NÅR KØNSNORMERNE LARMER

Størrelse: px
Starte visningen fra side:

Download "NÅR KØNSNORMERNE LARMER"

Transkript

1 NÅR KØNSNORMERNE LARMER - En kritisk diskursanalyse af, hvordan konstruktioner af maskulinitet influerer på unge mænds oplevelse af kærestevold Af: Amalie Frederikke Stender og Malene Laustsen Blædel Vejleder: Rikke Andreassen / Eksaminator: Christina Hee Pedersen Speciale: Kommunikation 2014 / Roskilde Universitet

2 Formalia Specialet fylder tegn, svarende til 83,92 normalsider. Herunder tælles en illustration af specialets indhold, en figur af Norman Faircloughs diskursmodel samt to billeder af kampagnen. Illustrationen af specialets indhold har vi vurderet til at svare til 370 tegn. Diskursmodellen har vi vurderet til at svare til 780 tegn, og de to billeder har vi vurderet til tilsammen at svare til 890 tegn. I alt fylder de tre modeller derfor tegn. Formidlingsprodukt Specialets formidlingsprodukt er en artikel, som findes sidst i specialet. Fordeling af afsnit Oversigten over opdelingen af specialets afsnit findes til sidst i specialet. Da vi begge har været involverede i alle dele af specialet, er opdelingen foretaget med udgangspunkt i, hvem der har udarbejdet den første kladde af afsnittet. Bilag Bagerst i specialet er vedlagt de bilag, vi finder vigtige for specialets gennemsigtighed.

3 Resumé This thesis concerns how discourses about masculinity influence the male victims of intimate partner violence and their experienced ability to seek help. Studies about intimate partner violence towards men show that the amount of male victims who experience intimate partner violence is increasing, whereas the amount of female victims is decreasing. However, there are still far more possibilities of getting professional help as a female victim of intimate partner violence. As an example, there are no shelters that specifically focus on male victims of intimate partner violence, and the few shelters for men that exist are in opposition to the women s shelters not state funded. In an attempt to reach the male victims, the Department of Equal Rights initiated a campaign in 2008 that focuses on both male and female victims of intimate partner violence between the ages of The campaign was developed in cooperation with The Crime Prevention Council and The National Organization of Women's Crisis Centres, LOKK, and the goals were to break the taboo that surrounds intimate partner violence for both young male and female victims. However, we find that parts of the campaign tend to favor the female victims by sustaining a specific discourse that positions men as violators and women as victims. On those grounds, our purpose with this thesis has been to shed light on those problematic aspects of the campaign, and also explore how the male target group experiences the campaign. This is done by two discourse analyses of respectively chosen aspects of the campaign, and a focus group interview with the target group. Since several studies on the subject show that especially male victims experience a taboo regarding intimate partner violence, we have focused on how our informants discursively construct the term Masculinity in their reaction to the campaign, and to intimate partner violence in general. By doing so, we wanted to disclose whether these constructions and discourses influenced their perceptions of intimate partner violence and of their reactions to the campaign. On the basis of our discourse analyses we have concluded that there seems to be certain kinds of discourses in both the campaign and among the informants which position men as violators

4 and women as victims. However, there appears to be a certain ambivalence among our informants regarding these discourses. This is reflected in the informants contradictory statements about both the campaign and their perceptions of intimate partner violence.

5 INDHOLDSFORTEGNELSE- KAPITEL-1- -INDLEDENDE-AFSNIT MOTIVATION-OG-PROBLEMFELT VORES-INTERESSE PROBLEMFORMULERING SPECIALETS-STRUKTUR-OG-AFGRÆNSNING BEGREBSAFKLARING DEFINITIONAFBEGREBET KÆRESTEVOLD KØNSBETEGNELSER... 7 KAPITEL-2- -TEORETISK-RAMME SOCIALKONSTRUKTIONISMENS-HOVEDTRÆK POSITIONERING NORMAN-FAIRCLOUGHS-KRITISKE-DISKURSANALYSE FAIRCLOUGHSDISKURSBEGREB FAIRCLOUGHSTREDIMENSIONELLEDISKURSMODEL INTERTEKSTUALITETOGINTERDISKURSIVITET IDEOLOGI HEGEMONI ANALYSEREDSKABER Modalitet Kohærens Præsupposition JUDITH-BUTLERS-KØNSTEORI KØNSOMSOCIALKONSTRUKTION KØNSOMPERFORMATIV KØNSOMNORM SAMMENFATNING-AF-DE-TRE-TEORETIKERE...21 KAPITEL-3- -METODE FOKUSGRUPPEINTERVIEWS UDVÆLGELSEAFINFORMANTER FREMGANGSMÅDE INTERVIEWENESINDHOLDOGSTRUKTUR REFLEKSIONEROVERVORESROLLERSOMINTERVIEWERE TRANSSKRIBERING KODNING,-KATEGORISERING-OG-BEGREBSLIGGØRELSE KODNING KATEGORISERING

6 3.2.3BEGREBSLIGGØRELSE FREMGANGSMÅDE METODISKE-REFLEKSIONER ATSKABEMENINGISINEMPIRI FORFORSTÅELSER KVALITETSSIKRING Reliabilitet Validitet Kvalitativgeneralisering...35 KAPITEL-4- -ANALYSER ANALYSE-AF-KAMPAGNEN DENBINÆREKØNSOPFATTELSE POSITIONERINGAFDETOKØN OPSUMMERING BLANDEDESIGNALER KAMPAGNENSFARVEVALG REFLEKSIONER-OVER-KAMPAGNENS-DISKURSIVE-PRAKSIS KAMPAGNENSAFSENDERE IKKEHDISKURSIVE-FORHOLD-I-DEN-SOCIALE-PRAKSIS ANALYSE-OG-FORTOLKNING-AF-FOKUSGRUPPEINTERVIEWENE AFSNITTETSUDFORMNINGOGDISPOSITION INFORMANTERNESOPLEVELSEAFKAMPAGNEN Kampagnensvisuelleudtryk Kampagnensindhold DOMINERENDEDISKURSER Diskurs1:Kunkvinderudsættesforkærestevold Diskurs2:Kærestevoldertabubelagt Diskurs3: Enrigtigmand SOCIALKONTROL $TEKST,DISKURSIVPRAKSISOGSOCIALPRAKSIS...89 KAPITEL-5- -KONKLUSION...91 LITTERATURLISTE

7 Kapitel-1- -Indledende-afsnit- 1.1-Motivation-og-problemfelt- Fænomenetpartnervolderikkenyt.Imangeårharderværetforskelligetiltag,derhar fokuseretpåemnet ogprimærtiforholdtilvoldmodkvinder(www.sibfolkesundhed.dk, partnervoldmodmænd:7).dogerderidesenereårkommetøgetfokuspå,atogsåmænd udsættesforpartnervold.blandtandetudgavstatensinstitutforfolkesundhedsidsteåren rapport,derviste,atantalletafpartnervoldsepisodermedmændsomofreersteget, hvorimodepisodernemedkvindeligeofreerfaldet(www.sibfolkesundhed.dk,voldinære relationer:14).samtidigsesogsåenudviklingilovgivningengennemdesenesteår,nårdet gælderfokuspåbeggekønsudsathediforbindelsemedpartnervold.denneudvikling afspejleseksempelvisiregeringensnationalehandlingsplanertilbekæmpelseafvolden, hvorpåtitlenharændretsiggennemårene.denførste,somudkomi2002,havdetitlen Regeringens$handlingsplan$til$bekæmpelse$af$vold$mod$kvinder,mensdennæstefra2005b2008 blevkaldthandlingsplan$til$bekæmpelse$af$mænds$vold$mod$kvinder$og$børn$i$familien. Slutteligtblevdensenestehandlingsplanfra2010benævntNational$strategi$til$bekæmpelse$af$ vold$i$nære$relationer(www.lige.dk,handlingsplan).denneudviklingafspejler,hvordan fokussetgennemdesenesteårharændretsigfrakunatværerettetmoddekvindelige voldsofretilogsåatomfattemændogbørn. Påtrodsafdenstigendeopmærksomhedpådemandligeofreforpartnervoldharde voldsramtemændikkesammerettighedersomdekvindelige.dettepåpegesblandtandeti rapportenpartnervold$mod$mænd$i$danmark,foretagetafstatensinstitutforfolkesundhedi 2012,someretinitiativunderdennationalestrategiforbekæmpelseafvoldinærerelationer 2010b2012(www.sibfolkesundhed.dk,partnervoldmodmænd:3).Irapportenkritiseresdet blandtandet,atdefåmandecentre,derfindesidanmark,ikkeeromfattetafserviceloven, somdedanskekvindecentreer(www.retsinformation.dk,serviceloven 109).Endvidere anfægtesdet,athverkenmandecentreneellerdetokrisecentreformænderspecifikt målrettetmodvoldsudsattemænd,samtatderikkegivessærligestøttetilbudtilde 3

8 voldsudsattebrugere,somdetertilfældetmedkvindecentrene(www.sibfolkesundhed.dk, partnervoldmodmænd:14). Vifinderdetbemærkelsesværdigt,atdenligestillingsdiskurs,dertrækkespåiregeringens nyestenationalehandlingsplantilbekæmpelseafvolden,såledesikkeafspejlersigidesociale tilbud,derydestildemandligeofreforpartnervold. Ifølgeovennævnterapportbetragtesdetafmangemændsomettabuatbliveudsatforvoldaf enkvinde,hvorfordeikkeønskeratståfremogindrømme,atdeerblevetudsatfor partnervold(www.sibfolkesundhed.dk,partnervoldmodmænd:9).irapportenfremgårdet desuden,atrisikoenforatbliveudsatforpartnervoldsommanderstørstialderen16b24 (www.sibfolkesundhed.dk,partnervoldmodmænd:12). I2008udgavStatensInstitutforFolkesundhedenrapportmedfokuspåkærestevold(wwwb sibfolkesundhed.dk,kærestevold).detteerdenførsterapportidanmark,sombehandler omfangetafkærestevold,hvorfokusliggerpåungemellem16b24år.rapportenviser,atca. 10%afungekvinderog4%afungemændåretforindenhavdeværetudsatforkærestevold. Samtidigviserundersøgelsen,atfærremændendkvinder,somerblevetudsatfor kærestevold,vælgeratanmeldevolden(wwwbsibfolkesundhed.dk,kærestevold:71).iden forbindelsekonkluderesdet,atemnetkærestevoldertabubelagt,ogatsærligtdeungemænd opleverdettetabu(ibid.).desudenfremgårdet,atbådeungekvinderogmændfinderfysisk voldfraenkvindemindrealvorligendfysiskvoldfraenmand.hvorkærestevoldudøvetaf mændfordømmes,syneskærestevoldudøvetafkvindersnarereatblivelatterliggjort(wwwb sibfolkesundhed.dk,kærestevold:10). Det$er$ganske$enkelt$uacceptabelt,$at$unge$kvinder$og$mænd$udsættes$for$vold$i$en$nær$ relation.$vold$i$de$unge$år$gør$det$sværere$at$sige$fra,$hvis$man$udsættes$for$vold$i$et$parforhold$ som$voksen.$så$en$indsats$mod$kærestevold$er$også$en$forebyggelse$af$vold$senere$i$livet$( ).$Med$ udgangspunkt$i$denne$rapport$og$de$unges$egne$udsagn$vil$jeg$øge$indsatsen.$jeg$lancerer$nu$et$ ungepanel,$som$skal$komme$med$forslag$til,$hvordan$vi$kan$øge$indsatsen$mod$kærestevold,$så$ unge$oplyses$om$dens$følger,$og$hvor$de$kan$søge$hjælp (wwwbsibfolkesundhed.dk,kærestevold:3b4). 4

