Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Fyns virksomhed i

Størrelse: px
Starte visningen fra side:

Download "Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Fyns virksomhed i 2013-2014"

Transkript

1 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Fyns virksomhed i Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering af MGK Fyns virksomhed i 2013 og 2014, samt overvejelser og anbefalinger for MGK-centrets videre udvikling de kommende år. 1. Evalueringsgrundlag Rapportens vurderinger og anbefalinger tager udgangspunkt i de forventninger for MGK Fyn, som er udtrykt i den fireårige rammeaftale mellem Statens Kunstfonds Projektstøtteudvalg for Musik og Odense Musikskole for perioden 1. januar december Udvalgets viden om MGK Fyns virksomhed baserer sig dels på den statusrapport, MGK-centret i august 2015 har udarbejdet til brug for evalueringen, dels på den fælles statusrapport fra MGK Danmark (de otte MGK-centre i fællesskab), dels på MGK Fyns årsrapporter og dels på den uddybende samtale med Odense Musikskole på mødet den 7. september Ved mødet deltog: For Statens Kunstfonds Projektstøtteudvalg for Musik: Formand Bente Dahl, udvalgsmedlemmer Henrik Jansberg, Maria Frej og Niels Rønsholdt samt chefkonsulent Jan Ole Traasdahl, specialkonsulent Hanne Holdt Madsen og student Niklas Smith fra Kulturstyrelsen. For MGK Fyn: MGK-centerleder og musikskoleleder for Odense Musikskole Uffe Most og MGKsekretær/regnskabsfører Pernille Gaba. Udover nærværende evalueringsrapport om MGK Fyn har Statens Kunstfonds Projektstøtteudvalg for Musik udarbejdet en rapport om den samlede situation for de musikalske grundkurser i Danmark. Rapporten analyserer og vurderer de otte MGK-centres samlede virksomhed og betydning for dansk musikliv og foreslår tiltag, som de kommende år yderligere vil kunne bidrage til, at MGK-centrene fungerer som dynamiske regionale kraftcentre, der varetager udviklingen af unge musiktalenter i hele landet. 2. Forbehold MGK-center-strukturen er endnu ny, og det statistiske materiale om såvel faglige som økonomiske resultater er derfor endnu ganske spinkelt; for alle otte centre foreligger der alene kvantitative data for året Når talmaterialet vurderes, må det derfor ske med det forbehold, at der kan være tale om tal, som er atypiske i forhold til 2013 og årene efter Dertil kommer, at der på økonomiområdet formodentlig endnu ikke er helt ensartede konteringspraksisser på de otte centre, så også her må der i nogen grad tages forbehold for pålideligheden af de sammenlignende analyser på tværs af centrene. Det er Statens Kunstfonds Projektstøtteudvalg for Musiks forventning, at MGK-centrene de kommende år vil tilvejebringe et mere solidt statistisk materiale, og at der dermed vil foreligge et bedre grundlag for at foretage sammenlignende vurderinger af både de faglige og økonomiske forhold på centrene. 1

2 3. Forventningerne til MGK Fyn MGK Fyn er i henhold til rammeaftalen med Statens Kunstfonds Projektstøtteudvalg for Musik omfattet af følgende overordnede formål og vision, som er gældende for alle otte MGK-centre: Formål Formålet med de musikalske grundkurser (MGK) er at uddanne musikudøvere, som kan deltage i og stimulere det lokale og regionale musikliv, og at forberede elever til optagelse på en videregående musikuddannelse. MGK indgår som et væsentligt element i den musikalske fødekæde. Vision Det er visionen, at MGK-centrene fremstår og virker som dynamiske og kompetente kraftcentre for hele den region, de er hjemmehørende i, og som i samarbejde med regionens musikskoler og andre relevante samarbejdspartnere varetager og udvikler undervisningen af unge musiktalenter. De musikalske grundkurser er regionalt forskelligartede, og de arbejder på hver deres egen måde målrettet med at rekruttere, fastholde og udvikle unge musiktalenter. MGK-centrene bidrager til at opfylde formål og vision gennem målrettede aktiviteter inden for fem strategiske områder: 1. Rekruttering og talentudvikling 2. Undervisningsvirksomhed 3. Profilering og synliggørelse 4. Eksternt samarbejde 5. Professionel ledelse, organisation og opgaveløsning I de følgende afsnit beskrives de forhold, som Statens Kunstfonds Projektstøtteudvalg for Musik finder det særligt vigtigt, at MGK Fyn giver opmærksomhed i årene fremover. Forhold, som er af relevans for alle otte MGK-centre, er beskrevet i udvalgets samlede evalueringsrapport om de otte MGK-centre i Danmark. 4. Rekruttering og talentudvikling Overordnet målsætning: MGK-centret skal sikre samarbejdet med det lokale musikliv herunder med musikskolerne og andre institutioner i regionen omkring rekruttering og talentudvikling af unge musikere, blandt andet med henblik på at sikre kvalificerede ansøgere til MGK. MGK Fyn bidrager til at styrke talentudviklingen i sit regionale virkeområde, særligt gennem et understøttende samarbejde med Odense Musikskoles talentlinje. MGK Fyn styrker kontakten til unge rytmiske talenter i musikalske miljøer gennem MGK-koncertvirksomhed rundt i regionen. De indsendte statistiske oplysninger viser, at MGK Fyn i 2014 havde ansøgere fra alle kommuner i sit regionale virkeområde, undtagen fra Ærø, og at der i sammenligning med landets øvrige MGK-centre, og set i forhold til kommunernes befolkningstal, er en nogenlunde ligelig fordeling af ansøgere fra kommunerne i 2

3 virkeområdet. De optagnes karaktergennemsnit ligger på 9,9, hvilket er lidt højere end landsgennemsnittet på 9,1. Statens Kunstfonds Projektstøtteudvalg for Musik vurderer, at MGK Fyn arbejder målrettet på at understøtte talentudviklingen i hele virkeområdet, således at unge talenter uanset bopæl får gode muligheder for at kvalificere sig til MGK-optagelsesprøverne. 5. Undervisningsvirksomhed Overordnet målsætning: Musikalske grundkurser har til formål at bibringe unge musikere musikalske færdigheder, der svarer til optagelsesniveauet for et konservatorium. Undervisningsvirksomheden beskrives i fælles overordnede læreplaner, som omfatter alle kurser, i lokale tilpasninger af læreplaner for fag, som kun udbydes på det enkelte kursus, samt i time- og fagfordelingen. MGK Fyn sikrer en udviklende undervisning af unge musikalske talenter, bl.a. gennem overordnede undervisningsplaner, tværfaglige aktiviteter og workshops arrangeret i samarbejde med Syddansk Musikkonservatorium. Hovedparten af MGK Fyns undervisningsaktiviteter er placeret i Odense Kommune. Sammenlignet med andre MGK er lå MGK Fyn i 2014 omkring middel i andelen af afgåede kursister, som fortsætter på en videregående musikuddannelse samme år, de ophører. I 2014 forsatte 8 ud af 18 ophørte kursister på en videregående musikuddannelse, hvilket svarer til ca. 44 pct. Landsgennemsnittet for de otte MGK-centre ligger på 43 pct. Statens Kunstfonds Projektstøtteudvalg for Musik vurderer, at MGK Fyn arbejder effektivt og målrettet på at sikre de bedst mulige betingelser for at udvikle unge musikalske talenter med henblik på at forberede dem til optagelse på en videregående musikuddannelse. Udvalget opfordrer til, at MGK Fyn overvejer mulighederne for mere decentralt forankret undervisning, og at centret inddrager MGK-kursisternes oplevelse af undervisningsforløbet og udarbejder tilfredshedsundersøgelser blandt kursisterne med henblik på at forny og kvalificere undervisningsvirksomheden. 6. Profilering og synliggørelse Overordnet målsætning: Musikalske grundkurser bidrager til at stimulere og udvikle det lokale og regionale musikliv. Kurserne arbejder strategisk og involverende med at udvikle eksisterende og nye platforme for indsatsen i forhold til musikmiljøet her med særligt fokus på mødesteder og scener for musikalsk udfoldelse for børn og unge. Kurset inddrager forskellige samarbejdspartnere i arbejdet og udarbejder mål, metoder og succeskriterier for indsatsen. Kurset markedsfører og kommunikerer sine aktiviteter effektivt i hele sit virkeområde. MGK Fyn skærper sin profilering og synliggørelse gennem koncerter ud af huset på gymnasier, efterskoler og spillesteder mv. Herudover arbejder MGK Fyn strategisk med informationsvirksomhed, både i form af en aktiv online tilstedeværelse og gennem samarbejde med Samrådet af Musikskoler på Fyn, som videreformidler MGK Fyns aktiviteter. 3

4 Statens Kunstfonds Projektstøtteudvalg for Musik vurderer, at MGK Fyn fortsat bør styrke indsatsen for at profilere og synliggøre MGK Fyn som et dynamisk kraftcenter, der er en aktiv og værdifuld del af det regionale musikliv. Udvalget opfordrer til, at MGK Fyn arbejder målrettet og strategisk med at udvikle nye platforme, som kan bidrage til at styrke musikmiljøerne og rammerne for musikalsk udfoldelse for børn og unge. Herudover opfordrer udvalget til, at MGK Fyn overvejer, hvilke nøgletal og indikatorer, der kunne være velegnede til at belyse resultaterne af centrets indsats inden for profilering og synliggørelse. 7. Eksternt samarbejde Overordnet målsætning: Musikalske grundkurser bidrager til øget dialog og samarbejder lokalt, i regionen, og i samarbejde med de øvrige kurser nationalt og internationalt med spillesteder, genreorganisationer, uddannelsesinstitutioner og andre aktører i og uden for kulturlivet med henblik på at styrke og udvikle kursets tilbud til talentfulde unge. MGK Fyn styrker sin virksomhed gennem samarbejder med forskellige aktører i det regionale kulturliv såsom spillesteder, musikefterskoler, gymnasier og konservatorier, hvilket bidrager til at skabe regional sammenhængskraft og styrke den musikalske fødekæde. MGK Fyn bemærkede på evalueringsmødet med Statens Projektstøtteudvalg for Musik, at det kan være en udfordring at samarbejde med eksterne kulturinstitutioner i regionen. De store institutioner som f.eks. symfoniorkestre og konservatorier interesserer sig ikke tilstrækkeligt for at åbne sig over for MGK Fyn. MGK Fyn ønsker at bidrage til at styrke samarbejdet mellem de forskellige led i den musikalske fødekæde og at virke som en dynamo for musiklivet i bred forstand. Statens Kunstfonds Projektstøtteudvalg for Musik vurderer, at MGK Fyn fortsat bør styrke indsatsen for at være en attraktiv, opsøgende samarbejdspartner, der bidrager til at stimulere og udvikle det lokale og regionale musikliv. Udvalget finder det positivt, at MGK Fyn ønsker at agere dynamo for musiklivet og opfordrer til, at man overvejer metoder og strategier til, hvordan man kan styrke samarbejdet med eksterne kulturinstitutioner og andre aktører. MGK-centre over hele landet har hver især taget gode initiativer, og en intensiveret erfaringsudveksling mellem centrene vil formodentlig kunne bidrage til at fremme den ønskede udvikling. 8. Professionel ledelse, organisation og opgaveløsning Overordnet målsætning: De musikalske grundkursers aktiviteter varetages, ledes og administreres udviklingsorienteret og professionelt. MGK Fyn sikrer en professionel og udviklingsorienteret drift gennem centrale ledelsesorganer såsom Samrådet for Musikskoler på Fyn, koordinatorer, koordinationsudvalg og repræsentantskab, som bidrager med hver deres faglige og organisatoriske kompetencer. Statens Kunstfonds Projektstøtteudvalg for Musik vurderer, at MGK Fyn ledes målrettet og med inddragelse af mange relevante kompetencer. Udvalget finder det vigtigt, at MGK Fyn styrker sit ledelsesmæssige og organisatoriske fokus på at være et decentralt center, således at centret fortsat når ud i hele sit regionale virkeområde. 4

