution Thy-Mors HF & VUC Uddannelse Fag og niveau Lærer(e) Hold HFe Kemi-C Gunnsteinn Agnar

Læs mere

Kvantitativ forsæbning af vindruekerneolie. Rapport nr. 1 1.9-2005

Kvantitativ forsæbning af vindruekerneolie. Rapport nr. 1 1.9-2005 Kvantitativ forsæbning af vindruekerneolie. Rapport nr. 1 1.9-2005 Skrevet af: Helene Berg-Nielsen Lærer: Hanne Glahder Formål: At bestemme vindruekerneolies gennemsnitlige molare masse, for derved at

Læs mere

Bestemmelse af koffein i cola

Bestemmelse af koffein i cola Bestemmelse af koffein i cola 1,3,7-trimethylxanthine Koffein i læskedrikke Læs følgende links, hvor der blandt andet står nogle informationer om koffein og regler for hvor meget koffein, der må være i

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Institution Uddannelse Fag og niveau Lærer(e) Maj-juni 2012 VUF - Voksenuddannelsescenter Frederiksberg HF-e

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Termin hvori undervisningen afsluttes: maj-juni 2013. Her efterår 2011 og forår 2012 Institution Københavns

Læs mere