9 SådanlyderforhenværendeministerforligestillingKarenJespersensreaktionpårapportens konklusioner.derforlanceredeligestillingsministerietpåbaggrundafdetnedsatte ungepanelsønskerogforslagi2009kampagnenditforhold.dk(www.ditforhold.dk). KampagnenblevtilisamarbejdemedDetkriminalpræventiveråd,Foreningenforbørnog ungeivoldsramtefamilieroglandsorganisationenafkvindekrisecentre(lokk).denhartil formålatgøreungeopmærksommepåkærestevoldfordermedatbrydetabuetomkring emnet.samtidigharkampagnensamletenrækkehjælpetilbudtilbådeungemændog kvinder.idéener,atmanvedoplysningomkærestevoldkanforebyggedennetypevold blandtungepar(www.ditforhold.dk,brydtabu). 1.2-Vores-interesse- Påtrodsafkampagnensmålomathenvendesigtilbeggekønervoresumiddelbareopfattelse dog,atdenihøjeregradhenvendersigtilungekvinder,ogatdenpåvisseområdersynesat positioneredetmandligekønsomvoldsudøverenogdetkvindeligekønsomofferet.det skyldesvisseafdevirkemidlerogdiskurser,vifinder,atkampagnentrækkerpå.viønsker derforviaendiskursanalyseatbelysedeelementerafkampagnen,somvifinder problematiskeiforholdtilkampagnensmulighedforatappelleretildenmandligedelafdens erklæredemålgruppe.daderikketidligereerlavetevalueringerafdennekampagne,ønsker viendvidereatspørgeselvedenmandligemålgruppe,hvordandeopleverkampagnen,davi jokunvedatspørgemålgruppenkanfåenindsigtidette. Eftersomrapportenkonkluderer,atdetisærerungemænd,derikkesøgerhjælp,ønskervii denforbindelseatsættefokuspåeventuellekønsforskelle,sommåttespilleindpåunge mændsforholdtilkærestevold.viønskernærmerebestemtatundersøge,omderernogle særligekønsnormer,somspillerind,nårdetkommertildeungemændsoplevelseaf kærestevoldsamtderesoplevedemulighederforatsøgehjælp samtomdetisåfaldhar indflydelsepå,hvordandeopleverkampagnenditforhold.dk.afdenneårsagvilvisættefokus på,hvordanbegrebetmaskulinitetopleves,forhandlesogitalesættesafmålgruppen.de pågældendeinteresseområderlederosfremtilfølgendeproblemformulering: 5

10 1.3-Problemformulering- Ud-fra-en-socialkonstruktionistisk-og-diskursanalytisk-tilgang-vil-vi-undersøge,- hvordan-begreberne- kærestevold -og- maskulinitet -konstrueres-i-kampagnen- Ditforhold.dk-samt-af-kampagnens-mandlige-målgruppe.-Herudover-vil-vi-undersøge,- hvilken-indflydelse-målgruppens-konstruktioner-af-maskulinitet-og-kærestevold-har-på- dennes-modtagelse-af-kampagnen Specialets-struktur-og-afgrænsning- Daviønskeratundersøge,hvordanbådekampagnenogmålgruppenkonstruerer maskulinitetogkærestevold,vilanalysenværetodelt.førstedelvilværeentekstnær diskursanalyseafudvalgteafsnitafkampagnen,somvifinderproblematiskeiforholdtil afsendernesambitionomatnådenmandligedelafmålgruppen.andendelafanalysenvil væreentekstnærdiskursanalyseaftrefokusgruppeinterviewsmedetudsnitafdenmandlige målgruppe.nedenforfølgerenillustrationsamtuddybningafspecialetsstruktur. Udoverindledningenerspecialetinddelti4hovedkapitler: Ikapitel-2vilviredegøreforspecialetssocialkonstruktionistiskeudgangspunkt.I forlængelseherafvilvipræsenteredeteorierindenfordennevidenskabsteoretiskeramme, somvibenytterianalyserne.detdrejersigomnormanfaircloughsdiskursanalyse,herunder hansdiskursmodel,judithbutlersteoriomkønsamtbronwyndavies&romharrésteoriom positionering. Ikapitel-3redegørviforvoresmetode.Afsnittetvilderforvise,hvordanviharproduceretog bearbejdetvoresempiri. Kapitel-4erdeltopitoanalyserafhenholdsviskampagnenogfokusgruppeinterviewene. 6

11 Ikapitel-5vilvisamleoppåspecialetscentralekonklusioneromkring,hvilkediskurservi identificererikampagnenogblandtinformanterne. 1.5-Begrebsafklaring- - Foratundgåuklarhederiforholdtilvoresanvendelseafvissebetegnelserfølgernedenforen Ditforhold.dkinformereromflereformerforkærestevold;bådefysisk,psykiskogseksuel vold(www.ditforhold.dk,etvoldeligtforhold).dagrænsernekanværeflydendeogsværeat adskilleskarpt,læggerviosikkefastpåenellerflereafvoldsformerne.nårvibruger betegnelsen kærestevold,dækkerdetsåledesoveralledisseformerforvold.viharsamtidig valgtatbegrænsevoresfokustilheteroseksuelleforhold.dettefordivimener,at inddragelsenafhomoseksuelleforhold,medvoreskønsteoriinmente,villekræveen selvstændiganalyse.foratholdeetskarptfokusharviderforvalgtatafgrænseosfradenne dimension.samtidigdefineresdetikkeikampagnen,hvorvidtdenomtalerbådeheterobog homoseksuelleforhold.desteder,hvorkampagnensætterkønpåaktørerneiet kæresteforhold,erdetdogheteroseksuelleforhold,derbeskrives. redegørelsefor,hvordanvidefinereroganvenderdisse Definition-af-begrebet- kærestevold Kønsbetegnelser- Kampagnenvekslerimellematbetegnekønnenesomhenholdsvis dreng / pige og mand / kvinde,oginformanternebrugerbetegnelserne dreng og pige.for overskuelighedensskyldharvivalgtkonsekventatbrugekønsbetegnelserne mand og kvinde.nårviundtagelsesvisbrugerbetegnelserne dreng eller pige,erdetiforbindelse medkonkretereferencertilkampagnenellerinformanternesudtalelser,hvordeto betegnelsertiltiderbenyttes. - 7

12 Kapitel-2- -Teoretisk-ramme- Alledeteoretikere,vibenytterosafiforbindelsemedanalysenafvoresproblemstilling,har dettilfælles,atdeindskriversigisocialkonstruktionismen.ifølgendekapitelintroducerervi derforhovedpræmisserneisocialkonstruktionismensomudlagtafpsykologoglektorvivien Burr. 2.1-Socialkonstruktionismens-hovedtræk--- Socialkonstruktionismenopfattersprogetsomværendecentraltforkonstruktionenafverden, idetdetersproget,dergiververdenbetydning(burr,2003:46).burrpræsentererisitværk Social$Constructionismfra2003firenøglepræmisser,somerfællesfordemangegreneaf socialkonstruktionismen. Denførstepræmiser,atsocialkonstruktionismenharenkritiskindstillingoverforobjektiv ogselvfølgeligviden(burr,2003:2b3).detteantibessentialistiskesynpåverdenbetyder,at denikkeharnogen essens ellerendegyldigsandhed(burr,2003:5).mankanderfor,ifølge socialkonstruktionismen,ikkeblotobservereverdenogdervedsedenssandenatur(burr, 2003:2b3).Vifinderdetteperspektivinteressantforvoresproblemstilling,idetdetmuliggør endybdegåendekritiskanalyseafdepotentiellediskursiveselvfølgeligheder,derkanliggei voreskulturomkringkøn,ogsompotentieltvillekunnefremkommeivoresinterviews. Denandenpræmiser,atmennesketsvidenomverdenerhistoriskogkultureltbetinget.Det vilsige,atdenmåde,manforstårverdenpå,afhængeraf,hvoroghvornårmanlever(burr, 2003:3b4).Eteksempelpådettekan,setirelationtilvoresproblemstilling,være,at definitionenafpartnervoldidanmarksomnævntharændretsiggradvistgennemårene, hvilketadflereomgangeharmedførtændringerilovgivningenomkringhjælpetilbud(afsnit 1.1,Motivationogproblemfelt). FordettredjeforklarerBurr,atdenmåde,viforstårverdenpå,opretholdesogskabesi socialeprocesser.detergennemdagligdagensinteraktioner,atmenneskerskaberviden (Burr,2003,5). 8

13 Denfjerdeogsidstepræmiser,atsocialehandlingerudspringerafsocialeverdensbilleder. Dereraltsåsocialekonsekvenserafdensocialekonstruktionafsandhedogviden(Burr, 2005:3).Trækkerviigenentrådtildettespecialesproblemstilling,kandetsiges,atmåden, hvorpådesocialeverdensbillederafpartnervolderkonstrueretidag,måskekanværeårsag til,atmangemændundladeratsøgehjælp. Medovenståendepræmisserharvihermedsatdenvidenskabsteoretiskerammeforspecialet. Idefølgendeafsnitvilderbliveredegjortfordeteorier,vibenytterianalyserne,ogsomalle hørerunderdenneramme. 2.2-Positionering- IfølgedetoprofessorerogforskereBronwynDavies&RomHarréersamfundetogindividet dialektiskforbundet.samfundetsforskelligediskurserindeholdernoglepraksisser,som menneskettilbydes,ogsomdetkanvælgeimellem mereellermindrefrit.dissepraksisser kaldessubjektpositioner,ogifølgedavies&harréerdetdissepositioner,sommennesket forstårbådesigselvogverdenudfra(davies&harré,1990:46).skalmanderforbeskrive, hvemenpersoner,kanvedkommendesigesatværesummenafdepositioner,hanellerhun vedkendersigiøjeblikket: Who$one$is$is$always$an$open$question$with$a$shifting$answer$ depending$upon$the$positions$made$available$within$one s$own$and$other s$discursive$practices $ (Davies&Harré,1990:46).Deforskelligesubjektpositionerskalforståssomdynamiskeog derformedmulighedforløbendeatkunneproduceresogforandres.eksempelviserderflere måder,hvorpåmankanværeenkæreste.mankanværeomsorgsfuldogkærligellermåske voldeligogdominerende.uansethvilkenafdissepositionermanvælger,kandenstadigsiges atpasseunderkategorienkæreste(veik,2008:29).ydermereharmanikkekunindflydelse pådenposition,manselvvælgeratindtage.mennesketharogsåihøjgradindflydelsepå andremenneskerssubjektpositioner,idetmanselvkanforsøgeatpositionereenanden.en personkanforeksempelforsøgeatpositionereenandensomunderdanig.vedkommende kansåentengodtagepositionenogeksempelvisadlydedenmindsteordre,ellerogsåkanhan afviseforsøgetpåpositionering,hvorefterenforhandlingafindbyrdespositionerkanopstå (Veik,2008:33).Detskalherunderstreges,atpositioneringerogforhandlingerneafdem langtfraaltiderintenderedehandlinger(ibid.). 9

14 Positioneringersker,ifølgeDavies&Harré,primærtgennem talehandlinger,someret begreb,deharadopteretfradenamerikanskesprogfilosofjohnsearl.searlsdefinitionaf talehandlingerdækkeroverudsagn,derudgørenhandlingisigselv(davies&harré,1990: 45).Eteksempelpåensådantalehandlingkanværeatlovenoget.Herikandernemligsigesat blivehandletiformafafgivelsenafdetpågældendeløfte.idavies&harrésegendefinition udbrederdebegrebettilogsåatdækkeovernonbverbalehandlinger.dedefinererdet nærmerebestemtsom: (...)$a$structured$set$of$speech$acts,$that$is$as$sayings$and$doings$of$ types$defined$by$reference$to$their$social$(illocutionary)$force (Davies&Harré,1990:43).Da positioneringererenvigtigdelafeventuelopretholdelseellerudfordringafdiskursen,vilvi undersøge,hvordanhenholdsviskampagnenoginformanterneforetagersådanne positioneringer.positioneringsbegrebetvildesudenkunneværegivtigtiundersøgelsenaf, hvordanmaskulinitetbliverkonstrueretikampagnenogafinformanterne. Medhenblikpåatkunnebelyseblandtandetsådannepositioneringerladerviosinspirereaf denkritiskediskursanalytikernormanfaircloughsdiskursanalytisketilgang.idetfølgende vilviredegøreforhansteori,samthvorforvifinderdenanvendeligforvoresundersøgelse. 2.3-Norman-Faircloughs-kritiske-diskursanalyse VifinderFaircloughsdiskursanalyseoplagtatbenytte,dahanmedsinvenstreorienteredeog humanistisketilgangsættersærligtfokuspåsocialeogsamfundsmæssigeulighederog magtbalancerisamfundet(fairclough,2008:8) hvilketerselvsammeproblematikker,som vieroptagedeafiforholdtilvoresproblemstilling.nærmerebestemtvilfaircloughs diskursanalysefungeresomanalytiskogmetodiskrammeforvoresanalyser. Førviredegørnærmereforhansdiskursanalytisketilgangogdeaspekterafden,viharfundet relevanteforvoresundersøgelse,vilvidogkortgøreredefor,hvordanvidefinererog anvenderhansdiskursbegrebivoresundersøgelse Faircloughs-diskursbegreb- IfølgeFairclougherdiskursbåde ( )$en$måde$at$handle$på,$en$form,$hvori$folk$kan$agere$i$ forhold$til$verden$og$særligt$i$forhold$til$hinanden,$og$en$måde$at$repræsentere$verden$på $ (Fairclough,2008:17).Diskurserhardermedogsåflerefunktioner;delserdemedtilat konstrueresåkaldte socialeidentiteter og subjektspositioner samtsocialerelationer 10