5 9. Justering af rammeaftalen for perioden Statens Kunstfonds Projektstøtteudvalg for Musik og de otte MGK-centre i fællesskab (MGK Danmark) har igangsat en proces, som i løbet af 2015 og 2016 skal føre til større klarhed om de regelsæt og afrapporteringskrav, som er gældende på området. Det er parternes forventning, at denne afklaring både vil forenkle og styrke kvaliteten af afrapporteringen om MGK-centrene. Dato: 10. december 2015 Bente Dahl formand for Statens Kunstfonds Projektstøtteudvalg for Musik Henrik Wenzel Andreasen kontorchef, Kulturstyrelsen Bilag 1. Statusrapport fra MGK Fyn 5

6 Statusrapport for MGK Fyn I denne rapport gør Odense Musikskole status over sin MGK-virksomhed de første to år af rammeaftalen med Statens Kunstfonds Projektstøtteudvalg for Musik for perioden 1. januar 2013 til 31. december Rapporten gør først rede for de væsentligste dele af målopfyldelsen i og beskriver dernæst MGKcentrets vigtigste udfordringer og muligheder de kommende år. Ud over denne rapport udarbejder de otte MGK-centre i fællesskab en statusrapport med nøgletal, indikatorer og resultater for MGK-området i hele landet. 1. Hvordan er det gået i ? Kapitel 1 omhandler de to første år af rammeaftalen. I afsnit 1.1 vurderer Odense Musikskole, hvordan det lokalt og regionalt aktuelt går med tilgangen og udviklingen af nye musikalske talenter, og hvordan udviklingen har været på området de første år af rammeaftaleperioden. I afsnit 1.2 findes Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision for alle otte MGKcentre. I afsnit 1.3 vurderer Odense Musikskole, hvordan MGK Fyns fem strategiske områder har bidraget til at indfri musikudvalgets overordnede formål og vision, og hvordan det er gået på hvert af de fem strategiske områder. I afsnit 1.4 beskrives, hvordan MGK Fyn lever op til Statens Kunstfonds Projektstøtteudvalg for Musiks supplerende fastsatte rammer for MGK-centrene (jf. notat om Statens Kunstråds Musikudvalgs rammer for indgåelse af flerårige aftaler med MGK-centrene, 5. oktober, 2012). Status for talentudviklingen i det regionale musikliv Beskrivelse af områdets aktuelle status og udvikling under de første to år af rammeaftaleperioden: MGKFynhargenereltgodsøgningafkvalificeredeansøgere,omendsøgningenharværetdalendefra2013til2014. Deroptageshvertåretantalkvalificeredeansøgerepå1.årgang(sestatistikunderpkt.1.4.4). MGKFynharenøkonomiskramme,dergiveretmaksimumpå40eleverfordeltpåårgangene.Fordelingentilstræ besatvære18påklassisklinje/18pårytmisklinjeog4påproduktionslinje.dererhvertåretstørreantalansøgere pårytmisklinjeendpåklassisklinje,hvorforderforetagesenkvoteringafdeoptagelsessøgendeunderhensynta gentil,atadgangskravetkaraktermæssigtermin.7(12skalaen). GennemdeførstetoåraframmeaftaleperiodenharMGKFynværetsærligopmærksompådeeksternesamar bejdspartnere,somkanværemedtilatprofilere,inspirereogudvikletalenttilbuddet. DetdrejersigomworkshopsogundervisningssamarbejdermedSyddanskMusikkonservatorium,OdenseSymfo niorkester, TheCarlNielsenMasterclass,DeFynskeTalentskolersamtomkoncertsamarbejdemedlokalespille stederiodense,defynskegymnasierogmusikefterskoler. DererindgåetaftalemedetlokaltgymnasiumforatsikresammenhængihverdagenfordeMGKelever,derhar deresdagligegangpågymnasiet. 1

7 DereretlandsdækkendesamarbejdemellemMGKCentrene,somsikrerfagligvidendelingifm.undervisningog studieplaneroglæringsmålpådeenkeltefagområder. Formål og vision for MGK Statens Kunstfonds Projektstøtteudvalg for Musik har i rammeaftalen om MGK Fyn fastsat følgende formål og vision for MGK: Formål: Formålet med de musikalske grundkurser (MGK) er at uddanne musikudøvere, som kan deltage i og stimulere det lokale og regionale musikliv, og at forberede elever til optagelse på en videregående musikuddannelse. MGK indgår som et væsentligt element i den musikalske fødekæde. Vision: Det er visionen, at MGK centrene fremstår og virker som dynamiske og kompetente kraftcentre for hele den region, de er hjemmehørende i, og som i samarbejde med regionens musikskoler og andre relevante samarbejdspartnere varetager og udvikler undervisningen af unge musiktalenter. De musikalske grundkurser er regionalt forskelligartede, og de arbejder på hver deres egen måde målrettet med at rekruttere, fastholde og udvikle unge musiktalenter. MGK-centrenes strategiske områder MGK-centrene realiserer Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision gennem målrettede aktiviteter inden for fem strategiske områder: 1) Rekruttering og talentudvikling 2) Undervisningsvirksomhed 3) Profilering og synliggørelse 4) Eksternt samarbejde 5) Professionel ledelse, organisation og opgaveløsning I de følgende afsnit gives en beskrivelse og vurdering af de vigtigste resultater for MGK Fyn Rekruttering og talentudvikling Rammeaftalen fastlægger følgende målsætning for det strategiske område rekruttering og talentudvikling : MGK centret skal sikre samarbejdet med det lokale musikliv herunder med musikskolerne og andre institutioner i regionen omkring rekruttering og talentudvikling af unge musikere, blandt andet med henblik på at sikre kvalificerede ansøgere til MGK. 2

8 Beskrivelse og vurdering af de vigtigste resultater inden for rekruttering og talentudvikling : A. Aktiviteter, som har bidraget mest til opfyldelsen af målsætningen for rekruttering og talentudvikling: 2013: MGKFynhartiloptagelsesprøvernei2013haftgodsøgning,ialt73tilmeldte(16fraFyns11.Musikskole).Heraf aflagde50prøve(13frafyns11.musikskole),og46bestodoptagelsesprøven. Knaphalvdelenaf(48%)afdeoptagelsessøgendefikkarakterfra7 12,hvilketmåbetragtessommegettilfredsstil lendeoggavbaggrundforoptagelseafmegetkvalificeredeansøgere. Denprocentuellefordelingpådeaktueltaflagteprøvermed54%ansøgerepårytmisklinje,40%ansøgerepåklas sisklinjeog6%ansøgerepåproduktionslinjengiverikkeumiddelbartgrundtilbekymring 2014: MGKFynhartiloptagelsesprøvernei2014haftgodsøgning,ialt60tilmeldte.Herafaflagde37prøve,og35bestod optagelsesprøven. Knap3/4afde,dergiktilprøve(70%)fikkarakterfra7 12,hvilketmåbetragtessommegettilfredsstillendeoggav baggrundforoptagelseafmegetkvalificeredeansøgere. Denprocentuellefordelingpådeaktueltaflagteprøvermed70%ansøgerepårytmisklinje,25%ansøgerepåklas sisklinjeog5%ansøgerepåproduktionslinjengiverikkeumiddelbartgrundtilbekymring.derskaldogfremadret tetfokuserespåvækstlagetforsåvelproduktionslinjesomklassisklinje.odensemusikskoleharmedmidlerfra Kulturstyrelsenfokuseretpådenneopgavegennemmusikskolenstalentlinjei2014ogvilfortsættearbejdetmed dennerekruttering.derersåledes3tilmeldtepåproduktionslinjeniforåret2015. B. Aktiviteter, som har bidraget mindst til opfyldelsen af målsætningen for rekruttering og talentudvikling: MGKeleverharofteproblemermedatfåhverdagentilathængesammenidentredelingafderestidpåskolegang, MGKkursusogerhvervsarbejde,somdeflesteelevererunderlagt. Deterenstorudfordringfordeældreelever,atMGKikkeerSUberettigetogatdederforernødsagettilathave erhvervsarbejdeparalleltmedmgkkurset. C. Det strategiske områdes bidrag til indfrielsen af Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision: MGKFynbidragertildetoverordnedemålvedatuddannermusikudøvere,somkandeltageiogstimuleredetlokale ogregionalemusikliv.4060%afafgangseleverneoptagespåogdeltagerefterfølgendepåenvideregåendemusik uddannelse Undervisningsvirksomhed Rammeaftalen fastlægger følgende målsætning for det strategiske område undervisningsvirksomhed : Musikalske grundkurser har til formål at bibringe unge musikere musikalske færdigheder, der svarer til optagelsesniveauet for et konservatorium. Undervisningsvirksomheden beskrives i fælles overordnede læreplaner, som omfatter alle kurser, i lokale tilpasninger af læreplaner for fag, som kun udbydes på det enkelte kursus, samt i time- og fagfordelingen. 3