15 imellemmennesker,delsmedvirkerdetilatkonstruerevidensbogbetydningssystemer (Fairclough,2008:18).Faircloughsdefinitionafdiskursadskillersigdesudenfrablandtandet poststrukturalismensdiskursbegreb,idetdetermerelingvistiskfunderet.dettegør Faircloughsdiskursbegrebsærligtrelevantforos,davisombekendtønskeratanalysere tekstuddragafkampagnensamtvoresinterviews.diskursererifølgefaircloughdelvis bestemmendefor,ogdelvisbestemtaf,socialestrukturer(fairclough,2008:17).detskal forståspådenmåde,atdiskurserpådenenesideerkonstituerendefordesocialestrukturer, mensamtidigvilværebegrænsedeafselvsammestrukturer.derersåledestaleomet dialektiskforholdimellemdiskursogsocialstruktur(fairclough,2008:19).dettevilblive uddybetnærmereiforbindelsemeddenfølgendepræsentationaffaircloughsdiskursmodel Faircloughs-tredimensionelle-diskursmodel- Faircloughopstillerenmodelfordiskursanalysen,somvifindergivtigforvores diskursanalyser,idetdentilbyderenkonkretfremgangsmådefordiskursanalyse.denvil såledeskunnedannerammeomanalysensudformning.modellenbeståraftredimensioner, deralleskalmedregnesianalysenafenkommunikativbegivenhed.detredimensionerer henholdsvis tekst, diskursiv$praksis og social$praksis 1 (Fairclough,1995:98).Fairclough forklarervigtighedenafatinkluderealletredimensionerisinanalysemed,atdetikkeer hensigtsmæssigtatisolereselvetekstenfradediskursiveogsocialepraksisser.detteskyldes, atdetredimensionerindgårietdialektiskforhold,hvormeddeuundgåeligtvilpåvirke hinanden(fairclough,1995:9).faircloughuddybersammenhængenmellemdimensionerne således: Egenskaber$ved$sociokulturel$praksis$former$tekster,$men$de$gør$det$ved$at$sætte$ rammerne$for$den$diskursive$praksis$ $det$vil$sige$de$måder,$tekster$produceres$og$konsumeres$ på$ $som$igen$realiseres$i$tekstens$træk (Fairclough,2008:127). Foretagermanenisolering,vildetaltsåifølgeFaircloughresultereienmangelfuldanalyse,da mandervedmisterblikketforsammenhængenimellemdeenkeltedeleogdermed helhedsbilledetafdetpågældendefænomen,manønskeratundersøge. SamspilletmellemdetredimensionerillustrererFaircloughviafølgendemodel: 1 Fairclough veksler mellem at kalde sidstnævnte praksis for sociokulturel praksis og social praksis. For overskuelighedens skyld har vi valgt at holde os til betegnelsen social praksis. 11

16 Figur1:Faircloughstredimensionellediskursmodel. Tekst:Faircloughdefinerertekstbredtsom ( )$spoken$as$well$as$written$texts,$electronic$ texts,$and$ multiumodal $texts$which$combine$language,$image,$music,$body$language,$etc. (Fairclough&Fairclough,2012:82).Denbrededefinitionskyldes,atteksteridagens samfund,ifølgefairclough,ermultisemiotiske(fairclough,1995:4).mangetekster inkludereraltsåflereelementerpåsammetid,ligesomvoresudvalgtekampagnemateriale derindeholderskreventekst,symbolerm.m.tekstanalysenindebærertraditionelle elementerilingvistiskanalyse,herunderordvalg,grammatikogsemantik.derudover inddragesanalyseaftekstensoverordnedestruktur,samthvordansætningernehænger sammen.derskalaltsåbådefokuserespåtekstersbetydningogderesform(fairclough, 2008: ). Diskursiv$praksis:Herliggerfokuspå,hvordantekstenerproduceret,oghvordanden modtages(fairclough,2008:126).dennedimensionindebærerdesuden,hvordanden kommunikativebegivenhedtrækkerpåandrediskurser oghvordandissediskurser kommerfremiteksten(fairclough,2008:129). Social$praksis:Nårmankiggerpådensocialepraksis,foretagermanenanalyseafdenbredere kontekst,someksempelvisdensamfundsmæssigeogkulturelleramme(fairclough,2008: 130).NårFaircloughinddragerdensocialepraksis,inkludererhanogsåforhold,somhan 12

17 anserforikkebdiskursive.detgørhanudfradenoverbevisning,atdiskursbådereproducerer ogsamtidigformesafblandtandetikkebdiskursivestrukturer(fairclough,2008:17). Ihenholdtilvoresproblemstillingsesdetteeksempelvisvedlovgivningensindflydelsepåden måde,kampagnenditforhold.dkerudformetpå.nærmerebestemterdervisse lovgivningsmæssigeogpolitiskfunderedestrukturer,sommansomafsenderafenkampagne ernødttilatindordnesigefter,nårdetkommertilformidlingafkampagnensbudskab.som Faircloughforklarerdet, ( )$må$diskursens$konstituerende$ arbejde $nødvendigvis$foregå$ inden$for$de$begrænsninger,$som$de$sociale$strukturer$på$dialektisk$vis$determinerer$i$forhold$til$ diskursen $(Fairclough,2008:20).DogkritiseresFaircloughsskelnenmellemdetdiskursive ogdetikkebdiskursiveforatværeproblematiskrentteoretisk,dadetkanværevanskeligtat differentieredetdiskursivefradetikkebdiskursive(jørgensen&phillips,1999:101b102).i forholdtilovenståendeeksempelvilkritikkenderforvære,atetsamfundslovenetopikkeer naturgivne,menbyggerpåpolitiskekampeogdiskurser,somgennemhistorienhar gennemgåetkontinuerligetransformationer.selvomdeteksempelvisikkeisigselver diskursivt,atdererfærremandecentreendkvindecentre,kandisseforholdaltsåstadigsiges atberopådebagvedliggendepolitiskediskurser,derliggertilgrundfordenneorganisering. Påtrodsafkritikkenfindervidogdenneskelnenrelevantattagehøjdeforiforholdtilvores problemstilling netopfordivierafdenoverbevisning,atkampagnensbudskab(somer diskursivt)eftervoresoverbevisninghæmmesafvissebagvedliggendeikkebdiskursive omstændigheder.dettevilbliveuddybetnærmereikapitel$4$u$analyser. SomnævnterdetifølgeFaircloughvigtigt,atmanisindiskursanalyseharen helhedsorienterettilgangtildetredimensioner.dogmåmangernevægteenellerflereaf praksissernehøjere,afhængigtafhvilkenforskningsmæssiginteressemanhar,oghvilke analytiskeredskabermanbenytter(fairclough,2008:131).davoresforskningsinteresseikke ersociologisk,mentekstorienteretogdiskursanalytisk,vilvoresfokuspådensocialepraksis værebegrænsettilnoglefåelementer,somvifindervæsentligeforvoresdiskursanalyseaf henholdsviskampagnenogfokusgruppeinterviewene(afsnit4.3densocialepraksis).vægten vilsåledesliggepåtekstenogdendiskursivepraksisibeggeanalyser,ogdensocialepraksis vilkunmomentvisinddragessomenperspektiveringtildensamfundsmæssigekontekst. 13

18 2.3.3-Intertekstualitet-og-interdiskursivitet- Fairclougharbejdermedetbegreb,hankalder intertekstualitet,somogsåindgårianalysen afendiskursivpraksis(fairclough,2008:43).intertekstualitetgårudpå,attekster indeholderdeleafandreteksterellerrefererdertil: Det$kan$være$eksplicit$markeret$eller$ fusioneret$ind$i$teksten,$og$teksten$kan$forholde$sig$assimilerende,$modsigende,$ironisk$og$så$ videre$til$den$ anden $tekst $(Fairclough,2008:43).Såledeskanmantaleom,atenteksteren delafenslagskædeaftekster,deralleindeholderfragmenterafénellerflereandretekster (Ibid.).Faircloughintroducereriforlængelseherafbegrebetinterdiskursivitet. InterdiskursivitetudspringerafintertekstualitetogerifølgeFairclough ( )$an$endless$ combination$and$recombination$of$genres$and$discourses (Fairclough,1995:134). Interdiskursivitetgåraltsåudpå,atdertrækkespåeksisterendediskurserpånyemåder, hvilketpotentieltkanføretilforandringafdiskursen.vivilløbendeinddragebegrebeti analysenaffokusgruppeinterviewene.dettefordidetkanbelyse,hvordaninformanterne tydeligtrefererertilandrediskursiveforståelser;eksempelvisiforholdtilkampagnen, medierneetc Ideologi- Faircloughharsomnævntetvenstreorienteretoghumanistiskudgangspunktforsin diskursteori,hvilketkommertiludtrykvedhansinteresseiatdekonstrueredominerendeog undertrykkendediskurserietgiventsamfund.deteridenforbindelse,athaninddrager begrebet ideologi (Fairclough,2008:46).Faircloughbetegnerbegrebetsomkonstruktioner afverden,derermedvirkendetilatproducere,reproducereogforandredominansrelationer (Ibid.).Diskurserkanværemereellermindreideologiskinvesteredeogopstårsærligti samfund,somerprægetafdominansrelationerpåbaggrundafkøn,klasseogkulturelle grupper(fairclough,2008:51).ligesomdetkunermuligtatændreendiskurs,såfremt diskursenbliverblotlagt,erdetkun,nårmennesketeristandtilatsættesigudoverdisse grupperinger,atdetkanladesiggøreatsættesigudoverideologien(fairclough,2008:51). Faircloughpåstår,atderogsåeksistererdiskurser,somikkeerideologiske(Ibid.).Dettehar vidogsværtvedatfåøjepå,dadeteftervoresoverbevisningkanværevanskeligtatfinde eksemplerpådiskurser,somikkepådeneneellerdenandenmådekansigesatproducere, reproducereellerforandredominansrelationerihøjereellerlaveregrad.ianalysenafbåde 14

19 kampagnenogfokusgruppeinterviewenevilviforsøgeatbelysesteder,hvorideologier omkringkønsynesatspilleenvigtigrolle Hegemoni- SomledisindekonstruerendetilgangoperererFaircloughogsåmedbegrebet hegemoni. Dettebegrebskalforståssomenformfordominansogmagtindenforsåveløkonomiskesom politiske,kulturelleogideologiskedomænerisamfundet.hegemonierforsøgesopnåetviade evigestrategiskekampe,derfinderstedimellemforskelligeklasseroggrupper(fairclough, 1992:92),ogdeetablerespåbaggrundafindbyrdesalliancerimellemdisse(Fairclough, 2008:52og55).Dissehegemoniskekampe,hvorafalliancerneopstår,kanfindestedpåbåde mikrobogmakroniveau.ifølgefaircloughafhængerenetableringafhegemonierpået samfundsmæssigtplanaf,atderogsåkæmpeshegemoniskekamperentlokalt: $ Opnåelsen$af$hegemoni$på$samfundsniveau$kræver$en$grad$af$integration$af$lokale$og$ semiautonome$institutioner$og$magtrelationer$forstået$på$den$måde,$at$magtrelationerne$delvis$ formes$af$hegemoniske$relationer,$og$lokale$kampe$kan$tolkes$som$hegemoniske$kampe (Fairclough,2008:55). Derersåledestaleomenvisdialektikimellemdeoverordnedeoglokalehegemoniskekampe, hvilketigenhængersammenmeddetdialektiskeforholdimellemdendiskursivepraksisog densocialepraksisifaircloughstredimensionellediskursmodel(figur1:12).vedatanvende hegemonibegrebetfårmanmulighedforatanalysere,hvordandendiskursivepraksishænger sammenmeddenstørresocialepraksis,herunderdemagtrelationerderfindersted (Jørgensen&Phillips,1999:88).Denmulighedfindervisærligtrelevantiforbindelsemed analysenafvoresfokusgruppeinterviews.endiskursivpraksis(somfxet fokusgruppeinterviewerendelaf)kannemligsessometaspektafenhegemoniskkamp,som medvirkertilenreproduktionogtransformationafdenoverordnedediskursorden,deneren delaf(jørgensen&phillips,1999:88).hegemoniskediskurserkanoftesporesiudtalelser, somudlæggessom common$sense,idetderherliggerennaturaliseringafdenkonkrete antagelse(fairclough,2008:98).pådenmådevilvikunnesammenholdedeeventuelle hegemonieromkringmaskulinitet,viidentificererifokusgruppeinterviewet,medde hegemonier,vimeneratkunneidentificerepåetmereoverordnetsamfundsmæssigtplan.for atkunnegøredettevilviundersøge,hvordaneventuellehegemoniskekampeimellem 15