9 Beskrivelse og vurdering af de vigtigste opnåede resultater inden for undervisningsvirksomheden i : A. Aktiviteter, som har bidraget mest til opfyldelsen af målsætningen for undervisningsvirksomheden: Undervisningsåretindeholder30ugersskemalagtundervisningmedugentligtskemaog6fleksibleundervisnings ugertilinstrumentaleworkshopsogtværfagligeaktiviteter.derafholdespåårsbasis4instrumentaltbaserede workshopspårytmiskline,ogeleverfraklassisklinjehardeltagetiweekendogugebaseredework shops/masterclass sarrangeretafsyddanskmusikkonservatoriumogthecarlnielsenmasterclass.foratmotivere elevernetilfremmødeerfagetkor/stemmetræningfraaugust2013igenblevetfastlagtidetugentligeskemaefter enperiodemedprojektstatus. B. Aktiviteter, som har bidraget mindst til opfyldelsen af målsætningen for undervisningsvirksomheden: PågrundafMGKeleverneshøjeaktivitetsniveaumedskolegang,frivilligemusikaktiviteter(bl.a.ideregionaleorke strei Den11.Musikskole )ogerhvervsarbejdeerdetsværtatplanlæggeprojekter,dergårudoverarbejdsugen, hvorforweekendarrangementerbegrænsestil1eller2pr.semester. C. Det strategiske områdes bidrag til indfrielsen af Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision: MGKFynbidragerihøjgradtilindfrielsenafsåvelformålsomvisionvedelevernesdeltagelseienlangrækkework shopogkoncertaktivitetermedeksternesamarbejdspartnereogeteksterntpublikumsamtmedkoncerterfor såvelgymnasiesomefterskoleelever Profilering og synliggørelse Rammeaftalen fastlægger følgende målsætning for det strategiske område profilering og synliggørelse : Musikalske grundkurser bidrager til at stimulere og udvikle det lokale og regionale musikliv. Kurserne arbejder strategisk og involverende med at udvikle eksisterende og nye platforme for indsatsen i forhold til musikmiljøet her med særligt fokus på mødesteder og scener for musikalsk udfoldelse for børn og unge. Kurset inddrager forskellige samarbejdspartnere i arbejdet og udarbejder mål, metoder og succeskriterier for indsatsen. Kurset markedsfører og kommunikerer sine aktiviteter effektivt i hele sit virkeområde. Beskrivelse og vurdering af de vigtigste resultater inden for profilering og synliggørelse i : A. Aktiviteter, som har bidraget mest til opfyldelsen af målsætningen for profilering og synliggørelse: Koncertvirksomhed: Fokuspåkoncerterudafhuset(2årligepåhverlinje)isamarbejdemedlokalekulturaktørerogspillesteder.Resul tateterkontakttiletbrederepublikumogenstyrkelseafrekrutteringen,idetmangeungeframusikmiljøetioden se/påfynopsøgerdeoffentligekoncerter. MGKturnéenmedalleMGKeleveriefteråret(uge46)henvendersigtilgymnasierogefterskoleroghardelsen koncertdel,delsenefterfølgendeinformationsdel. Beggetiltagharudovermåletomprofileringogsynliggørelsetilhensigtatinformereomdetinstrumentaleog musikalskeniveau,derforventesafkommendemgkansøgere. 4

10 Informationsvirksomhed: HjemmesidenMGKFyn.dksikreruptodateinformationogvejledningtiloptagelsesprøvepådetrelinjer.Øvrige informationer(kontakt,studieplaner,fotosmv.)styrkerdetgenerelleinformationsniveau. Samarbejdetmed Fyns11.Musikskole sørgerforrelevantinformationdirektetilmålgruppenaftalenteleverpå Fyn. SamrådetafMusikskolerpåFyninformeresfastomMGK saktiviteterdelssomorienteringspunktpådekvartalsvise møder,delsgennemdetorepræsentantervalgttilmgk skoordinationsudvalgafsamrådet(pt.assensmusikskole ognyborgmusikskole) DerinformeresomMGKFynpådenårligeMGKturnétilgymnasierogefterskoler,ogderertilPRformålfremstillet småfolderemedkontaktinfotiluddeling. DerarbejdesmedsåvelfællesoplysningomMGKpåMGKDanmarkshjemmesidewww.musikalskgrundkursus.dk somfællesannonceringifagblade(musikeren,modus,gaffa,musikmagasinet). B. Aktiviteter, som har bidraget mindst til opfyldelsen af målsætningen for profilering og synliggørelse: C. Det strategiske områdes bidrag til indfrielsen af Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision: MGKFynbidragertilindfrielsenafsåvelformålsomvisionvedelevernesdeltagelseieksterneworkshopogkon certaktivitetermedeksternesamarbejdspartnereogeteksterntpublikumsamtmedkoncerterforsåvelgymnasie somefterskoleelever.mgkfyninformereraktivtommgk stilbudogkoncertertilsåvelregionensmusikskolersom gymnasierogefterskolermedhenblikpåatværeetdynamiskogkompetentkraftcenterforfyn Eksternt samarbejde Rammeaftalen fastlægger følgende målsætning for det strategiske område eksternt samarbejde : Musikalske grundkurser bidrager til øget dialog og samarbejder lokalt, i regionen, og i samarbejde med de øvrige kurser nationalt og internationalt med spillesteder, genreorganisationer, uddannelsesinstitutioner og andre aktører i og uden for kulturlivet med henblik på at styrke og udvikle kursets tilbud til talentfulde unge. Beskrivelse og vurdering af de vigtigste opnåede resultater inden for eksternt samarbejde i : A. Aktiviteter, som har bidraget mest til opfyldelsen af målsætningen for eksternt samarbejde: Derhari2013og2014væretsamarbejdetmed SyddanskMusikkonservatoriumomkringenMGKworkshopspåkonservatorietiEsbjerg. TheCarlNielsenMasterclass (uge42 sinfoniettaprojekt2013ogsymfoniorkesterprojekt2014) OdenseKommune(koncerteriOdenseogNorrköping) Lokalespillesteder(Musikbiblioteket,Studenterhuset) Fynskegymnasierogmusikefterskoler(turnéuge462013og2014) B. Aktiviteter, som har bidraget mindst til opfyldelsen af målsætningen for eksternt samarbejde: 5

11 C. Det strategiske områdes bidrag til indfrielsen af Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision:/ MGKFynsstrategiskesamarbejderbidragertilindfrielseafformålogvisionervedatinspirereogdygtiggøreelever nepåmgkmedhenblikpåderesoptagelsepåenvideregåendemusikuddannelseogtilatvirkesom fyrtårne for andreungemusiktalenteridetfællesmødeomkringmusikken Professionel ledelse, organisation og opgaveløsning Rammeaftalen fastlægger følgende målsætning for det strategiske område professionel ledelse, organisation og opgaveløsning: De musikalske grundkursers aktiviteter varetages, ledes og administreres udviklingsorienteret og professionelt. Beskrivelse og vurdering af de vigtigste opnåede resultater inden for professionel ledelse, organisation og opgaveløsning i : A. Aktiviteter, som har bidraget mest til opfyldelsen af målsætningen for professionel ledelse, organisation og opgaveløsning: LedelsenafMGKFynbliverudøvetpåflereniveauer,somerbaseretpåmøderogsamarbejdemed: MGKFynskoordinationsudvalg(4årligemøder) MGKFynsrepræsentantskab(1årligtmøde) MGKlederkredsenpålandsplan(45årligemøder) MGKFynskoordinatorer(møderefterbehov) SamrådetforMusikskolerpåFyn(6årligemøder) OdenseMusikskolesBrugerrådm.repræsentationafSyddanskMusikkonservatorium(4årligemøder) MGKFynlærerkredsen(4årligemøderfordeltpårytmiskeogklassiskelærere) AnsættelseogafskedigelserskergennemOdenseKommune.Indstillingafnyeeksternehovedfagslæreregodken desafkoordinationsudvalget.dagligkoordinationaflærerpersonale,undervisning,standpunktsogafgangsprøver, projekterogkoncerterm.m.skergennemmgkfynsrytmiskeogklassiskekoordinatorer. MusikskoleledelsenrefererertilBørnogUngechefVest(derogsåhartilsynsmyndigheden)medhvem,derholdes lejlighedsvisedrøftelserommgk svirksomhed. B. Aktiviteter, som har bidraget mindst til opfyldelsen af målsætningen for professionel ledelse, organisation og opgaveløsning: Generelterorganisationsstrukturenrettungatarbejdei,ogderermangemødermed samme dagsorden.der kunneskabesenbedresammenhængistrukturen,såfremtrepræsentantskabetårligtafsinkredsnedsattekoordi nationsudvalget. C. Det strategiske områdes bidrag til indfrielsen af Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision: Professionelledelseogengennemarbejdetorganisationsstruktursikrer,atMGKFynbidragertilopfylderformålog visionformgk. 6

12 Statens Kunstfonds Projektstøtteudvalg for Musiks supplerende rammer for indgåelse af flerårige aftaler med MGK-centrene I tillæg til rammeaftalen har Statens Kunstfonds Projektstøtteudvalg for Musik fastsat en række supplerende rammer for de otte MGK-centre, som findes i notatet om Statens Kunstråds Musikudvalgs rammer for indgåelse af flerårige aftaler med MGK-centrene af 5. oktober De supplerende rammer vedrører blandt andet følgende fire specifikke elementer ved MGK-centrenes virke: 1) Repræsentantskab 2) Koordinationsudvalg 3) Aldersfordeling 4) Optagelsesniveau I de følgende afsnit gives en beskrivelse og vurdering af status for de fire elementer hos MGK Fyn Repræsentantskabet for MGK Fyn Der er oprettet et repræsentantskab for MGK Fyn bestående af relevante samarbejdspartnere. Formålet med repræsentantskabet er at sikre samarbejdet med og om det regionale musikliv og medvirke til udviklingen af MGK Fyn Beskrivelse og vurdering af repræsentantskabets virke i : A. Repræsentantskabets opfyldelse af eget formål: Repræsentantskabetsamlerrelevantesamarbejdspartnereiregionenoginkluderer: Enrepræsentantforledelsenfrahverafregionensmusikskoler,enrepræsentantforregionenslandsdelsorkester, enrepræsentantforderegionalespillesteder,enrepræsentantfordeøvrigespillesteder,enmgkstuderende,en repræsentantforhverregionensmusikkonservatorium,enrepræsentantforgymnasieskolerogungdomsskoler. Repræsentantskabetafholdermødemindsténgangårligt,hvorrepræsentantskabetudtalersigoverforStatens KunstrådsMusikudvalgidenårligerapport. B. Repræsentantskabets bidrag til indfrielsen af Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision: Repræsentantskabetbidragertilformålogvisionervedatværebindeledmellemregionenskulturaktørerogskoler. Dervilleværemeresammenhængiorganisationsstrukturen,såfremtrepræsentantskabetårligtafsinkredsnedsat tekoordinationsudvalget Koordinationsudvalget for MGK Fyn Der er oprettet et koordinationsudvalg for MGK Fyn bestående af bl.a. musikskoleledere i regionen. Formålet med koordinationsudvalget er at sikre kontakten mellem MGK Fyns ledelse og musikskolerne i regionen, og at forestå den overordnede tilrettelæggelse af undervisning, optagelsesprøver og elevoptag. 7

13 Beskrivelse og vurdering af koordinationsudvalgets virke i : A. Koordinationsudvalgets opfyldelse af eget formål: Koordinationsudvalget(KU)forMGKFynsikreroptimaltilrettelæggelseafundervisning,optagelsesprøverogelev optagsamtkontakttilsamrådetafmusikskolergennemårligemøder. KUbestårafMGKFyn slederogdecentralemgkkoordinatorer,lederneaffynsrytmisketalentskoleogfyns KlassiskeTalentskolesamttoledereregionensmusikskolerudpegetafSamrådetforMusikskolerpåFyn. KUsikrerkontaktenmellemMGKledelsenogledelsenafmusikskolerneiområdet,herunderarbejdetmedatfast holdelseogudviklekreative,musikalskemiljøerimgkregionen.koordinationsudvalgetmedvirkertilatsikrefælles strategierformusikskolernestalentudviklingimgkregionenogsammenhængidenmusikalskefødekæde. KUvejlederledelseniansættelsesanliggender,herundergodkendelseafpersonaletilundervisningpåMGKogdrøf terforholdafvæsentligbetydningformgk,herundereventuelplaceringafdecentralundervisningudfraansøger nespræferenceroghjemsted. B. Koordinationsudvalgets bidrag til indfrielsen af Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision: KUbidragertilindfrielsenformålogvisionveddeltagelseidagligdriftsamtvedudarbejdelsenafårligrapporttil repræsentantskabogstatenskunstrådsprojektstøtteudvalgmusikudvalgsamtveddenårligeudarbejdelseafbud get Aldersfordeling Unge mellem 14 og 25 år kan blive optaget på MGK. Kurserne kan dispensere fra aldersgrænserne i særlige tilfælde. Formålet med aldersgrænserne er at fokusere på talentudviklingen og uddannelsen af unge musikudøvere. Beskrivelse og vurdering af aldersfordelingen på MGK Fyn i : A. Aktuel status og udviklingen for aldersfordelingen på MGK Fyn: Derergenereltstorforskelpåoptagetfraårtilår. 2013optogMGKFyn3pigerog10drengemedenalderfra14til24år.Aldersgennemsnittetvar17,6forpigerog 18,9fordrenge. 2014optogMGKFyn5pigerog11drengemedenalderfra14til20år.Aldersgennemsnittetvar17,2forpigerog 18,1fordrenge. Dererengenereltendenstilatklassiskmusikmeddeyngsteudøvereprægesafpiger,mensrytmiskmusikmedde ældsteudøvereprægesafdrenge.enesteundtagelsehererfagetrytmisksang,somovervejendeharpigersom ansøgere. B. Forholdet mellem aldersfordelingen og Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision Aldersfordelingenharingenindflydelsepåindfrielsenafdetoverordnedeformålogvision. 8

14 Optagelsesniveau Adgangskravet til MGK er en bestået optagelsesprøve. Optagelsesprøven sikrer, at det er de mest egnede og talentfulde elever, som får tilbudt en plads på MGK. Beskrivelse og vurdering af optagelsesniveauet på MGK Fyn i : A. Aktuel status og udviklingen for optagelsesniveauet på MGK Fyn: 2013: MGKFynhartiloptagelsesprøvernei2013haftgodsøgning,ialt73tilmeldte(16fraDen11.Musikskole).Herafaf lagde50prøve(13fraden11.musikskole),og46bestodoptagelsesprøven. Knaphalvdelenaf(48%)afdeoptagelsessøgendefikkarakterfra7 12,hvilketmåbetragtessommegettilfredsstil lendeoggavbaggrundforoptagelseafmegetkvalificeredeansøgere. Denprocentuellefordelingpådeaktueltaflagteprøvermed54%ansøgerepårytmisklinje,40%ansøgerepåklas sisklinjeog6%ansøgerepåproduktionslinjengiverikkeumiddelbartgrundtilbekymring.derskaldogfremadret tetfokuserespåvækstlagetforproduktionslinjenogodensemusikskoleharsøgt(ogfået)midlerfrakulturstyrelsen tilatfokuserepådenneopgavei : MGKFynhartiloptagelsesprøvernei2014haftgodsøgning,ialt60tilmeldte.Herafaflagde37prøve,og35bestod optagelsesprøven. Knap3/4afde,dergiktilprøve(70%)fikkarakterfra7 12,hvilketmåbetragtessommegettilfredsstillendeoggav baggrundforoptagelseafmegetkvalificeredeansøgere. Denprocentuellefordelingpådeaktueltaflagteprøvermed70%ansøgerepårytmisklinje,25%ansøgerepåklas sisklinjeog5%ansøgerepåproduktionslinjengiverikkeumiddelbartgrundtilbekymring.derskaldogfremadret tetfokuserespåvækstlagetforsåvelproduktionslinjesomklassisklinje.odensemusikskoleharmedmidlerfra Kulturstyrelsenfokuseretpådenneopgavegennemmusikskolenstalentlinjei2014ogvilfortsættearbejdetmed dennerekruttering.derersåledes3tilmeldtepåproduktionslinjeniforåret2015. Optagelsesniveauetmågenereltsigesatværetilfredsstillende,omendantalletaftilmeldtetiloptagelsesprøvenhar væretfaldendefra derhardogibeggeårværettilstrækkeligtmedkvalificeredeansøgeretilatopret holdeetindtagafelevermedprøvekarakterfra712påalletrelinjermeddenønskedefordelingpåenligestorklas sisksomrytmisklinjeogenmindreproduktionslinje. B. Forholdet mellem optagelsesniveauet og Statens Kunstfonds Projektstøtteudvalg for Musiks formål og vision: 2013 Iåreter16eleverholdtpåMGKFyn,herafer11optagetpåkonservatoriet,1erholdtefterbevilgetårsorlov,1holdt pågrundafbarselog3erholdtaferhvervsmæssig(musikervirke)årsag. Kønsfordelinger6pigerpåklassisklinjeog1pårytmisklinje,9drengepårytmisklinje Iåreter18eleverstoppetpåMGKFyn,herafer8optagetpåkonservatoriet,3erholdtefterbevilgetårsorlov,5er holdtgrundetandrestudiemuligheder(ikkemusikfaglige)og2erholdtpågrundafsygdom(herunderstressrelate retarbejdspres). Kønsfordelinger4pigerpåklassisklinjeog1pårytmisklinje,5drengepåklassisklinjeog8drengepårytmisklinje. MGKFynsoptagelsesogafgangsniveausikreratdetoverordnedeformålogvisionmedleveringafsåvelkandidater tildevideregåendemusikuddannelserpålandetsmusikkonservatoriersomstyrkelseafdelokaleamatørmusikliv bliveropfyldtiregionen. 9

15 Øvrige forhold Beskrivelse og vurdering af øvrige vigtige forhold, som ikke er berørt i de foregående afsnit: [Beskriv. Hvis der ikke er behov for at beskrive øvrige forhold kan hele afsnit 1.5 slettes] 2. MGK Fyns muligheder og udfordringer de kommende år Dette kapitel ser fremad mod den anden halvdel af rammeaftaleperioden. Kapitlet beskriver de muligheder og udfordringer, som Odense Musikskole vurderer som værende de mest væsentlige for MGK Fyns opfyldelse af Statens Kunstfonds Projektstøtteudvalgs overordnede formål og vision (se afsnit 1.2). Beskriv de vigtigste muligheder og udfordringer for MGK Fyn i de kommende 2-3 år: Nævn de 3-5 vigtigste muligheder og de 3-5 største udfordringer for MGK Fyn. Tag især udgangspunkt i forhold, som MGK Fyn selv har mulighed for at agere på og beskriv, hvad Odense Musikskole vil gøre og med hvilket forventet resultat.] Muligheder SetilysetafudfordringeromkringfinancieringenafFyns11.MusikskoleogKulturstyrelsensændringaftalentpuljen (Musikhandlingsplanen)børMGKFynfremadrettetindtageenmereaktivrolleidetopsøgenderekrutteringsarbej deisamarbejdemedkonservatoriumogsymfoniorkester.deførstemøderiforholdtilettætteresamarbejdemed SDMKogOdenseSymfoniorkesteromkringCarlNielsenOrchestraAcademyharmedførtatderbliversammen hængmellemcarlnielsenkonkurrencen(violini2016)ogtalentarbejdetpåstrygersiden.påsigttænkessåvelkon servatoriesommgkeleverdeltagendeistruktureretsamarbejdemedodensesymfoniorkester. Dererudviklingspotentialegennemetsærligfokuspåvækstlagetideselvorganiserendemiljøer(emusikogsinger songwritermiljøer)iforholdtilrekrutteringafelevertilproduktionslinjen,ogdetvilmgkfynudforskeidekom mendetoår. Den1.årigeforsøgsordninghvorMGKeleverpåsidstesemesterkonvertereholdtimertiletafslutningsprojekt,der erstatterdennormaleafgangsprøveihovedfagetergodkendtogigangsættesmed4sidstesemestereleverfra februar2016. Udfordringer DererbekymringvedudsigtentilFyns11.MusikskolepågrundafbevillingsbortfaldfraKulturregionFynfra2016 ikkekanforsættesittalentarbejdeinuværendeformogdervedfåsværerevedatleverekvalificeredeansøgeretil MGKFyn. ElevernestidspresiforholdtilskolegangogerhvervsarbejdesideløbendemedderesMGKkursuskræversærligt engagementmedhenblikpåenfleksibelstudieordning.deigangværendeforsøgmed35årsforløbfordesærlig ungemgkelever(dertypiskgårifolkeskole)børimplementeres/eksemplificeresikommenderammeaftale. DereretstortønskefraMGKFynomatsmidiggøreprocessenmedregnskabsaflæggelseogafrapporteringtilKul turstyrelsen,ogimødeserdenkommendeevalueringsprocesmedforventningtil,atdetlykkes. 10

16 3. Forholdet mellem MGK Fyn og Statens Kunstfonds Projektstøtteudvalg for Musik I dette kapitel vurderer Odense Musikskole, om den fireårige aftale understøtter MGK Fyns arbejde, og om der er noget Statens Kunstfonds Projektstøtteudvalg for Musik eller Kulturstyrelsen kan gøre bedre inden for de givne økonomiske rammer Rammeaftalen Er rammeaftalens overordnede mål relevante, eller ville det styrke MGK Fyns resultater, hvis målene var defineret på en anden måde? [Beskriv, hvorvidt de overordnede mål er relevante, og eventuelt hvorvidt målene burde formuleres på en anden måde.] Rammeaftalensmålerrelevante.Deterdogikkerelevantmedaftalenspunkt1.3.5omkring Professionelledelse, organisationogopgaveløsning dadetsetilysetafdriftenirammerneafenstorkommunalinstitutionmåværeen selvfølgeatledelse,organisationogopgaveløsningerprofessionel.aftalensformuleringersynesathaveudgangs punktienandenkontekst Skabeloner og vejledninger Hvordan fungerer Kulturstyrelsens skabeloner og vejledninger på Hvad fungerer godt, hvad fungerer dårligt, og hvordan kunne det blive bedre? [Beskriv] Detoplevessomrelativtarbejdskrævendemedmangeskabelonerogvejledningerforetstatsligttilskudtilendrift, somudgørenmindredelafdensamledevirksomhed. OrganiseringenmedrepræsentantskabogkoordinationsudvalgharmonererikkeheltmedprofessionelleMGK koordinatorerogmusikskolensbrugerråd.koordinationsudvalgetkunnemedfordeludpegesafrepræsentantska betforengivenperiodeogdermedskabemeresammenhængidendagligedrift. Derforekommerendeldobbeltmødermedsammedagsordnerisåvelbrugerråd,koordinationsudvalgogrepræ sentantskab Dialog med Statens Kunstfonds Projektstøtteudvalg for Musik Hvordan er den løbende dialog med Statens Kunstfonds Projektstøtteudvalg for Musik og Kulturstyrelsen? Har MGK Fyn indtil nu fået den vejledning og opbakning, der er brug for, eller er der noget, Statens Kunstråds Musikudvalg og Kulturstyrelsen kunne gøre bedre? 11