20 informanternekommertiludtryk,ogikkemindsthvilkediskurseromkringmaskulinitet,der eventueltmåttevindehegemonipåbaggrundafdissekampe Analyseredskaber- Faircloughlæggersomnævntvægtpåsprogetisindiskursanalytisketilgangogfokusereri denforbindelsesærligtpågrammatiskeoglingvistiskedetaljer,somermedtilatforme diskursenienhvertekst(fairclough,2008:13).viharudvalgtdeafhansanalytiskebegreber, vifinderhensigtsmæssigeiforholdtilundersøgelsenafvoresproblemstilling.dissebegreber vilbliveintroduceretidetfølgende &Modalitet& Begrebet modalitet henvisertilforfatterensgradaftilslutningtilteksten(fairclough,2002: 158).Modalitetkommertiludtrykvedhjælpafmodalverberne kunne, skulle, ville, måtte, burde, turde ogadverbiersom da, nok, vist og jo (GyldendalsEncyklopædi: modaliteter).derfindesdesudenbådesubjektivmodalitetogkategoriskmodalitet (Fairclough,2002:159).Foreksempelkanmansige Jegtror,atdetprimærterpiger,der bliverudsatforkærestevold.denneytringersubjektiv,hvorimoddetmedytringen Deter sandsynligvisprimærtpiger,derbliverudsatforkærestevold eruklart,hvismening,der bliverudtrykt.detkanværetalerensegenmening,ellertalerenkanytresigpåvegneafandre (Ibid.).Vedbrugafkategoriskmodalitetfremstillesytringenikkesomafsenderenssubjektive meningellerholdning,menfremlæggesistedetsomenobjektivsandhed.sætningen kærestevoldskerprimærtforkvinder ereksempelvismereobjektivenddetoovenstående eksempler.vedbrugafkategoriskmodalitetkanudsagnetdermedfremståsomenobjektiv, universelsandhed,hvilketendviderekanfremmeafsenderensautoritet(fairclough,1992: 159). Vifinderdetgivtigtatanvendemodalitetsomanalyseredskabibådevoresanalyseaf kampagnenogfokusgruppeinterviewene.ianalysenafkampagnenharmodalitetenbetydning for,hvordaninformationernebliverfremlagtafdennesafsendere,ogianalysenaf fokusgruppeinterviewenekanmanvedatanalyserepådeformerformodalitet,som informanterneanvender,undersøgegradenaftilslutningtilderesegneudsagn.hvis tilslutningenivissetilfældeerhøj,kandetværeudtrykfor,atdet,derudtrykkes,betragtes somcommonsense ognårnogetbetragtessomcommonsense,kandetværeudtrykfor,at 16

21 dertrækkespåenstærktetableretdiskurs,idetdetafafsenderenforventes,atmodtagerne forstårræsonnementet.davinetoperinteresseredeiatbelyse,hvilkediskurserkampagnen oginformanternetrækkerpå,ermodalitetsåledesetvigtigtredskab &Kohærens& Kohærens kommerafdetlatinskeordcohaerere,sombetyder hængesammen (Gyldendals encyklopædi,kohærens).kohærensbetegnerentekstsmeningspotentialeoganvendesderfor iforbindelsemedfortolkningsprocessen(fairclough,2008:42).enteksterkohærentidet omfang,atdenskonstituerendedelesammensættespåenmeningsfuldmåde,såtekstensom helhedgivermening.eksempelviskanmanopfattefølgendesætningersomkohærente: Peter ergåetfrakæresten.hanblevslået.dettefordimankanforetagedenslutning,atdet,atpeter blevslået,erårsagentil,athanergåetfrakæresten.foratkunneforetagedenneslutningsom modtagerkræverdetdogenindlejring,elleridetmindsteenindsigt,idendiskurs,somgør,at sætningernegivermeningsammen.somfaircloughudtrykkerdet,givertekstenkun ( )$ mening$for$den,$der$får$mening$ud$af$den,$den,$som$er$i$stand$til$at$inferere$de$meningsfulde$ relationer$i$fraværet$af$eksplicitte$markører (Fairclough,200842).Kohærenserderforet vigtigtanalyseredskabforosibådeanalysenafkampagnensamtfokusgruppeinterviewene. Meddetforøjekanvinemligidentificeretilfældeikampagnensamtiinformanternesudsagn, hvordisseeksplicittemarkørermangler,hvilketkanværeenindikationpå,atdertaleomen stærk,måskeenddahegemonisk,bagvedliggendediskurs.dettemåantages,iogmedatdet forventes,atmodtagerenselvfindersammenhængen.manundersøgerentekstskohærens vedatfokuserepåtekstens kohæsion (Fairclough,2008:34).Kohæsionhenvisertil,hvordan ledsætningerkoblessammenogigenkædessammenilængeretekstsekvenser(fairclough, 2008:34).Herunderdækkerbegrebetoverdesprogligekonnektorer,somgørteksten kohærent,såsom derfor, imidlertid og men (Ibid.).Eteksempelpåbrugenafdensproglige konnektor men,kanvære: Peterslogsinkæreste,menhunergåettilbagetilham.Ikraftaf konnektoren men liggerderunderforstået,atdetmestsandsynligevillevære,atpeters kæresteikkevargåettilbagetilham. Ivoresanalyseaffokusgruppeinterviewenevilviudbredebegrebetkohærenstilogsåat dækkesætningerytretafforskelligeinformanteridensammetalerække.detgørvipåden baggrund,atinformanternetiltiderfærdiggørhinandenssætninger,og,trodsfraværetaf eksplicittemarkører,synesatværeenigeomkringmeningenikædenafytringer. 17

22 &Præsupposition& En præsupposition erenformforimplicitbetydningspræmis,derafforfatterenafteksten antagessomenalleredeetableret sandhed (Fairclough,2002:120).Eteksempelherpåer ytringen: DetvarikkeOlesskyld,athanblevslåetafsinkæreste.Ytringenpræsupponerer, atoleblevslåetafsinkæreste deterumiddelbartikketildiskussion. Præsuppositionerkanogsåsessomenindirekteformforintertekstualitet.Dettefordien forfatterkanrefereretilandretekstermedenpræsupposition.foreksempelkansætningen: Selvom$flest$piger$er$udsat$for$kærestevold,$kan$det$også$ske$for$drenge $(www.ditforhold.dk, forside),sigesathenvisetiltidligereundersøgelser,derviser,atflestpigerbliverudsatfor kærestevold.ytringenpræsupponerer,atflestpigerbliverudsatforkærestevold,ogordet selvom erbådemedvirkendetilatfremhævedennepræsuppositionsamttilathenvisetil,at dererenandentekst,derviserdette.dapræsuppositionerkanafsløre,hvilkendiskursiv forståelseafsenderentrækkerpå,vilsådannepræsuppositionerværerelevanteforosatkigge efterianalyserne. 2.4-Judith-Butlers-kønsteori- Davisomendelafvoresdiskursanalyseønskeratbelyse,hvilkemaskulinitetsdiskurserder kommertiludtrykihenholdsviskampagnenoginterviewene,findervidetrelevantat inddragefilosofogkønsteoretikerjudithbutleroghendesteorieromkønsomensocial konstruktion.medbutlersteoriersomfundamenterdetmuligtforosatbelyse,hvilkeformer formaskulinitetderkonstrueresikampagnenogblandtinformanterneifokusgrupperne. Nærmerebestemtgiverdetosianalysenaffokusgruppeintervieweneetteoretiskgrundlag foratanalysere,hvordanforskelligediskurseromkønogmaskulinitetkommertiludtryki informanternesudsagnogindbyrdesforhandlinger Køn-som-social-konstruktion- Butlersudgangspunkterpoststrukturalistisk,ogenafhendeshovedpointerer,atkøneren socialkonstruktionogderforikke naturligt.butlerønskerderforatdekonstruere kønsbegrebetforatgivemulighedfor,atmåden,viforstårkønpå,kanudvides(butler2004: 43).Hunproblematiserersåledesdenbinæreforståelseafkøn: 18

23 (...)$a$restrictive$discourse$on$gender$that$insists$on$the$binary$of$man$and$woman$as$the$ exclusive$way$to$understand$the$gender$field$performs$a$regulatory$operation$of$power$that$ naturalizes$the$hegemonic$instance$and$forecloses$the$thinkability$of$its$disruption (Butler, 2004:43). Trodsenudbredtopfattelseaf,atdetsocialekønerenkulturelfortolkningafdetbiologiske køn,børbådedetsocialekønogdetbiologiskekønifølgebutleropfattessomsocialt konstrueret(butler,2007/1:46).detteforklarerhunmed,atopfattelsenafdetbiologiskekøn somnogetnaturgivent nogetsomdetsocialekønkantilskrivebetydning kunermuligtpå grundafdiskurserne.detbetyder,atdetbiologiskekønogsåbørforståssomsocialt konstrueret,ogatbetydningenafkøniprincippeterforanderligt.butlerforklarersinpåstand således: Socialt$køn$omfatter$også$de$diskursive/kulturelle$midler,$der$producerer$og$etablerer$ kønnet$ natur $eller$ naturligt$køn $som$ prædiskursivt,$dvs.$før$kultur,$en$politisk$neutral$overflade,$ hvorpå$kulturen$handler (Butler,2007/1:46). Detsocialekønogdetbiologiskekøneraltsåsammenhørende,dadetsocialekønikkekan eksistereudendetbiologiskekøn.enmandskropsligetegnharsåledesikkenogensærlig betydningisigselv,mentegnenetilskrivesbetydninggennemdetsocialekøn(ibid.). Mankanargumenterefor,atopfattelsenafdetsocialekønsomværendeenkulturel forlængelseafdetbiologiskekønihøjgradogsåertilfældetidanmark,ogendvidereatvisse egenskaberbetragtessomværende naturlige ellertangerendedetselvfølgeligeforbegge køn.blandtandeterdetenudbredtopfattelseivoreskultur,atmændfranaturenshånder stærkeogkanklarederesproblemerselv.detunderstøttesblandtandetirapporten Partnervold$mod$mændfra2012,somblevpræsenteretiindledningentilspecialet(www.sib folkesundhed.dk,partnervoldmodmænd:9).detskalherunderstreges,atbutlerikkeafviser mændogkvindersforskelligekropstegnseksistensisigselv,menblotmener,atbetydningen afdisseforskellealtsåerkultureltkonstruerede. Diskursensættersomnævntenrammefor,hvilkepositionervisomsubjekterhartilrådighed (afsnit2.2,positionering).dettegørsigogsågældende,nårdetkommertilspørgsmåletom maskulinitet.dererforskelligefaktorer,derdefinerer,hvorledeskønskategorierne mand og 19

24 kvinde gøres korrekt.ifølgebutlerforventesderatværeensammenhængmellembådeen personssocialeogbiologiskekønogmellemenpersonskønogseksuellepraksis: The$cultural$matrix$through$which$gender$identity$has$become$intelligible$requires$that$certain$ kinds$of$ identities $cannot$ exist $ $that$is,$those$in$which$gender$does$not$follow$from$sex$and$ those$in$which$the$practices$of$desire$do$not$ follow $from$either$sex$or$gender (Butler,2007/2: 24). Afvigermanformegetpåetellerflereafpunkterne,risikerermansåledesatvære uigenkendeligelleruforståeligiforholdtilkønsnormen(ibid.).detkanaltsåværetruendefor opfattelsenafenpersonskønsligegenkendelighed,hvisvedkommendeeksempelviserfødt medkvindeligtkropstegn,begærermænd,mensamtidigidentificerersigsomenmand Køn-som-performativ- IforlængelseafopfattelsenafkønsomværendesocialtkonstrueretforklarerButler,atvi såledesikkeeretkøn,mengøretkøn.idennesammenhængbenytterhunsigafbegrebet performativity (Butler,2004:218).Hunforstårkønsomenproces,dergårudpå,at individetkontinuerligtefterleverkønsnormenogpådennemådeopretholderden.medandre orddefinererhunkønsom: ( )$the$repeated$stylization$of$the$body,$a$set$of$repeated$acts$within$a$highly$rigid$regulatory$ frame$that$congeal$over$time$to$produce$the$appearance$of$substance,$of$a$natural$sort$of$being (Butler,2007/2:45). Butlerkalderdennekontinuerligeefterlevelsefor citational$practice (Butler,2004:218)og påpegeraltså,atdenkonstanteciteringafbestemtemåderatgøremandogkvindepå medførerenopfattelseafkønnenesegenskabersomværendenaturgivne.herkanman eksempelvistaleommåden,manbevægersigpå,mådenmantalerogklædersigpå,ogmåden manreagereriforskelligesituationerpå. IfølgeButlerskalciteringerneikkesidestillesmedefterligning.Tværtimoderderpladstil modifikationervedhverenkeltcitering(ibid.),ogdeterderformuligtforkønsnormenat ændresovertid.detkansammenlignesmedpositioneringsbegrebetogdesubjektpositioner, viindtager,somdervedmedvirkertilatopretholdekønsdiskursen(afsnit2.2,positionering). 20

25 Vifinderperformativitetsbegrebetrelevantatinddrageivoresanalyse,fordidetsætterfokus pådetenkeltemenneskesbehovforatleveoptilkønsnormen.deterisærrelevant,dadet somnævntervedkonstantciteringafkønsnormen,atdenopretholdes.vivilderforivores analyseaffokusgruppeintervieweneværeopmærksommepåsådanneciteringeri informanternesindbyrdespositioneringer Køn-som-norm- Butlerbeskriverkønsomen norm,oghundefinererennormsåledes: A$norm$is$not$the$ same$as$a$rule,$and$it$is$not$the$same$as$a$law.$a$norm$operates$within$social$practices$as$the$ implicit$standard$of$normalization $(Butler,2004:41). Ennormeraltsåetslagssætaf uskrevneregler.holdermansigindenfordisse,vilman såledeskunnebetragtessomgenkendeligog normaliseret manerindenfornormen.en normkanifølgebutlerværeeksplicitellerimplicitidensocialepraksis,ogdenormer,somer implicitte,kanafsammegrundværevanskeligeatafsløre(ibid.).kønkanihøjgradsessom enimplicitnormogfårdervedstatusafnoget selvfølgeligt (Butler,2004:42).Hermedfølger, atdet,derfalderudenfornormen,derforalligevelbliverdefineretiforholdtilnormen;det bliverenformforsammenligningsgrundlag.hvisenmandbliverbetegnetsomeksempelvis umandig,bliverhansåledesstadigdefineretudfradet,derbetegnesom mandig (Butler, 2004:42).Detterelationelleforholdsesogsåidetbinæreforholdmellemdetokøn.Som Butlersigerdet,ermankunsitkøn ( )$i$det$omfang,$at$man$ikke$er$det$andet$køn (Butler, 2007/1:67).Bådeikampagnenogifokusgruppeinterviewenevilviderforvære opmærksommepåeventuelle selvfølgeligheder ogsammenligninger,dadekanvidneom,at derernoglespecifikkenormerpåspil. 2.5-Sammenfatning-af-de-tre-teoretikere- Somnævntharalleovenståendeteoretikererødderidensocialkonstruktionistiske videnskabsteori,ogmeddettefællesudgangspunktkomplimentererdehinandenpåflere områder.hverafdetreteorierfokusererpåsærligeelementer,somvifinderrelevantei forholdtilvoresfokusområde.butlersættermedsinedekonstruerendeteorierkønnetiet socialkonstruktionistiskperspektiv,ogmedhendesbegreberomperformativitetogkønsom 21

26 norm,fårvimulighedforatidentificeredestederikampagnenoginformanternesudsagn, hvorderestrækkespåsærligekønsdiskurser.davies&harrépræsenterermedderes positioneringsteorinoglebegreber,dergørdetmuligtforosatbelyse,hvordan informanternepositionererhinandenirelationellermodsætningtileventuellekønsnormer. SlutteligttilbyderFaircloughnogleanalytiskeredskaber,somgørdetmuligtforosat dekonstruereteksterne,hvilketerenforudsætningforatkunneforetageengrundigog tekstnæranalyseafdediskurserogpositioneringer,somvisersigibådekampagnenog interviewene. 22

27 Nårmanønskeratudforskeetbestemtfænomen,erdetvigtigt,atdenmetodisketilgang,man benytter,stemmeroverensmedensinteresseområde(halkier,2002:26).daviønskerat findeudaf,hvordanungemændkonstruererogforhandlermaskulinitetogkærestevold,har vivalgtetkvalitativtdesign;nærmerebestemtharvisomnævntvalgtatforetage fokusgruppeinterviewsmedetudsnitafdenmandligedelafmålgruppen. Viharendviderehaftenabduktivtilgangtilvoresempiri,hvilketvilsige,atmansomforsker bevægersigfremogtilbagemellemeksisterendeteoriogdenproduceredeempiri(jensen 2002:265).Nærmerebestemtharvihaftvisseforforståelser,somviharønsketatundersøge (afsnit1.1,motivationogproblemfelt),samtidigmedatviharværetåbnefornyeerkendelser ogperspektiverpåemnet.dettefordiviikkeblotharønsketatverificereellerfalsificere voresegnehypoteser,menogsåatgivepladstilinformanternesperspektiver.dermedharvi væretåbnefor,atmaskulinitetsforståelsenmuligvisikkevillehaveligesåstorbetydningfor informanternesopfattelseafkampagnen,somantaget,hvilketvillehavenødvendiggjorten revurderingafvoresfokuspunkter.afdenneårsaglodvihellerikkemaskulinitetsbegrebet værestyrendeforvoresspørgsmåltilinformanterne.nærmereomkringvoresmetodiskevalg ogfremgangsmådervilblivepræsenteretidetfølgende. Kapitel-3- -Metode- 3.1-Fokusgruppeinterviews- Viharforetagettrefokusgruppeinterviewsmedungemændfrakampagnensmålgruppe.Vi harvalgtdenneinterviewform,fordiviharønsketatfåadgangtildeungemændsindbyrdes meningsudvekslingeromkringkampagnenogderesitalesættelserafkærestevold. Fokusgrupperersærligtvelegnedetilnetopdetteformål(Halkier,2002:13).Detskyldes, atdeltagerneherfårmulighedforatmeningsudveksleogudfordrehinandensforståelser, hvilketgiverosindbliki,hvordeerenigeelleruenige samthvilketankerderliggerbag deresudsagn.desudentvingesdeltagerneihøjeregradtilatekspliciterederesholdningerog pointer,idetdeskalgøresigforståeligeoverfordeandredeltagere.såledesfårmansom forskeradgangtildensåkaldte tavseviden imenneskerspraktiskebevidsthed(halkier, 2002:12b13).Dentavsevidendækkeroverdemereellermindreselvfølgelige 23

28 erfaringsbaseredeogdiskursiverepertoirer,somvimenneskertrækkerpåivores fortolkningeroghandlingeridagligdagen(halkier,2002:12).ifølgehalkierdækker diskursiverepertoirerogsåover ( )$større$komplekser$af$sociosproglige$forståelser,$der$er$ tilgængelige$i$samfundet (Halkier,2002:93).Vibetragterdermeddediskursiverepertoirer somværendeitrådmedfaircloughsteoriominterdiskursivitet(afsnit2.3.3intertekstualitet oginterdiskursivitet). Pådenmådegiverfokusgruppeinterviewetsommetodeosmulighedforatfåbelystså mangeaspekterafemnetsommuligt,herunderforskelligediskursiveforståelserog forforståelser,visomforskeremåskeikkeselvharhaft(halkier,2008:14) Udvælgelse-af-informanter- Daformåletmedfokusgruppeintervieweneeratbelyse,hvordankampagnenoplevesaf målgruppen,erdetoplagtfordetførsteatinterviewedenmålgruppe,somkampagnener tiltænkt.idettetilfældeungemellem14og24(www.voldsforebyggelse.nu,kampagnens målgruppe).idettespecialefokuserervisomnævntdesudenpåkærestevoldmedmændsom ofre,ogviønskeratundersøge,hvordandenmandligedelafmålgruppenopleverkampagnen. Viharpåbaggrundafovenståendekriteriervalgtatforetagevoresinterviewsmedmandlige efterskoleeleverialderen16b17år.atvivælgeratinterviewedenyngredelafmålgruppen skyldes,atdetirapportenomkærestevoldkonkluderes,atderbørsættesindtidligt,hvorfor kampagnenogsåerdesignettilatkunnefungereiundervisningssammenhæng (www.ditforhold.dk,undervisning).enaffordelenevedatintervieweefterskoleeleverfrem foreleverfraenalmindeligfolkeskoleelleretalmentgymnasiumerdesuden,atelevernepå enefterskoletypiskkommerfraforskelligedeleaflandet.viantager,atdengeografiske forskelgivermulighedforstørrediversitetidereserfaringerogdermedideresreaktionerpå kampagnen.vierdogopmærksommepå,atdenempiri,viproducerer,ikkeerrepræsentativ, hvilkethellerikkeerformåletmedvoresinterviews.deterdogvigtigt,atmaneranalytisk selektivikvalitativeundersøgelser,ogatmanderforudvælgersineinformanterudfraen vurderingaf,hvilkeforholdderkanværevæsentligefor,atmanfårundersøgtdet,man ønskeratundersøge(halkier,2002:30).eftersomefterskoleeleverneborsammenpåskolen ogdermedtilbringerenstordelafderesskolebogfritidsammen,formodervidesuden,atdet viløgemulighedenforatskabeentrygatmosfære.netoptryghedervigtigt,dadetkanhave 24

29 betydningfor,hvorvidtalleinformanternetøratudtalesig(halkier,2002:32) særligtnår detgælderetfølsomtemne,somkærestevoldkansigesatvære. NærmerebestemtharvivalgtSvenstrupEfterskole,somliggeriSvenstrup,lidtudenfor Næstved.Denpågældendeefterskoleervalgtudfrafå,menforosvigtige,kriterier.Detene kriteriumharværet,atefterskolenskullehuse8.b10.klasseforatgøredetmuligtforosat intervieweeleverpådeforskelligealderstrin.detandetkriteriumharværet,atskolenskulle være ( )$fri$for$religiøse$og$politiske$forpligtelser,somdetformulerespåsvenstrup Efterskoleshjemmeside(www.svenstrupbefterskole.dk).Foratundgåatensærligreligiøs ellerpolitisklinjeskulleprægeinterviewenesrammerellerindhold,hardetværetvigtigtfor osatfindeenefterskole,somstilledesigneutraltiforholdtildissespørgsmål.ydermere ønskedevisåvidtmuligtogsåenefterskole,somhavdeetbredtudbudaflinjefagmed.dette ønskedevimedhenblikpåensåstordiversitetmellemelevernesommuligt.dadefleste efterskolerseleverkommerfraforskelligestederilandet,harvifundetselveefterskolens beliggenhedmindrevigtig.vivalgtederforefterskolensbeliggenhedudfralogistiskeog transportmæssigekriterier,velatmærkeindenfordealleredenævntekriterier. Strategienforudvælgelsenafvoresinformanterbyggerpåønsketomatarbejdemeden netværksgruppe.fordideungemændkenderhinandeniforvejen,kandetnemligøgefølelsen aftryghedmellemdem,hvilketmansominterviewerbørtilstræbe(halkier,2008:30).da informanternesesdagligtpåefterskolen,vildesåledesogsåhaveetforholdtilhinandenefter fokusgruppeinterviewene.dettekanmedvirketil,atinformanterneudfordrerdeandres udtalelser,hvisdisseliggerlangtfra,hvaddesædvanligvissigeroggør(ibid.).vimenersom nævnt,atemnetkærestevoldkanværefølsomt.selvominformanterneikkedirektebliver spurgtindtilegneeventuelleerfaringermedkærestevold,vurderervidog,atdeterenfordel, atdekenderhinandenogertryggeihinandensselskabunderfokusgruppeinterviewet. Enulempevedbrugafnetværksgrupperkandog,ifølgeHalkier,værerisikoenfor,at deltagerneopførersigeftereventuelle dominansurelationer (Ibid.).Foreksempelkandet forekomme,atenafdeungemændharenhøjeresocialstatusenddeandre,hvorveddekan havesværtvedatudfordrehansforståelserogmeninger.iforholdtilvores forskningsinteressemenervidog,atsådannedominansrelationerkanværeinteressanteat belyse.dettefordiviharetdiskursanalytiskfokusognetopderforønskeratundersøge, 25

NOTIFICATION. - An expression of care

NOTIFICATION. - An expression of care NOTIFICATION - An expression of care Professionals who work with children and young people have a special responsibility to ensure that children who show signs of failure to thrive get the wright help.