17 [Beskriv] ArbejdsgangenmedKulturstyrelseoplevesoftesomrettungmedpådenenesidelangventetidpåtilsagnsskrivelser oggodkendelser,deroftekanhaveenbehandlingstidmåltiår,ogpådenandensidemedenlangrækkeønskerom indogafrapporteringeroftemedkortaftræk. Derkunnemedfordeleffektiviseresogkoordineresiforholdtilarbejdsgangenetilgavnogglædeforsåvelstyrelsen sommgkfyn. 4. Behov for justering af de gældende rammer for den resterende del af aftaleperioden ( ) [Beskriv og begrund eventuelle forslag til justeringer af de gældende rammer for den resterende del aftaleperioden ( ).] Dererikkeønskeomatjustereellerændrerammenfordenresterendedelafperioden. 5. Påtegning Dato: 25. august 2015 Daglig leder: Uffe Most Bilag 1. Repræsentantskabet for MGK Fyn 2. Koordinationsudvalget for MGK Fyn 12

18 Bilag 1. Repræsentantskabet for MGK Fyn Navn Stilling Institution/organisation Finn Schumacker Musikchef Odense Symfoniorkester Morten Øberg Orkestermedlem TipToe Bigband Morten Østlund Leder Spillestedet Posten Lasse Tajmer Kulturchef Spillestedet Tobaksgården Henning Harder Leder Spillestedet Harmonien Lars Asger Nørby MGK studerende MGK Fyn Inge Bjarke Lektor Syddansk Musikkonservatorium Lene Høsthaab Formand Kulturregion Fyn Ellen Drost Kulturchef Kulturregion Fyn Uffe Veppler Formand Odense Musikskoles Brugerråd Nikolaj Juul Jørgensen Børn- og Unge-chef Odense Kommune-Region Vest Susanne Crawley Larsen Børn- og Unge-Rådmand Odense Kommune Anders Mogensen Formand Odense Musikudvalg Jens Thodberg Bertelsen Rektor Odense Katedralskole Niels Grønbæk Nielsen Chefkonsulent University College Lillebælt Jørgen Chr. Bang Lektor Syddansk Universitet Niels Erik Haug-Larsen Adm. Direktør Udvikling Fyn Anders Nyborg Leder No Domain Ole Kjellerup Musikkoordinator Odense Kommune-Ung Vest Uffe Most Musikskoleleder Odense Musikskole Lars Konrad Mortensen Musikskoleleder Nordfyns Musikskole Anders Richard Pedersen Musikskoleleder Nyborg Musikskole John Rasmussen Musikskoleleder Middelfart Musikskole Niels Thåstrup Musikskoleleder Assens Musikskole Jens Winther Musikskoleleder Langeland Musikskole Kim Bakdal Jensen Musikskoleleder Svendborg Musikskole Henrik Harder Musikskoleleder Ærø Musikskole Morten Just Musikskoleleder Kerteminde Musikskole Helle Jakobsen Musikskoleleder Faaborg-Midtfyn Musikskole Peter Sund Leder Fyns 11. musikskole Mats Ringaby Koordinator, klassisk MGK Fyn Svend Staal Larsen Koordinator, rytmisk MGK Fyn 13

19 Bilag 2. Koordinationsudvalget for MGK Fyn Navn Stilling Institution/organisation Uffe Most Musikskoleleder Odense Musikskole Anders Richard Pedersen Musikskoleleder Nyborg Musikskole Niels Thåstrup Musikskoleleder Assens Musikskole Peter Sund Leder Fyns 11. musikskole Mats Ringaby Koordinator, klassisk MGK Fyn Svend Staal Larsen Koordinator, rytmisk MGK Fyn 14

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Østjyllands virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Østjyllands virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Østjyllands virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering af

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Sjællands virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Sjællands virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Sjællands virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering af MGK

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Nords virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Nords virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Nords virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering af MGK Nords

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Hovedstadens virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Hovedstadens virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK Hovedstadens virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering af

Læs mere

Rammeaftale om det regionale spillested Fermaten

Rammeaftale om det regionale spillested Fermaten Rammeaftale om det regionale spillested Fermaten 1. Aftaleparter Statens Kunstråds Musikudvalg, Herning Kommune og Foreningen Fermaten. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Dacapo Edition-S' virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Dacapo Edition-S' virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Dacapo Edition-S' virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering

Læs mere

Rammeaftale om det regionale spillested Gimle

Rammeaftale om det regionale spillested Gimle Rammeaftale om det regionale spillested Gimle 1. Aftaleparter Statens Kunstråds Musikudvalg, Roskilde Kommune og Fonden Gimle. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål og vision

Læs mere

Rammeaftale om det regionale spillested Det Musiske Hus

Rammeaftale om det regionale spillested Det Musiske Hus Rammeaftale om det regionale spillested Det Musiske Hus 1. Aftaleparter Statens Kunstråds Musikudvalg, Frederikshavns Kommune og Det Musiske Hus under Fonden Arena Nord. 2. Aftaleperiode 1. januar 2013

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Samlet evaluering af MGK-centrene i Danmark i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Samlet evaluering af MGK-centrene i Danmark i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Samlet evaluering af MGK-centrene i Danmark i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering

Læs mere

Rammeaftale for det regionale spillested Studenterhuset for perioden

Rammeaftale for det regionale spillested Studenterhuset for perioden RAMMEAFTALE UDKAST Rammeaftale for det regionale spillested Studenterhuset for perioden 2017-2020 1. Aftalens formål og grundlag Denne 4-årige rammeaftale er indgået mellem Statens Kunstfonds Projektstøtteudvalg

Læs mere

Statusrapport for Sankt Annæ MGK, 26. august 2015

Statusrapport for Sankt Annæ MGK, 26. august 2015 Statusrapport for Sankt Annæ MGK, 26. august 2015 1. Hvordan er det gået i 2013-14? Status for talentudviklingen i det regionale musikliv Beskrivelse af områdets aktuelle status og udvikling under de første

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Copenhagen JazzHouse' virksomhed som regionalt spillested i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Copenhagen JazzHouse' virksomhed som regionalt spillested i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Copenhagen JazzHouse' virksomhed som regionalt spillested i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg

Læs mere

Rammeaftale om det regionale spillested Train

Rammeaftale om det regionale spillested Train Rammeaftale om det regionale spillested Train 1. Aftaleparter Statens Kunstråds Musikudvalg, Aarhus Kommune og Train. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål og vision for de regionale

Læs mere

Rammeaftale om det regionale spillested Klaverfabrikken Live

Rammeaftale om det regionale spillested Klaverfabrikken Live Rammeaftale om det regionale spillested Klaverfabrikken Live 1. Aftaleparter Statens Kunstråds Musikudvalg, Hillerød Kommune og Klaverfabrikken Live. 2. Aftaleperiode 1. januar 2013 til 31. december 2016.

Læs mere

Støtte til videreførelse af Fyns 11. Musikskole Marts 2015

Støtte til videreførelse af Fyns 11. Musikskole Marts 2015 Samrådet for Musikskoler på Fyn v/ formand Anders Richard Pedersen arp@nyborg.dk Tlf. 21 335 206 Støtte til videreførelse af Fyns 11. Musikskole Marts 2015 Den lokale medfinansiering, som Fyns 11. Musikskole

Læs mere

Rammeaftale om det regionale spillested Copenhagen JazzHouse

Rammeaftale om det regionale spillested Copenhagen JazzHouse Rammeaftale om det regionale spillested Copenhagen JazzHouse 1. Aftaleparter Statens Kunstråds Musikudvalg, Københavns Kommune og Fonden Copenhagen JazzHouse. 2. Aftaleperiode 1. januar 2013 til 31. december

Læs mere

Statens Kunstråds Musikudvalg: Samlet evaluering af de fem basisensembler 2010-2011

Statens Kunstråds Musikudvalg: Samlet evaluering af de fem basisensembler 2010-2011 - den Statens Kunstråds Musikudvalg: Samlet evaluering af de fem basisensembler 2010-2011 Denne evalueringsrapport indeholder Statens Kunstråds Musikudvalgs analyser, vurde ringer og anbefalinger vedrørende

Læs mere

Rammeaftale om det regionale spillested Global Copenhagen

Rammeaftale om det regionale spillested Global Copenhagen Rammeaftale om det regionale spillested Global Copenhagen 1. Aftaleparter Statens Kunstråds Musikudvalg, Københavns Kommune og Global Copenhagen. 2. Aftaleperiode 1. januar 2013 til 31. december 2016.

Læs mere

Statens Kunstråds Musikudvalg og Aalborg Kommune, Hvor MGK NORD drives og administreres af den kommunale institution Aalborg Kulturskole

Statens Kunstråds Musikudvalg og Aalborg Kommune, Hvor MGK NORD drives og administreres af den kommunale institution Aalborg Kulturskole Rammeaftale for MGK NORD 1. Aftaleparter Statens Kunstråds Musikudvalg og Aalborg Kommune, Hvor MGK NORD drives og administreres af den kommunale institution Aalborg Kulturskole 2. Aftaleperiode 1. januar

Læs mere

Rammeaftale om det regionale spillested Studenterhuset

Rammeaftale om det regionale spillested Studenterhuset Rammeaftale om det regionale spillested Studenterhuset 1. Aftaleparter Statens Kunstråds Musikudvalg, Aalborg Kommune og Aalborg Universitets Studenterhus. 2. Aftaleperiode 1. januar 2013 til 31. december

Læs mere

Rammeaftale om det regionale spillested Radar

Rammeaftale om det regionale spillested Radar Rammeaftale om det regionale spillested Radar 1. Aftaleparter Statens Kunstråds Musikudvalg, Aarhus Kommune og Radar. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål og vision for de regionale

Læs mere

Rammeaftale om det regionale spillested Musikhuzet Bornholm

Rammeaftale om det regionale spillested Musikhuzet Bornholm Rammeaftale om det regionale spillested Musikhuzet Bornholm 1. Aftaleparter Statens Kunstråds Musikudvalg, Bornholms Regionskommune og Fonden Musikhuzet Bornholm. 2. Aftaleperiode 1. januar 2013 til 31.

Læs mere

Rammeaftale om det regionale spillested Godset

Rammeaftale om det regionale spillested Godset Rammeaftale om det regionale spillested Godset 1. Aftaleparter Statens Kunstråds Musikudvalg, Kolding Kommune og Kulturinstitutionen Godset ved Kolding Kommune. 2. Aftaleperiode 1. januar 2013 til 31.

Læs mere

Rammeaftale om det regionale spillested Vega

Rammeaftale om det regionale spillested Vega Rammeaftale om det regionale spillested Vega 1. Aftaleparter Statens Kunstråds Musikudvalg, Københavns Kommune og Koncertvirksomhedens Fond (Vega). 2. Aftaleperiode 1. januar 2013 til 31. december 2016.

Læs mere

Rammeaftale om det regionale spillested Posten/Dexter

Rammeaftale om det regionale spillested Posten/Dexter Rammeaftale om det regionale spillested Posten/Dexter 1. Aftaleparter Statens Kunstråds Musikudvalg, Odense Kommune og Musikhuset Posten og Dexter. 2. Aftaleperiode 1. januar 2013 til 31. december 2016.

Læs mere

Rammeaftale om det regionale spillested Stars

Rammeaftale om det regionale spillested Stars Rammeaftale om det regionale spillested Stars 1. Aftaleparter Statens Kunstråds Musikudvalg, Vordingborg Kommune og Stars - Storstrøms Amts Rytmiske Spillested. 2. Aftaleperiode 1. januar 2013 til 31.

Læs mere

ÅBENT UDBUD. Frist for at indgive tilbud: 10. januar 2016. Udbudsmateriale Egnsteater i Næstved Kommune

ÅBENT UDBUD. Frist for at indgive tilbud: 10. januar 2016. Udbudsmateriale Egnsteater i Næstved Kommune ÅBENT UDBUD Frist for at indgive tilbud: 10. januar 2016 Udbudsmateriale Egnsteater i Næstved Kommune KONTAKTINFORMATION Udbuddet varetages af Center for Kultur og Borgerservice i Næstved Kommune. Tilbud

Læs mere

Rammeaftale om det regionale spillested Sønderborghus

Rammeaftale om det regionale spillested Sønderborghus Rammeaftale om det regionale spillested Sønderborghus 1. Aftaleparter Statens Kunstråds Musikudvalg, Sønderborg Kommune og Sønderborghus. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Status og udviklingsmuligheder for JazzDanmark, ROSA og World Music Denmark

Statens Kunstfonds Projektstøtteudvalg for Musik: Status og udviklingsmuligheder for JazzDanmark, ROSA og World Music Denmark Statens Kunstfonds Projektstøtteudvalg for Musik: Status og udviklingsmuligheder for JazzDanmark, ROSA og World Music Denmark Denne rapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks

Læs mere

Rammeaftale om det regionale spillested Culture Box

Rammeaftale om det regionale spillested Culture Box Rammeaftale om det regionale spillested Culture Box 1. Aftaleparter Statens Kunstråds Musikudvalg, Københavns Kommune og Kulturforening CB. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål

Læs mere

Job og kravprofil - afdelingsleder Aalborg Kulturskole

Job og kravprofil - afdelingsleder Aalborg Kulturskole Job og kravprofil - afdelingsleder Aalborg Kulturskole www.aalborgkulturskole.dk 1) Indledning 2) Ansættelsesudvalg 3) Tidsplan 4) Aalborg Kommunale Skolevæsen 5) Præsentation af Aalborg Kulturskole 6)

Læs mere

Syddansk Musikkonservatorium søger vicerektor

Syddansk Musikkonservatorium søger vicerektor Syddansk Musikkonservatorium søger vicerektor Syddansk Musikkonservatorium (SDMK) søger en vicerektor med stort kendskab til videregående uddannelser samt ledelse og organisation inden for det kunstneriske

Læs mere

Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og JazzDanmark.

Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og JazzDanmark. Marts 2013 Rammeaftale 2013-2016 for JazzDanmark 1. Aftalens formål og grundlag Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og JazzDanmark. JazzDanmark er en selvejende institution,

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK MidtVests virksomhed i

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK MidtVests virksomhed i Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af MGK MidtVests virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering af MGK

Læs mere

De fynske byråd ligger lavt placeret når det drejer sig om at lytte til erhvervslivet og at skabe mere privat beskæftigelse

De fynske byråd ligger lavt placeret når det drejer sig om at lytte til erhvervslivet og at skabe mere privat beskæftigelse September 2013 De fynske byråd ligger lavt placeret når det drejer sig om at lytte til erhvervslivet og at skabe mere privat beskæftigelse Hver tredje virksomhed på Fyn mener, at byrådet har været gode

Læs mere

Forslag til undervisningsplan for MGK

Forslag til undervisningsplan for MGK Forslag til undervisningsplan for MGK Klassisk linje Udarbejdet af Bodil Ørum og Hans Mydtskov. Indhold Indledning 1 Instrumental fagblok Hovedinstrument 4 Klaver 5 Teoretisk fagblok Hørelære/teori 6 Musikkundskab

Læs mere

REFERAT. Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 7 Mødedato: 25. september 2014 Tidspunkt: Kl. 11.30 til 15.00 Sted: Lokale 8, stuen

REFERAT. Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 7 Mødedato: 25. september 2014 Tidspunkt: Kl. 11.30 til 15.00 Sted: Lokale 8, stuen 26. septembert 2014 Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 7 Mødedato: 25. september 2014 Tidspunkt: Kl. 11.30 til 15.00 Sted: Lokale 8, stuen Kl. 10.00 møde med kulturminister Marianne

Læs mere

www.aalborgkulturskole.dk

www.aalborgkulturskole.dk Job og kravprofil Aalborg Kulturskole - med særligt fokus på folkeskolesamarbejde www.aalborgkulturskole.dk Vil du være med til at sætte retning, udvikle og indfri ambitiøse mål for samarbejdet mellem

Læs mere

Talentcentre og kraftcentre

Talentcentre og kraftcentre Talentcentre og kraftcentre 1.0 Indledning Team Danmark anser talentcentre og kraftcentre som en hjørnesten i en langsigtet udvikling af dansk eliteidræt. Formålet med talentcentrene og kraftcentrene er

Læs mere

Rammeaftale om det regionale spillested Loppen

Rammeaftale om det regionale spillested Loppen Rammeaftale om det regionale spillested Loppen 1. Aftaleparter Statens Kunstråds Musikudvalg, Københavns Kommune og Musikforeningen Loppen. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål

Læs mere

To af de i alt fem kriterier i en institutionsakkreditering er centreret omkring kvalitetssikring i form af:

To af de i alt fem kriterier i en institutionsakkreditering er centreret omkring kvalitetssikring i form af: Oprettet: 140318 Senest rev.: 150126 J.nr.: 2010-027729 Kvalitetssikring systematisk Ref: KP/MeO Behandlet / godkendt af: rektoratet 150121 Kvalitetssikring på DJM Institutionsakkreditering og kvalitetssikring

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Det Danske Suzuki Instituts virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Det Danske Suzuki Instituts virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Det Danske Suzuki Instituts virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks

Læs mere

Aftale mellem Byrådet og Randers Musikskole & MGK 2008

Aftale mellem Byrådet og Randers Musikskole & MGK 2008 Aftale mellem Byrådet og Randers Musikskole & MGK 2008 Indhold 1. Formål med aftalen 2. Politiske visioner, mål og krav 3. Randers Musikskole Hvem er vi? 4. Målene i aftalen 5. Økonomi 6. Gensidige aftaleforhold

Læs mere

REFERAT. Til stede fra udvalget: Bente Dahl, Henrik Jansberg, Henrik Marstal, Maria Frej indtil kl. 15.20 og Niels Rønsholdt.

REFERAT. Til stede fra udvalget: Bente Dahl, Henrik Jansberg, Henrik Marstal, Maria Frej indtil kl. 15.20 og Niels Rønsholdt. 16. marts 2015 Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 13 Mødedato: 26. marts 2015 Tidspunkt: fra kl. 10.00 til kl.16.20 Sted: Mødelokale 8 i stuen Fra kl. 13.00 til 14.00 mødtes udvalget

Læs mere

Beskriv hvad projektet går ud på

Beskriv hvad projektet går ud på Bilag til ansøgning om Talentudvikling musik Vejledning: Alle felter skal udfyldes. Skemaet skal vedhæftes som fil til det elektroniske ansøgningsskema. ---------------------------------------------------------------------------------------------------------------------------------------------

Læs mere

Rammeaftale om det regionale spillested Fonden VoxHall

Rammeaftale om det regionale spillested Fonden VoxHall Rammeaftale om det regionale spillested Fonden VoxHall 1. Aftaleparter Statens Kunstråds Musikudvalg, Aarhus Kommune og Fonden VoxHall. 2. Aftaleperiode 1. januar 2013 til 31. december 2016. 3. Formål

Læs mere

Dagsorden til møde i den politiske styregruppe 28. april 2016 kl Mødet afholdes på Kulturhuset Byskolen, Grønnegade 40, 5600 Faaborg

Dagsorden til møde i den politiske styregruppe 28. april 2016 kl Mødet afholdes på Kulturhuset Byskolen, Grønnegade 40, 5600 Faaborg Odense Kommune, Nørregade 36, 5000 Odense C Dagsorden til møde i den politiske styregruppe 28. april 2016 kl. 13-15.30. Mødet afholdes på Kulturhuset Byskolen, Grønnegade 40, 5600 Faaborg Indkaldt: Lene

Læs mere

MÅL MISSION VÆRDIER SDMK

MÅL MISSION VÆRDIER SDMK MÅL MISSION VÆRDIER SDMK MISSION Syddansk Musikkonservatorium har til opgave på kunstnerisk og, hvor det er relevant, videnskabeligt grundlag at give uddannelse i musik og musikpædagogik og tilgrænsende

Læs mere

Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og Edition S..

Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og Edition S.. RAMMEAFTALE Rammeaftale 2013-2016 for Edition S 1. Aftalens formål og grundlag Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og Edition S.. Edition S er en selvejende institution,

Læs mere

Indhold. Evalueringsrapport. Dansk deltagelse på Classical:NEXT 14. 17. maj 2014. Sammenfatning

Indhold. Evalueringsrapport. Dansk deltagelse på Classical:NEXT 14. 17. maj 2014. Sammenfatning 28. maj 2014 Evalueringsrapport Dansk deltagelse på Classical:NEXT 14. 17. maj 2014 Indhold Sammenfatning 1. Indledning 1.1 Om dansk deltagelse på Classical:NEXT 1.2 Organisering af den danske deltagelse

Læs mere

Rapport fra repræsentantskabet for MGK Hovedstaden

Rapport fra repræsentantskabet for MGK Hovedstaden Oktober 2011 MGK Hovedstaden Rapport fra repræsentantskabet for MGK Hovedstaden Iht. retningslinjer for afrapportering á 01.03.11 fra Statens Kunstråds fagudvalg for musik (SKM). Indhold 1. Repræsentantskabets

Læs mere

REFERAT. Til stede fra udvalget: Bente Dahl, Henrik Jansberg, Henrik Marstal, Maria Frej, Niels Rønsholdt, Asbjørn Keiding og Mikael Rørsted.