Læs mere

Bilag. Resume. Side 1 af 12

Bilag. Resume. Side 1 af 12 Bilag Resume I denne opgave, lægges der fokus på unge og ensomhed gennem sociale medier. Vi har i denne opgave valgt at benytte Facebook som det sociale medie vi ligger fokus på, da det er det største

Læs mere

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov.

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. På dansk/in Danish: Aarhus d. 10. januar 2013/ the 10 th of January 2013 Kære alle Chefer i MUS-regi! Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. Og

Læs mere

Sport for the elderly

Sport for the elderly Sport for the elderly - Teenagers of the future Play the Game 2013 Aarhus, 29 October 2013 Ditte Toft Danish Institute for Sports Studies +45 3266 1037 ditte.toft@idan.dk A growing group in the population

Læs mere

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred Kandidatuddannelsen i Folkesundhedsvidenskab Aalborg Universitet 1. Semester projekt Gruppe nummer: 755 Vejleder: Henrik Bøggild

Læs mere

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen The X Factor Målgruppe 7-10 klasse & ungdomsuddannelser Engelskundervisningen Læringsmål Eleven kan give sammenhængende fremstillinger på basis af indhentede informationer Eleven har viden om at søge og

Læs mere

Design til digitale kommunikationsplatforme-f2013

Design til digitale kommunikationsplatforme-f2013 E-travellbook Design til digitale kommunikationsplatforme-f2013 ITU 22.05.2013 Dreamers Lana Grunwald - svetlana.grunwald@gmail.com Iya Murash-Millo - iyam@itu.dk Hiwa Mansurbeg - hiwm@itu.dk Jørgen K.

Læs mere

Bilag 1: Ekspertinterview m. Karen Sjørup

Bilag 1: Ekspertinterview m. Karen Sjørup Bilag 1: Ekspertinterview m. Karen Sjørup Vi har haft en mailkorrespondance med Lektor fra Roskilde Universitet Karen Sjørup, hvoraf vi har anvendt en række citater. Denne vil fremgå i det følgende afsnit.

Læs mere

Indhold 1. INDLEDNING...4

Indhold 1. INDLEDNING...4 Abstract This thesis has explored the hypothesis that emotional dysregulation may be involved in problems with non response and high dropout rates, which are characteristicofthecurrenttreatmentofposttraumatic,stressdisorder(ptsd).

Læs mere

Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk

Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk Medborgerskabets fire dimensioner (ifølge G. Delanty, 2000) Rettigheder Pligter Deltagelse

Læs mere

Domestic violence - violence against women by men

Domestic violence - violence against women by men ICASS 22 26 august 2008 Nuuk Domestic violence - violence against women by men Mariekathrine Poppel Email: mkp@ii.uni.gl Ilisimatusarfik University of Greenland Violence: : a concern in the Arctic? Artic

Læs mere

Learnings from the implementation of Epic

Learnings from the implementation of Epic Learnings from the implementation of Epic Appendix Picture from Region H (2016) A thesis report by: Oliver Metcalf-Rinaldo, oliv@itu.dk Stephan Mosko Jensen, smos@itu.dk Appendix - Table of content Appendix

Læs mere

Bilag. Indhold. Resumé

Bilag. Indhold. Resumé Bilag Indhold Resumé... 1 Abstract... 2 Indgang og ventetid... 3 Resumé Dette projekt forklarer, hvilke værdier samfundet er udviklet igennem, og hvordan disse har haft en effekt på individet. For at gøre

Læs mere

Skriftlig Eksamen Kombinatorik, Sandsynlighed og Randomiserede Algoritmer (DM528)

Skriftlig Eksamen Kombinatorik, Sandsynlighed og Randomiserede Algoritmer (DM528) Skriftlig Eksamen Kombinatorik, Sandsynlighed og Randomiserede Algoritmer (DM58) Institut for Matematik og Datalogi Syddansk Universitet, Odense Torsdag den 1. januar 01 kl. 9 13 Alle sædvanlige hjælpemidler

Læs mere

IAIMTE 2015 Mønstre og perspektiver i den internationale forskning sammenholdt med danskdidaktisk forskning

IAIMTE 2015 Mønstre og perspektiver i den internationale forskning sammenholdt med danskdidaktisk forskning IAIMTE 2015 Mønstre og perspektiver i den internationale forskning sammenholdt med danskdidaktisk forskning Hver enkelt ytring er naturligvis individuel, men enhver sfære inden for sprogbrugen udvikler

Læs mere

Bookingmuligheder for professionelle brugere i Dansehallerne 2015-16

Bookingmuligheder for professionelle brugere i Dansehallerne 2015-16 Bookingmuligheder for professionelle brugere i Dansehallerne 2015-16 Modtager man økonomisk støtte til et danseprojekt, har en premieredato og er professionel bruger af Dansehallerne har man mulighed for

Læs mere

Tea Party - skabelsen af en magtfaktor

Tea Party - skabelsen af en magtfaktor Tea Party - skabelsen af en magtfaktor Skrevet af: Camilla Louise Grandt, Caroline Elmquist-Clausen, Johannes S. Schultz-Lorentzen og Lars Asbjørn Holst Projekttitel: Tea Party skabelsen af en politisk

Læs mere

Børn under et nyt paradigme? Børnekultur som begreb og virkelige greb

Børn under et nyt paradigme? Børnekultur som begreb og virkelige greb MalmöHögskola Kulturochsamhälle(K3) Kultur ochmedieproduktion2008 Børn under et nyt paradigme? Børnekultur som begreb og virkelige greb AfLouiseLidangKrøyer Englishtitle: Kidsunderanewparadigm? Conceptsandpracticesofchildren

Læs mere

Brug sømbrættet til at lave sjove figurer. Lav fx: Få de andre til at gætte, hvad du har lavet. Use the nail board to make funny shapes.

Brug sømbrættet til at lave sjove figurer. Lav fx: Få de andre til at gætte, hvad du har lavet. Use the nail board to make funny shapes. Brug sømbrættet til at lave sjove figurer. Lav f: Et dannebrogsflag Et hus med tag, vinduer og dør En fugl En bil En blomst Få de andre til at gætte, hvad du har lavet. Use the nail board to make funn

Læs mere

Trolling Master Bornholm 2016 Nyhedsbrev nr. 7

Trolling Master Bornholm 2016 Nyhedsbrev nr. 7 Trolling Master Bornholm 2016 Nyhedsbrev nr. 7 English version further down Så var det omsider fiskevejr En af dem, der kom på vandet i en af hullerne, mellem den hårde vestenvind var Lejf K. Pedersen,

Læs mere

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com.

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com. 052430_EngelskC 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau C www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen. og

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen.  og 052431_EngelskD 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau D www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen Øjnene, der ser - sanseintegration eller ADHD Professionshøjskolen UCC, Psykomotorikuddannelsen Professionsbachelorprojekt i afspændingspædagogik og psykomotorik af: Anne Marie Thureby Horn Sfp o623 Vejleder:

Læs mere

To kontrolafgifter på hver 750 kr. ialt 1500 kr., idet klagerne alene havde billetteret for deres cykler og ikke for sig selv.

To kontrolafgifter på hver 750 kr. ialt 1500 kr., idet klagerne alene havde billetteret for deres cykler og ikke for sig selv. 1 AFGØRELSE FRA ANKENÆVNET FOR BUS, TOG OG METRO Journalnummer: 2013-0291 Klageren: XX og XX 8501 Bissegem, Belgien Indklagede: Metroselskabet I/S v/metro Service A/S CVR: 21 26 38 34 Klagen vedrører:

Læs mere

Tanker omkring en dansk uddannelse i bæredygtighed baseret på erfaringer fra Ecovillage Design Education (EDE) i Hallingelille, august 2012

Tanker omkring en dansk uddannelse i bæredygtighed baseret på erfaringer fra Ecovillage Design Education (EDE) i Hallingelille, august 2012 Tankeromkringen danskuddannelsei bæredygtighed baseretpåerfaringerfraecovillagedesign Education(EDE)iHallingelille,august2012 BjørnUldall,SasjaChristensen ogcamillanielsen Englyst Hallingelille,februar2013

Læs mere

Voice of the People. Manuscript The Parliament in Latvia TVMV, Denmark. Production-team: Reporter: Jesper Mortensen

Voice of the People. Manuscript The Parliament in Latvia TVMV, Denmark. Production-team: Reporter: Jesper Mortensen Voice of the People Manuscript The Parliament in Latvia TVMV, Denmark Production-team: Reporter: Jesper Mortensen Photographer: Lars Damgaard Nielsen Editing: Jesper Mortensen Places of shooting: Riga,

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Tilmeldingerne til 2013 I dag nåede vi op på 85 tilmeldte både. Det er stadig lidt lavere end samme tidspunkt sidste år. Tilmeldingen er åben

Læs mere

Experience. Knowledge. Business. Across media and regions.

Experience. Knowledge. Business. Across media and regions. Experience. Knowledge. Business. Across media and regions. 1 SPOT Music. Film. Interactive. Velkommen. Program. - Introduktion - Formål og muligheder - Målgruppen - Udfordringerne vi har identificeret

Læs mere

applies equally to HRT and tibolone this should be made clear by replacing HRT with HRT or tibolone in the tibolone SmPC.

applies equally to HRT and tibolone this should be made clear by replacing HRT with HRT or tibolone in the tibolone SmPC. Annex I English wording to be implemented SmPC The texts of the 3 rd revision of the Core SPC for HRT products, as published on the CMD(h) website, should be included in the SmPC. Where a statement in

Læs mere

Managing stakeholders on major projects. - Learnings from Odense Letbane. Benthe Vestergård Communication director Odense Letbane P/S

Managing stakeholders on major projects. - Learnings from Odense Letbane. Benthe Vestergård Communication director Odense Letbane P/S Managing stakeholders on major projects - Learnings from Odense Letbane Benthe Vestergård Communication director Odense Letbane P/S Light Rail Day, Bergen 15 November 2016 Slide om Odense Nedenstående

Læs mere

DEN GODE BORGERINDDRAGELSE. Nana & Salik

DEN GODE BORGERINDDRAGELSE. Nana & Salik DEN GODE BORGERINDDRAGELSE Nana & Salik BORGERINDDRAGELSE DEFINITION Public participation is not just providing information to the public. There is interaction between the organization making de decision

Læs mere

Handout 1: Eksamensspørgsmål

Handout 1: Eksamensspørgsmål Handout 1: Eksamensspørgsmål Denne vejledning er udfærdiget på grundlag af Peter Bakkers vejledning til jeres eksamensspørgsmål. Hvis der skulle forekomme afvigelser fra Peter Bakkers vejledning, er det

Læs mere

GREEN KEY GREEN DREAMS

GREEN KEY GREEN DREAMS GREEN KEY GREEN DREAMS EN VI RON MENT 1 VI TÆNKER PÅ MILJØET OG DIN KOMFORT Du har valgt en Green Key (Grøn Nøgle) virksomhed. Det betyder, at du automatisk er med til at passe på miljøet, da vi lever

Læs mere

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet. ATEX direktivet Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.dk tlf: 7220 2693 Vedligeholdelse af Certifikater / tekniske dossier / overensstemmelseserklæringen.