REFERAT. Til stede fra udvalget: Bente Dahl, Henrik Jansberg, Henrik Marstal, Maria Frej, Niels Rønsholdt, Asbjørn Keiding og Mikael Rørsted. 23. april 2014 Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 14 Mødedato: 22. april 2015 Tidspunkt: fra kl. 10.00 til kl.16.00 Sted: Mødelokale 8 i stuen Kl. 13.15 til 14.00 møde med ministeren

Læs mere

AMK-Syd 20-08-2015. Nøgletal for arbejdsmarkedet RAR Fyn

AMK-Syd 20-08-2015. Nøgletal for arbejdsmarkedet RAR Fyn AMK-Syd 20-08-2015 Nøgletal for arbejdsmarkedet RAR Fyn September 2015 Forord Beskæftigelsesområdet er omfattende og har stor betydning. Mange borgere er i kontakt med beskæftigelsessystemet, og der er

Læs mere

Resultatkontrakt for foreningen bag Forbrændingen 2015 2018

Resultatkontrakt for foreningen bag Forbrændingen 2015 2018 J.nr. 15/1666 Resultatkontrakt for foreningen bag Forbrændingen 2015 2018 Aftale om tilskud til drift af Forbrændingen mellem Forbrændingen og Albertslund Kommune for perioden 1. januar 2015 31. december

Læs mere

1. Aftalens parter. 2. Formål. 3. Aftalens indhold. 4. Parterne. Aftalen indgås mellem: Aabenraa Kommune Skelbækvej 2 6200 Aabenraa www.aabenraa.

1. Aftalens parter. 2. Formål. 3. Aftalens indhold. 4. Parterne. Aftalen indgås mellem: Aabenraa Kommune Skelbækvej 2 6200 Aabenraa www.aabenraa. 1 1. Aftalens parter Aftalen indgås mellem: Aabenraa Kommune Skelbækvej 2 6200 Aabenraa www.aabenraa.dk og VUC Syd Christian d. X s vej 39 6100 Haderslev www.vucsyd.dk 2. Formål Et partnerskab mellem Aabenraa

Læs mere

HR-strategi 2012. En fælles indsats for effektiv arbejdstilrettelæggelse, god ledelse, godt arbejdsmiljø og strategisk kompetenceudvikling

HR-strategi 2012. En fælles indsats for effektiv arbejdstilrettelæggelse, god ledelse, godt arbejdsmiljø og strategisk kompetenceudvikling HR-strategi 2012 En fælles indsats for effektiv arbejdstilrettelæggelse, god ledelse, godt arbejdsmiljø og strategisk kompetenceudvikling HR-strategi 2012 1 Indholdsfortegnelse HR-strategi 2012 s.3 Systematisk

Læs mere

Center for Anvendt Kunstnerisk Innovation

Center for Anvendt Kunstnerisk Innovation Center for Anvendt Kunstnerisk Innovation CAKI/ Fremtidens væksthus for de Kunstneriske og Kreative Uddannelser Projektbeskrivelse, Philip de Langes Allé 10, 1435 København K 1 Indhold Notat vedrørende

Læs mere

Strategi for Dansk Talentakademi

Strategi for Dansk Talentakademi Strategi for Dansk Talentakademi Baggrund I 2003 blev Nordvestjysk Talentcenter etableret med en ambition om, at det i Holstebro skulle være muligt at dygtiggøre sig inden for flere forskellige kunstarter,

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af de regionale spillesteder i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af de regionale spillesteder i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af de regionale spillesteder i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks analyser, vurderinger

Læs mere

Ansøgning om fortsat at varetage opgaven som MGK-center i Region Hovedstaden, jf.

Ansøgning om fortsat at varetage opgaven som MGK-center i Region Hovedstaden, jf. 01-11-2012 København oktober 2012 MGK Hovedstaden Ansøgning om fortsat at varetage opgaven som MGK-center i Region Hovedstaden, jf. Statens Kunstråds Musikudvalgs rammer for indgåelse af flerårige aftaler

Læs mere

Udkast til samarbejde om den virksomhedsrettede indsats på Fyn

Udkast til samarbejde om den virksomhedsrettede indsats på Fyn Udkast til samarbejde om den virksomhedsrettede indsats på Fyn Notat udarbejdet som baggrundsmateriale til en drøftelse af samarbejde om den virksomhedsrettede indsats på Fyn for de beskæftigelsespolitiske

Læs mere

Indhold. Evalueringsrapport. Dansk deltagelse på Classical:NEXT 21. 23. maj 2015. Sammenfatning

Indhold. Evalueringsrapport. Dansk deltagelse på Classical:NEXT 21. 23. maj 2015. Sammenfatning 17. juni 2015 Evalueringsrapport Dansk deltagelse på Classical:NEXT 21. 23. maj 2015 Indhold Sammenfatning 1. Indledning og baggrund 1.1 Om dansk deltagelse på Classical:NEXT 1.2 Organisering af den danske

Læs mere

Hverv fordelt på regionsrådsmedlemmer

Hverv fordelt på regionsrådsmedlemmer Hverv fordelt på regionsrådsmedlemmer - 27. april 2016 Regionsrådsmedlem Andrea Terp (A) Bente Gertz (A) Bjarne Jensen (O) Bo Libergren (V) Carsten Abild (V) Hverv Erhvervsakademi Lillebælt Fordelingsudvalg

Læs mere

REFERAT. Godkendt af udvalget den 7. november 2014.

REFERAT. Godkendt af udvalget den 7. november 2014. 25. oktober 2014 Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 8 Mødedato: 22.- 24. oktober 2014 Tidspunkt: Onsdag fra kl. 9.00 til 18.00 Torsdag kl. 9.00 til 18.00 Fredag kl. 9.00 til 13.00

Læs mere

Job- og personprofil. Afdelingschef Natur & Miljø i Holstebro Kommune

Job- og personprofil. Afdelingschef Natur & Miljø i Holstebro Kommune Job- og personprofil Afdelingschef Natur & Miljø i Holstebro Kommune 1 1. Indledning Vores nuværende afdelingschef i Natur og Miljø gennem de sidste godt otte år er blevet ansat som forvaltningsdirektør

Læs mere

NATIONALE MÅL FOR SUNDHEDS- VÆSENET

NATIONALE MÅL FOR SUNDHEDS- VÆSENET NATIONALE MÅL FOR SUNDHEDS- VÆSENET 2 NATIONALE MÅL FOR SUNDHEDSVÆSENET VI LØFTER KVALITETEN MED PATIENTEN I CENTRUM Vi har de seneste 10-15 år oplevet et markant løft i kvaliteten i det danske sundhedsvæsen.

Læs mere

HF & VUC FYN er landets største VUC, og det forpligter. Derfor vil vi også være landets bedste VUC til at

HF & VUC FYN er landets største VUC, og det forpligter. Derfor vil vi også være landets bedste VUC til at Fælles fokus på læring HF & VUC FYN bygger bro til en fremtid med mere uddannelse bedre job og højere livskvalitet Strategi 2016 2019 Med udgangspunkt i denne vision uddanner vi unge og voksne i et miljø,

Læs mere

Afslutningskonference 24. november 2014. Mogens Kragh Andersen

Afslutningskonference 24. november 2014. Mogens Kragh Andersen Afslutningskonference 24. november 2014 Mogens Kragh Andersen Formand for styregruppen for Syddansk Uddannelsesaftale 1 Disposition for velkomst Hvordan arbejdes der med uddannelse regionalt under Syddansk

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Dansk Amatørmusik (DAM)'s virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Dansk Amatørmusik (DAM)'s virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af Dansk Amatørmusik (DAM)'s virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering

Læs mere

KUNST TALENT KLASSEN SKÆLSKØR SKOLE 2016/2017

KUNST TALENT KLASSEN SKÆLSKØR SKOLE 2016/2017 KUNSTTALENTKLASSEN SKÆLSKØR SKOLE 2016/2017 VIL DU DYRKE DIT TALENT? Skal du i 7. klasse efter sommerferien 2016? Elsker du musik, kunst, design eller performance? Drømmer du om at skabe dit eget professionelle

Læs mere

Deltagerliste. (opdateret 11. maj 2015) FMOL netværksevent 2015

Deltagerliste. (opdateret 11. maj 2015) FMOL netværksevent 2015 Deltagerliste (opdateret 11. maj 2015) FMOL netværksevent 2015 ÅRGANG 2009 Ghita Sausdal HR-specialist Københavns Kommune Jan Lavdal Forstander Solglimt Lilian Vium Forstander Sandfeldgården Lisbeth Muurholm

Læs mere

Hverv fordelt på regionsrådsmedlemmer

Hverv fordelt på regionsrådsmedlemmer Hverv fordelt på regionsrådsmedlemmer - 28. oktober 2015 Regionsrådsmedlem Andrea Terp (A) Bente Gertz (A) Bjarne Jensen (O) Bo Libergren (V) Carsten Abild (V) Hverv Erhvervsakademi Lillebælt Fordelingsudvalg

Læs mere

26. maj Strategi for Det Kongelige Danske Musikkonservatorium

26. maj Strategi for Det Kongelige Danske Musikkonservatorium 26. maj 2011 Strategi for Det Kongelige Danske Musikkonservatorium 1. Indledning Det Kongelige Danske Musikkonservatorium indtager en helt central rolle i Danmarks musik- og kulturliv. Lærerkorpset rummer

Læs mere

Musiktalenter skal brande kommunen

Musiktalenter skal brande kommunen Musiktalenter skal brande kommunen Hedensted Kommune vil gerne være kendt for at satse på musikken. Tørring Skole og Hedensted Musikskole skal folde drømmen ud med projektet Musik Talent Tørring. Af Jakob

Læs mere

Studieordning (bind I) for Solistuddannelsen i musik

Studieordning (bind I) for Solistuddannelsen i musik Studieordning (bind I) for Solistuddannelsen i musik VERSION 1 160503 Side 1 af 5 Indholdsfortegnelse 1. Indledning... 3 2. Uddannelsens betegnelse på dansk og engelsk... 3 2.1. Dansk... 3 2.2. Engelsk...

Læs mere

Deltagerliste. FMOL netværksevent 2015

Deltagerliste. FMOL netværksevent 2015 FMOL netværksevent 2015 ÅRGANG 2009 Ghita Sausdal HR-specialist Københavns Kommune Jan Lavdal Forstander Solglimt Lilian Vium Forstander Sandfeldgården Lisbeth Muurholm Sygehusapoteker Odense Universitetshospital,

Læs mere

St. Championats Pokal

St. Championats Pokal St. Championats Pokal 2015 Th. & Poul Pedersen "013 Svendborg" 2014 Th. & Poul Pedersen " 013 Svendborg" 2013 Th. & Poul Pedersen " 013 Svendborg" 2012 Th. & Poul Pedersen " 013 Svendborg" 2011 Svend Kærgård

Læs mere

Regnskaber og beretninger 2013 for selvejende musikinstitutioner.

Regnskaber og beretninger 2013 for selvejende musikinstitutioner. Punkt 3. Regnskaber og beretninger 2013 for selvejende musikinstitutioner. 2014-23316. Sundheds- og Kulturforvaltningen fremsender til Sundheds- og Kulturudvalgets orientering, regnskaber og beretninger

Læs mere

Rammeaftalen gælder for 2015-2018. Hver part kan opsige aftalen med 6 måneders varsel til udgangen af et kalenderår.