Læs mere

Ole Abildgaard Hansen

Ole Abildgaard Hansen Kandidatspeciale Betydningen af den kliniske sygeplejespecialists roller og interventioner for klinisk praksis - gør hun en forskel? af Ole Abildgaard Hansen Afdeling for Sygeplejevidenskab, Institut for

Læs mere

To the reader: Information regarding this document

To the reader: Information regarding this document To the reader: Information regarding this document All text to be shown to respondents in this study is going to be in Danish. The Danish version of the text (the one, respondents are going to see) appears

Læs mere

Help / Hjælp

Help / Hjælp Home page Lisa & Petur www.lisapetur.dk Help / Hjælp Help / Hjælp General The purpose of our Homepage is to allow external access to pictures and videos taken/made by the Gunnarsson family. The Association

Læs mere

We hope you have enjoyed your holiday and that you are willing to help us improve our holiday support programme by completing this questionnaire.

We hope you have enjoyed your holiday and that you are willing to help us improve our holiday support programme by completing this questionnaire. Dear holiday-maker We hope you have enjoyed your holiday and that you are willing to help us improve our holiday support programme by completing this questionnaire. The information and answers you provide

Læs mere

PR day 7. Image+identity+profile=branding

PR day 7. Image+identity+profile=branding PR day 7 Image+identity+profile=branding A few definitions Public Relations is the planned and sustained effort to establish and maintain goodwill and understanding between an organisation and it s public.

Læs mere

Skriftlig Eksamen Diskret matematik med anvendelser (DM72)

Skriftlig Eksamen Diskret matematik med anvendelser (DM72) Skriftlig Eksamen Diskret matematik med anvendelser (DM72) Institut for Matematik & Datalogi Syddansk Universitet, Odense Onsdag den 18. januar 2006 Alle sædvanlige hjælpemidler (lærebøger, notater etc.),

Læs mere

Appendix A. E-mail correspondence with Fyrvaerkeri.dk:

Appendix A. E-mail correspondence with Fyrvaerkeri.dk: Appendix A E-mail correspondence with Fyrvaerkeri.dk: Fra: Mette Jørvad Niess MEJN@ucl.dk Emne: SV: Projekt til fyrværkeri Til: "dste06@media.aau.dk" dste06@media.aau.dk Cc: "Kathrine Møgelbjerg Jørgensen"

Læs mere

Trolling Master Bornholm 2014

Trolling Master Bornholm 2014 Trolling Master Bornholm 2014 (English version further down) Så er ballet åbnet, 16,64 kg: Det er Kim Christiansen, som i mange år også har deltaget i TMB, der tirsdag landede denne laks. Den måler 120

Læs mere

Trolling Master Bornholm 2014

Trolling Master Bornholm 2014 Trolling Master Bornholm 2014 (English version further down) Den ny havn i Tejn Havn Bornholms Regionskommune er gået i gang med at udvide Tejn Havn, og det er med til at gøre det muligt, at vi kan være

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Tilmeldingen åbner om to uger Mandag den 3. december kl. 8.00 åbner tilmeldingen til Trolling Master Bornholm 2013. Vi har flere tilmeldinger

Læs mere

Sustainable investments an investment in the future Søren Larsen, Head of SRI. 28. september 2016

Sustainable investments an investment in the future Søren Larsen, Head of SRI. 28. september 2016 Sustainable investments an investment in the future Søren Larsen, Head of SRI 28. september 2016 Den gode investering Veldrevne selskaber, der tager ansvar for deres omgivelser og udfordringer, er bedre

Læs mere

Politikugen. Sikkerhedsbegrebet: Historisk og analytisk

Politikugen. Sikkerhedsbegrebet: Historisk og analytisk Politikugen Sikkerhedsbegrebet: Historisk og analytisk Indholdsfortegnelse En (meget) kort historie om begrebet Den Kolde Krig Sikkerhedsbegrebet i strategiske studier Sikkerhedsbegrebet i fredsforskning

Læs mere

Teknologispredning i sundhedsvæsenet DK ITEK: Sundhedsteknologi som grundlag for samarbejde og forretningsudvikling

Teknologispredning i sundhedsvæsenet DK ITEK: Sundhedsteknologi som grundlag for samarbejde og forretningsudvikling Teknologispredning i sundhedsvæsenet DK ITEK: Sundhedsteknologi som grundlag for samarbejde og forretningsudvikling 6.5.2009 Jacob Schaumburg-Müller jacobs@microsoft.com Direktør, politik og strategi Microsoft

Læs mere

The two traction/speed curves can be seen below. Red for diesel, Green for electric.

The two traction/speed curves can be seen below. Red for diesel, Green for electric. Denne artikel er publiceret i det elektroniske tidsskrift Artikler fra Trafikdage på Aalborg Universitet (Proceedings from the Annual Transport Conference at Aalborg University) ISSN 1603-9696 www.trafikdage.dk/artikelarkiv

Læs mere

Modtageklasser i Tønder Kommune

Modtageklasser i Tønder Kommune Modtageklasser i Tønder Kommune - et tilbud i Toftlund og Tønder til børn, der har behov for at blive bedre til dansk TOFTLUND TØNDER Hvad er en modtageklasse? En modtageklasse er en klasse med særligt

Læs mere

Financial Literacy among 5-7 years old children

Financial Literacy among 5-7 years old children Financial Literacy among 5-7 years old children -based on a market research survey among the parents in Denmark, Sweden, Norway, Finland, Northern Ireland and Republic of Ireland Page 1 Purpose of the

Læs mere

Kunstig intelligens. Thomas Bolander, Lektor, DTU Compute. Siri-kommissionen, 17. august Thomas Bolander, Siri-kommissionen, 17/8-16 p.

Kunstig intelligens. Thomas Bolander, Lektor, DTU Compute. Siri-kommissionen, 17. august Thomas Bolander, Siri-kommissionen, 17/8-16 p. Kunstig intelligens Thomas Bolander, Lektor, DTU Compute Siri-kommissionen, 17. august 2016 Thomas Bolander, Siri-kommissionen, 17/8-16 p. 1/10 Lidt om mig selv Thomas Bolander Lektor i logik og kunstig

Læs mere

Forskningsprojekt og akademisk formidling - 13. Formulering af forskningsspørgsmål

Forskningsprojekt og akademisk formidling - 13. Formulering af forskningsspørgsmål + Forskningsprojekt og akademisk formidling - 13 Formulering af forskningsspørgsmål + Læringsmål Formulere det gode forskningsspørgsmål Forstå hvordan det hænger sammen med problemformulering og formålserklæring/motivation

Læs mere

Aktivering af Survey funktionalitet

Aktivering af Survey funktionalitet Surveys i REDCap REDCap gør det muligt at eksponere ét eller flere instrumenter som et survey (spørgeskema) som derefter kan udfyldes direkte af patienten eller forsøgspersonen over internettet. Dette

Læs mere

Appendix 1: Interview guide Maria og Kristian Lundgaard-Karlshøj, Ausumgaard

Appendix 1: Interview guide Maria og Kristian Lundgaard-Karlshøj, Ausumgaard Appendix 1: Interview guide Maria og Kristian Lundgaard-Karlshøj, Ausumgaard Fortæl om Ausumgaard s historie Der er hele tiden snak om værdier, men hvad er det for nogle værdier? uddyb forklar definer

Læs mere

DONG Energy. Photobook

DONG Energy. Photobook DONG Energy Photobook DA Om Duba-B8 Duba-B8 A/S er blandt de førende i norden indenfor totalindretning af kontormiljøer. Vores indretningskoncepter er skræddersyede og bygger på rådgivning og analyse af

Læs mere

VPN VEJLEDNING TIL MAC

VPN VEJLEDNING TIL MAC VPN VEJLEDNING TIL MAC MAC OS X 1 VPN VEJLEDNING TIL MAC Formålet med en VPN forbindelse er, at du kan tilgå nogle af Aarhus Universitets services hjemmefra, som ellers kun er tilgængelige, når du er på

Læs mere

Trolling Master Bornholm 2015

Trolling Master Bornholm 2015 Trolling Master Bornholm 2015 (English version further down) Panorama billede fra starten den første dag i 2014 Michael Koldtoft fra Trolling Centrum har brugt lidt tid på at arbejde med billederne fra

Læs mere

Rødsand laboratoriet et samarbejde mellem KU, Femern & DHI

Rødsand laboratoriet et samarbejde mellem KU, Femern & DHI Rødsand laboratoriet et samarbejde mellem KU, Femern & DHI Ulrik Lumborg DHI Rødsand laboratoriet I 2012 var det erkendt at Rødsand lagune ville være et fokusområde i forbindelse med etableringen af Femernforbindelsen

Læs mere

Fejlbeskeder i SMDB. Business Rules Fejlbesked Kommentar. Validate Business Rules. Request- ValidateRequestRegist ration (Rules :1)

Fejlbeskeder i SMDB. Business Rules Fejlbesked Kommentar. Validate Business Rules. Request- ValidateRequestRegist ration (Rules :1) Fejlbeskeder i SMDB Validate Business Rules Request- ValidateRequestRegist ration (Rules :1) Business Rules Fejlbesked Kommentar the municipality must have no more than one Kontaktforløb at a time Fejl

Læs mere

DONG-område Resten af landet

DONG-område Resten af landet TDC A/S regulering@tdc.dk Fremsendes alene via mail Tillægsafgørelse vedrørende fastsættelse af priser for BSA leveret via TDC s fibernet 1 Indledning traf fredag den 15. april 2011 LRAIC-prisafgørelse

Læs mere

Hvor mange har egentlig kræft?

Hvor mange har egentlig kræft? Hvor mange har egentlig kræft? John Brodersen Professor, speciallæge i almen medicin, ph.d. Center for Forskning & Uddannelse i Almen Medicin, IFSV, KU Forskningsenheden for Almen Praksis, Region Sjælland

Læs mere

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22.

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22. Bøger på engelsk How Al-Anon Works - for Families & Friends of Alcoholics Al-Anons grundbog på engelsk, der indfører os i Al- Anon programmet. Om Al-Anons historie, om forståelse af os selv og alkoholismen.

Læs mere

FIST-GPS3 I N S T A L L A T I O N S I N S T R U K S

FIST-GPS3 I N S T A L L A T I O N S I N S T R U K S FIST-GPS3 I N S T A L L A T I O N S I N S T R U K S GPSTF-patchbakker monteret med prætermineret kabel UDARBEJDET I SAMARBEJDE MED TDC Indhold 1 General information 2 Kit indhold 3 Montering af skuffer

Læs mere

Barnets navn: Børnehave: Kommune: Barnets modersmål (kan være mere end et)

Barnets navn: Børnehave: Kommune: Barnets modersmål (kan være mere end et) Forældreskema Barnets navn: Børnehave: Kommune: Barnets modersmål (kan være mere end et) Barnets alder: år og måneder Barnet begyndte at lære dansk da det var år Søg at besvare disse spørgsmål så godt

Læs mere

TA BUSSEN - LINIE 888 - HURTIGT BILLIGT BEHAGELIGT NEMT KØBENHAVN SILKEBORG ÅRHUS THISTED AALBORG KUN 120 KR. til Århus og Silkeborg. Aalborg og Thisted kun 140 kr. Ovenstående priser er for studerende

Læs mere

DEN ÅRLIGE GENNEMFØRELSESRAPPORT FOR DEN EUROPÆISKE FOND FOR BISTAND TIL DE SOCIALT DÅRLIGST STILLEDE OP II

DEN ÅRLIGE GENNEMFØRELSESRAPPORT FOR DEN EUROPÆISKE FOND FOR BISTAND TIL DE SOCIALT DÅRLIGST STILLEDE OP II DEN ÅRLIGE GENNEMFØRELSESRAPPORT FOR DEN EUROPÆISKE FOND FOR BISTAND TIL DE SOCIALT DÅRLIGST STILLEDE OP II 1. IDENTIFIKATION AF DEN ÅRLIGE GENNEMFØRELSESRAPPORT CCI Betegnelse Version 2014.1 Rapporteringsår

Læs mere

BILAG 8.1.B TIL VEDTÆGTER FOR EXHIBIT 8.1.B TO THE ARTICLES OF ASSOCIATION FOR

BILAG 8.1.B TIL VEDTÆGTER FOR EXHIBIT 8.1.B TO THE ARTICLES OF ASSOCIATION FOR BILAG 8.1.B TIL VEDTÆGTER FOR ZEALAND PHARMA A/S EXHIBIT 8.1.B TO THE ARTICLES OF ASSOCIATION FOR ZEALAND PHARMA A/S INDHOLDSFORTEGNELSE/TABLE OF CONTENTS 1 FORMÅL... 3 1 PURPOSE... 3 2 TILDELING AF WARRANTS...