Rammeaftalen gælder for 2015-2018. Hver part kan opsige aftalen med 6 måneders varsel til udgangen af et kalenderår. 1 1. Aftalens parter Aftalen indgås mellem: Aabenraa Kommune Skelbækvej 2 6200 Aabenraa www.aabenraa.dk og IBC Birkemosevej 1 6000 Kolding www.ibc.dk 2. Aftaleperiode og opsigelse Rammeaftalen gælder for

Læs mere

Indstilling. Realisering af musikpolitiske initiativer. 1. Resume. Til Aarhus Byråd via Magistraten. Kultur og Borgerservice.

Indstilling. Realisering af musikpolitiske initiativer. 1. Resume. Til Aarhus Byråd via Magistraten. Kultur og Borgerservice. Indstilling Til Aarhus Byråd via Magistraten Kultur og Borgerservice 13. juni 2012 Aarhus Kommune Kulturforvaltningen Kultur og Borgerservice Realisering af musikpolitiske initiativer. 1. Resume Magistratsafdelingen

Læs mere

Ældre- og Handicapforvaltningen, Aalborg Kommune Aalborg på Forkant Innovativ udvikling i sundhed og velfærd. Forundersøgelse. Aalborg på Forkant

Ældre- og Handicapforvaltningen, Aalborg Kommune Aalborg på Forkant Innovativ udvikling i sundhed og velfærd. Forundersøgelse. Aalborg på Forkant Forundersøgelse - bedre sundhed og mere omsorg og pleje for færre ressourcer Udvikling af innovative sundheds- og velfærdsløsninger i Ældre- og Handicapforvaltningen i Aalborg Kommune 1 Indholdsfortegnelse

Læs mere

Fra Musikcentret: Henrik Wenzel Andreasen og Connie Nielsen (referent) samt de relevante sagsbehandlere, hvor det var nødvendigt.

Fra Musikcentret: Henrik Wenzel Andreasen og Connie Nielsen (referent) samt de relevante sagsbehandlere, hvor det var nødvendigt. 13. januar 2010 Til medlemmerne af Statens Kunstråds Musikudvalg Referat af møde nr. 12 i 2009 i Musikudvalget tirsdag den 15. december fra kl. 10.00 til 15.00 i Musikcentrets mødelokale på H.C. Andersens

Læs mere

Referat af bestyrelsesmøde i DMKL 3. december 2015 Kl 10:00 16:00 Vartov, Farvergade 27, 1463 København K

Referat af bestyrelsesmøde i DMKL 3. december 2015 Kl 10:00 16:00 Vartov, Farvergade 27, 1463 København K Referat af bestyrelsesmøde i DMKL 3. december 2015 Kl 10:00 16:00 Vartov, Farvergade 27, 1463 København K Til stede: Lena Schnack Mertz, Morten Lønborg Friis, Jan Jacobsen, Jens Bloch, Jørgen Graven Nielsen,

Læs mere

NYE TONER KULTURMINISTERIETS MUSIKHANDLINGSPLAN Vision

NYE TONER KULTURMINISTERIETS MUSIKHANDLINGSPLAN Vision MUSIKHANDLINGSPLAN 2008-2011 MAJ 2008 NYE TONER KULTURMINISTERIETS MUSIKHANDLINGSPLAN 2008-2011 Vision Dansk musik skal udfolde sit fulde potentiale. Både nationalt og internationalt. Kulturministeriets

Læs mere

REFERAT. Bente Dahl, Henrik Jansberg, Maria Frej, Henrik Marstal, Niels Rønsholdt og Søren B. Kristensen.

REFERAT. Bente Dahl, Henrik Jansberg, Maria Frej, Henrik Marstal, Niels Rønsholdt og Søren B. Kristensen. 23. august 2016 Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 27 Mødedato: 22. august 2016 Tidspunkt: fra kl. 9.30 til kl.15.30 Sted: Mødelokale 5 i stuen Mødtes med Lotte Toftemark og Line

Læs mere

Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og Spot Festivalen.

Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og Spot Festivalen. RAMMEAFTALE Rammeaftale 2013-2016 for Spot Festivalen 1. Aftalens formål og grundlag Denne 4-årige rammeaftale er indgået mellem Statens Kunstråds Musikudvalg og Spot Festivalen. Spot Festivalen er en

Læs mere

REFERAT. Statens Kunstfonds Bestyrelse Møde nr. 10 Mødedato: 2. december 2015 Tidspunkt: Kl. 10.00 16.00 Sted: Lokale 8

REFERAT. Statens Kunstfonds Bestyrelse Møde nr. 10 Mødedato: 2. december 2015 Tidspunkt: Kl. 10.00 16.00 Sted: Lokale 8 7. december 2015 Statens Kunstfonds Bestyrelse Møde nr. 10 Mødedato: 2. december 2015 Tidspunkt: Kl. 10.00 16.00 Sted: Lokale 8 REFERAT Til stede fra bestyrelsen: Gitte Ørskou (fmd.), Anne Lise Marstrand-Jørgensen

Læs mere

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af JazzDanmarks virksomhed i 2013-2014

Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af JazzDanmarks virksomhed i 2013-2014 Statens Kunstfonds Projektstøtteudvalg for Musik: Evaluering af JazzDanmarks virksomhed i 2013-2014 Denne evalueringsrapport indeholder Statens Kunstfonds Projektstøtteudvalg for Musiks vurdering af JazzDanmarks

Læs mere

REFERAT. Til stede fra udvalget: Bente Dahl, Henrik Jansberg, Asbjørn Keiding, Maria Frej, Mikael Rørsted, Henrik Marstal og Niels Rønsholdt.

REFERAT. Til stede fra udvalget: Bente Dahl, Henrik Jansberg, Asbjørn Keiding, Maria Frej, Mikael Rørsted, Henrik Marstal og Niels Rønsholdt. 6. marts 2014 Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 2 Mødedato: 4. - 5. marts 2014 Tidspunkt: Tirsdag kl. 12.00 til onsdag kl. 13.00 Sted: Schæffergården, Jægersborg Allé 166, 2820

Læs mere

REFERAT. Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 1 Mødedato: 7. februar 2014 Tidspunkt: Kl. 11.00 til 16.20 Sted: Lokale 8, stuen

REFERAT. Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 1 Mødedato: 7. februar 2014 Tidspunkt: Kl. 11.00 til 16.20 Sted: Lokale 8, stuen 10. februar 2014 Statens Kunstfonds Projektstøtteudvalg for Musik Møde nr. 1 Mødedato: 7. februar 2014 Tidspunkt: Kl. 11.00 til 16.20 Sted: Lokale 8, stuen REFERAT Til stede fra udvalget: Bente Dahl, Henrik

Læs mere

Derfor vil vi arbejde målrettet for, at Folketinget beslutter at gennemføre projekterne.

Derfor vil vi arbejde målrettet for, at Folketinget beslutter at gennemføre projekterne. Fyn på banen FYN på banen Væksten i den fynske byregion skal øges gennem investeringerne i infrastrukturen Vi vil skabe et bæredygtigt transportsystem Den fynske byregion skal have Danmarks bedste bredbåndsdækning

Læs mere

Kultur- og Fritidspolitik

Kultur- og Fritidspolitik Kultur- og Fritidspolitik Nordfyns Kommune Revideret den 15. august 2014 Dokument nr. 480-2014-852344 Sags nr. 480-2013-36230 Indhold FORORD... 2 INDLEDNING... 3 VISIONEN... 4 VÆRDIER... 5 NORDFYNS KOMMUNE

Læs mere

Derfor vil vi arbejde målrettet for, at Folketinget beslutter at gennemføre projekterne.

Derfor vil vi arbejde målrettet for, at Folketinget beslutter at gennemføre projekterne. Fyn på banen FYN på banen Væksten i den fynske byregion skal øges gennem investeringerne i infrastrukturen Vi vil skabe et bæredygtigt transportsystem Den fynske byregion skal have Danmarks bedste bredbåndsdækning

Læs mere

Baggrund en befolkningsudvikling uden musikalsk afsmitning

Baggrund en befolkningsudvikling uden musikalsk afsmitning 1. juli 2010 Projektbeskrivelse: Brobygningskursus inklusionsprojekt for indvandrede musikere Baggrund en befolkningsudvikling uden musikalsk afsmitning Befolkningsstatistikker fra de seneste årtier viser

Læs mere

Bidrag til musikhandlingsplanen. Publikum i fokus

Bidrag til musikhandlingsplanen. Publikum i fokus Bidrag til musikhandlingsplanen Publikum i fokus Hermed fremsættes forslag om et innovativt forsøgsprogram omfattende alle musikgenrer, hvis formål er at udnytte potentialet for nye publikumsoplevelser

Læs mere

Bilag 3: Opgavebeskrivelse 4. maj 2016. Offentligt udbud af faglig bistand og facilitering af netværk på det socialøkonomiske forretningsområde

Bilag 3: Opgavebeskrivelse 4. maj 2016. Offentligt udbud af faglig bistand og facilitering af netværk på det socialøkonomiske forretningsområde Bilag 3: Opgavebeskrivelse 4. maj 2016 Offentligt udbud af faglig bistand og facilitering af netværk på det socialøkonomiske forretningsområde 0. Definitioner og termer Definerede termer fra Konsulentaftalen

Læs mere

Vær med til at præge den nye fynske kulturaftale 2011-2014

Vær med til at præge den nye fynske kulturaftale 2011-2014 Vær med til at præge den nye fynske kulturaftale 20112014 Tirsdag d. 9. marts kl. 16.0020.30 på spillestedet Posten, Østre Stationsvej 35, 5000 Odense C. Nye ideer ny energi Det fynske kultursamarbejde

Læs mere

Tabel 1: Sidste års mål for FVU indsatsen og sidste års faktiske aktivitetsniveau i alt, målt som antal FVU-kursister.

Tabel 1: Sidste års mål for FVU indsatsen og sidste års faktiske aktivitetsniveau i alt, målt som antal FVU-kursister. FVU-plan På baggrund af Region Syddanmarks oplæg til indhold og form til FVU-planerne, og den efterfølgende drøftelse heraf med voksenuddannelsescentrene og deres uddannelsesudvalg den 27. november 2007,

Læs mere

AMK-Syd 19-01-2016. Status på reformer og indsats RAR Sydjylland

AMK-Syd 19-01-2016. Status på reformer og indsats RAR Sydjylland AMK-Syd 19-01-2016 Status på reformer og indsats RAR Sydjylland Januar 2016 Forord Beskæftigelsesområdet er omfattende og har stor betydning. Mange borgere er i kontakt med beskæftigelsessystemet, og der

Læs mere

1. Organisation. Den nærmere organisering af Roskilde Kommunes arbejde med eliteidræt er beskrevet i bilag

1. Organisation. Den nærmere organisering af Roskilde Kommunes arbejde med eliteidræt er beskrevet i bilag Team Danmark og Roskilde Kommune, herefter parterne, er blevet enige om denne samarbejdsaftale, som har til formål at fremme vilkårene for talentudvikling og eliteidræt i Roskilde Kommune. Parterne som

Læs mere