Læs mere

SAS Corporate Program Website

SAS Corporate Program Website SAS Corporate Program Website Dear user We have developed SAS Corporate Program Website to make the administration of your company's travel activities easier. You can read about it in this booklet, which

Læs mere

Forslag til implementering af ResearcherID og ORCID på SCIENCE

Forslag til implementering af ResearcherID og ORCID på SCIENCE SCIENCE Forskningsdokumentation Forslag til implementering af ResearcherID og ORCID på SCIENCE SFU 12.03.14 Forslag til implementering af ResearcherID og ORCID på SCIENCE Hvad er WoS s ResearcherID? Hvad

Læs mere

Status\Anklaget Hvid Sort Dømt til døden 19 17 Frifundet 141 149

Status\Anklaget Hvid Sort Dømt til døden 19 17 Frifundet 141 149 I dette projekt vil vi undersøge racefordomme i USA: Bliver de sorte diskrimineret i forhold til de hvide? Fx har det været påstået at retssystemet ikke er så farveblindt som det måske burde være. For

Læs mere

The purpose of our Homepage is to allow external access to pictures and videos taken/made by the Gunnarsson family.

The purpose of our Homepage is to allow external access to pictures and videos taken/made by the Gunnarsson family. General The purpose of our Homepage is to allow external access to pictures and videos taken/made by the Gunnarsson family. Formålet med vores hjemmesiden er at gøre billeder og video som vi (Gunnarsson)

Læs mere

Process Mapping Tool

Process Mapping Tool Process Mapping Tool Summary of Documentation Selected recommendations from PA Mål, midler og indsatser: Det bør fremgå hvilke målsætninger, der vedrører kommunens ydelser/indsatser og hvilke målsætninger,

Læs mere

Resultater for COMPANY X. Strategic & Employee Wellbeing Assessment

Resultater for COMPANY X. Strategic & Employee Wellbeing Assessment Resultater for COMPANY X Strategic & Employee Wellbeing Assessment Agenda Resultaterne fra Strategic Wellbeing Assessment Resultaterne fra Alignment report Resultaterne fra Employee Wellbeing Assessment

Læs mere

Det bedste sted - en undersøgelse med cirkler

Det bedste sted - en undersøgelse med cirkler Det bedste sted - en undersøgelse med cirkler Ján 1 Šunderlík Introduction og Eva Barcíková In optics when it comes down to show path of rays of light through glass, lenses or systems of lenses, m physics

Læs mere

1 s01 - Jeg har generelt været tilfreds med praktikopholdet

1 s01 - Jeg har generelt været tilfreds med praktikopholdet Praktikevaluering Studerende (Internship evaluation Student) Husk at trykke "Send (Submit)" nederst (Remember to click "Send (Submit)" below - The questions are translated into English below each of the

Læs mere

Orientering om det engelske abstract i studieretningsprojektet og den større skriftlige opgave

Orientering om det engelske abstract i studieretningsprojektet og den større skriftlige opgave Fra: http://www.emu.dk/gym/fag/en/uvm/sideomsrp.html (18/11 2009) November 2007, opdateret oktober 2009, lettere bearbejdet af JBR i november 2009 samt tilpasset til SSG s hjemmeside af MMI 2010 Orientering

Læs mere

Unitel EDI MT940 June 2010. Based on: SWIFT Standards - Category 9 MT940 Customer Statement Message (January 2004)

Unitel EDI MT940 June 2010. Based on: SWIFT Standards - Category 9 MT940 Customer Statement Message (January 2004) Unitel EDI MT940 June 2010 Based on: SWIFT Standards - Category 9 MT940 Customer Statement Message (January 2004) Contents 1. Introduction...3 2. General...3 3. Description of the MT940 message...3 3.1.

Læs mere

Business Rules Fejlbesked Kommentar

Business Rules Fejlbesked Kommentar Fejlbeskeder i SMDB Validate Business Request- ValidateRequestRegi stration ( :1) Business Fejlbesked Kommentar the municipality must have no more than one Kontaktforløb at a time Fejl 1: Anmodning En

Læs mere

Implementering af evidensbaseret viden lederskab som bærende faktor

Implementering af evidensbaseret viden lederskab som bærende faktor Implementering af evidensbaseret viden lederskab som bærende faktor Bianca Albers Familie og Evidens Center Fokus for oplægget Evidens Ledelse Implementering Outcome Evidensbaseret vs. evidensinformeret

Læs mere

Dårlig litteratur sælger - Trykkekultur i 1800-tallets Storbritannien og idag. Maria Damkjær Post.doc. i Engelsk Litteratur

Dårlig litteratur sælger - Trykkekultur i 1800-tallets Storbritannien og idag. Maria Damkjær Post.doc. i Engelsk Litteratur Dårlig litteratur sælger - Trykkekultur i 1800-tallets Storbritannien og idag Maria Damkjær Post.doc. i Engelsk Litteratur Horace Engdahl i interview i Politiken Bøger, 7. december 2014: [Hos os i Norden]

Læs mere

Aalborg Universitet København Institut for Kommunikation April 2015

Aalborg Universitet København Institut for Kommunikation April 2015 INDLEDNING 4 PROBLEMFORMULERING 7 ABSTRACT 8 LÆSEVEJLEDNING 10 VIDENSKABSTEORI 11 SOCIALKONSTRUKTIVISME 12 METODEVALG 14 TEORI 15 KRITISK DISKURSANALYSE 15 DET KRITISKE PERSPEKTIV 18 TEKST 18 MODALITET

Læs mere

State Examinations Commission

State Examinations Commission State Examinations Commission 5 Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training

Læs mere

Userguide. NN Markedsdata. for. Microsoft Dynamics CRM 2011. v. 1.0

Userguide. NN Markedsdata. for. Microsoft Dynamics CRM 2011. v. 1.0 Userguide NN Markedsdata for Microsoft Dynamics CRM 2011 v. 1.0 NN Markedsdata www. Introduction Navne & Numre Web Services for Microsoft Dynamics CRM hereafter termed NN-DynCRM enable integration to Microsoft

Læs mere

Ilisimatusarfik HD Dimittender 2011

Ilisimatusarfik HD Dimittender 2011 HD dimittender 2011 Louise Langholz lol@ral.gl Forandringsledelse Fra forståelse til handling en planlagt organisationsforandring En undersøgelse af hvordan Royal Arctic Line A/S gennemfører etablering

Læs mere

PERSPECTIVES ON MARKETING OF GREEN ELECTRICITY:

PERSPECTIVES ON MARKETING OF GREEN ELECTRICITY: PERSPECTIVES ON MARKETING OF GREEN ELECTRICITY: MODELING CONSUMER ADOPTION, CHOICE BEHAVIOR AND CONSUMER SWITCHING By Yingkui Yang THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE

Læs mere

www.cfufilmogtv.dk Tema: Pets Fag: Engelsk Målgruppe: 4. klasse Titel: Me and my pet Vejledning Lærer

www.cfufilmogtv.dk Tema: Pets Fag: Engelsk Målgruppe: 4. klasse Titel: Me and my pet Vejledning Lærer Me and my pet My dogs SVTV2, 2011, 5 min. Tekstet på engelsk Me and my pet er en svenskproduceret undervisningsserie til engelsk for børn i 4. klasse, som foregår på engelsk, i engelsktalende lande og

Læs mere

Nyhedsmail, december 2013 (scroll down for English version)

Nyhedsmail, december 2013 (scroll down for English version) Nyhedsmail, december 2013 (scroll down for English version) Kære Omdeler Julen venter rundt om hjørnet. Og netop julen er årsagen til, at NORDJYSKE Distributions mange omdelere har ekstra travlt med at

Læs mere

Kort A. Tidsbegrænset EF/EØS-opholdsbevis (anvendes til EF/EØS-statsborgere) (Card A. Temporary EU/EEA residence permit used for EU/EEA nationals)

Kort A. Tidsbegrænset EF/EØS-opholdsbevis (anvendes til EF/EØS-statsborgere) (Card A. Temporary EU/EEA residence permit used for EU/EEA nationals) DENMARK Residence cards EF/EØS opholdskort (EU/EEA residence card) (title on card) Kort A. Tidsbegrænset EF/EØS-opholdsbevis (anvendes til EF/EØS-statsborgere) (Card A. Temporary EU/EEA residence permit

Læs mere

mandag den 23. september 13 Konceptkommunikation

mandag den 23. september 13 Konceptkommunikation Konceptkommunikation Status... En række koncepter, der efterhånden har taget form Status......nu skal vi rette os mod det færdige koncept idé 1 idé 2 How does it fit together Mixing and remixing your different

Læs mere

University of Copenhagen Faculty of Science Written Exam - 8. April 2008. Algebra 3

University of Copenhagen Faculty of Science Written Exam - 8. April 2008. Algebra 3 University of Copenhagen Faculty of Science Written Exam - 8. April 2008 Algebra 3 This exam contains 5 exercises which are to be solved in 3 hours. The exercises are posed in an English and in a Danish

Læs mere

Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling

Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling Venka Simovska Katrine Dahl Madsen Lone Lindegaard Nordin Forskning i sundhedsfremmende og bæredygtig

Læs mere

Trolling Master Bornholm 2016 Nyhedsbrev nr. 8

Trolling Master Bornholm 2016 Nyhedsbrev nr. 8 Trolling Master Bornholm 2016 Nyhedsbrev nr. 8 English version further down Der bliver landet fisk men ikke mange Her er det Johnny Nielsen, Søløven, fra Tejn, som i denne uge fangede 13,0 kg nord for

Læs mere

Implementing SNOMED CT in a Danish region. Making sharable and comparable nursing documentation

Implementing SNOMED CT in a Danish region. Making sharable and comparable nursing documentation Implementing SNOMED CT in a Danish region Making sharable and comparable nursing documentation INTRODUCTION Co-operation pilot project between: The Region of Zealand Their EHR vendor - CSC Scandihealth

Læs mere

SEPA Direct Debit. Mandat Vejledning 2013.03.15. Nets Lautrupbjerg 10 DK-2750 Ballerup

SEPA Direct Debit. Mandat Vejledning 2013.03.15. Nets Lautrupbjerg 10 DK-2750 Ballerup SEPA Direct Debit Mandat Vejledning 2013.03.15 Nets Lautrupbjerg 10 DK-2750 Ballerup Indholdsfortegnelse 1. Indledning... 3 1.1 Tilknyttet dokumentation... 3 1.2 Kontakt til Nets... 3 2. Krav til SEPA

Læs mere

GUIDE TIL BREVSKRIVNING

GUIDE TIL BREVSKRIVNING GUIDE TIL BREVSKRIVNING APPELBREVE Formålet med at skrive et appelbrev er at få modtageren til at overholde menneskerettighederne. Det er en god idé at lægge vægt på modtagerens forpligtelser over for

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Tilmeldingerne til 2013 I dag nåede vi op på 77 tilmeldte både. Det er lidt lavere end samme tidspunkt sidste år. Til gengæld er det glædeligt,

Læs mere

POSitivitiES Positive Psychology in European Schools HOW TO START

POSitivitiES Positive Psychology in European Schools HOW TO START POSitivitiES Positive Psychology in European Schools HOW TO START POSitivitiES Positive Psychology in European Schools PositivitiES er et Comenius Multilateral europæisk projekt, som har til formål at

Læs mere

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus Developing a tool for searching and learning - the potential of an enriched end user thesaurus The domain study Focus area The domain of EU EU as a practical oriented domain and not as a scientific domain.

Læs mere

Hi-Res Audio/DNC Headset MDR-NC750

Hi-Res Audio/DNC Headset MDR-NC750 Brugervejledning Hi-Res Audio/DNC Headset MDR-NC750 Indholdsfortegnelse Introduktion... 3 Introduktion...3 Oversigt... 3 De grundlæggende funktioner... 4 Sådan bærer du headsettet... 4 Tilslutning af dit

Læs mere

The soil-plant systems and the carbon circle

The soil-plant systems and the carbon circle The soil-plant systems and the carbon circle Workshop 15. november 2013 Bente Hessellund Andersen The soil-plant systems influence on the climate Natural CO 2 -sequestration The soil-plant systems influence

Læs mere