Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle

Save this PDF as:

Størrelse: px
Starte visningen fra side:

Download "Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle"


1 BIOINFORMATIK Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle indhold DNA 2 Hvilke databaser skal man vælge? 2 Søgning på en nukleotidsekvens 2 Proteiner 4 Søgning på aminosyresekvenser 4 Søgning på proteiners 3-D-struktur 5 Søgning på baggrund af aminosyresekvens 5 Søgning på baggrund af navn, art el. lign. 5 Søgning på baggrund af PDB ID 5 Undersøgelse af proteinets tredimensionelle struktur 5 Søg videre 6 Proteiner fra kapitel 3 7 Proteiner fra kapitel 4 7 Proteiner fra kapitel 5 7 Proteiner fra kapitel 6 8 Proteiner fra kapitel 7 8 BIOINFORMATIK Supplerende materiale til Biokemibogen liv, funktion, molekyle Kresten Cæsar Torp og Nucleus Forlag ApS Eksemplarfremstilling af papirkopier/prints fra denne hjemmeside til undervisningsbrug på uddannelsesinstitutioner og intern administrativ brug er tilladt med en aftale med Copydan Tekst & Node. Eksemplarfremstillingen skal ske inden for aftalens begrænsninger.

2 DNA DNA s struktur og metoderne til sekventering af DNA er beskrevet i Biokemibogen side På side 51 opsummeres nogle af de vigtigste problemer man kan behandle vha. www-baserede databaser: Søge efter bestemte sekvenser eller gener. Sammenligne sekvenser af ønskede gener (alignment). Søge efter homologe sekvenser, dvs. sekvenser der går igen i gener fra forskellige arter. Søge efter hvor et bestemt gen kan klippes med bestemte enzymer. Søge på oversættelser af generne til protein. Her er en praktisk vejledning til hvordan man kan prøve nogle af disse funktioner af. Hvilke databaser skal man vælge? DNA-sekvenser ligger på tre primære databaser, EMBL (Europa), GenBank (USA) og DDJB (Japan), som opdateres dagligt. Her ud over findes der et antal særlige databaser som letter specielle former for søgning. Non-redundant (nr)-databaser er omfattende databaser som har den fordel at man kan undgå flere udgaver af samme resultat. De mindre databaser, fx expressed sequence tags (EST) har flere referencer og kommentarer til søgeresultatet. Fra databaserne er der adgang til forskellige søgeprogrammer og hjælpeværktøjer. Her starter vi på GenBank, Det kan være en god ide først at orientere sig på siden. Under fanerne for oven på siden er der adgang til forskellige databaser og søgeprogrammer der går på tværs af disse. Der er også adgang til artikelsamlinger som dog kræver registrering. Se fx på kromosomkortene som du finder under Entrez, Human Genome og Browse Genome. Tryk på kromosomerne og se om du kan finde gener du kender fra Biokemibogen. Søgning på en nukleotidsekvens Vi har en nukleotidsekvens: TTAATAATGTATTCCAGAGTGAAGCAGATATGTAGAGAAGATGGGCACACATATGTTGAAGTGAATGACTTAACTTTGAC ATTGTCAAATCATTTGTCATTTCATGCTGCTTCAGAGTCTCTGAAGTTTTTGAAGGATATTGGTGTGGTGACATATGAGA AGTCCTGTGTCTTCCCTTATGACCTTTACCATGCTGAAAGAGCCATGGCCTTTTCAATTTGTGACCTGATGAAGAAACCT CCTTGGCATTTATGTGTCGATGTCGTAAAGGTGCTTGCCTCTATTCACACCACAAAACCTGAGAATTCAAGCGATGATGC ATTGAATGAGAGCAAACCTGATGAATTAAGATTAGAAAATCCTGTGGATGTTGTGGACACACAGGACAATGGTGACCATA TTTGGACTAATGGTGAAAAT Hvor i det menneskelige genom hører den hjemme? For at finde ud af det laver vi en homologisøgning med søgeprogrammet BLAST (Basic Local Alignment Search Tool). Homologi, enslydende, refererer egentlig til en antagelse om at to gener er evolutionært beslægtede fordi de stammer fra beslægtede organismer. Her anvendes det dog om i hvor høj grad nukleotiderne i to sekvenser stemmer overens, slægtskab eller ej. 1. Vælg BLAST i menuen. Herfra vil der være forskellige muligheder for søgning. Man kan vælge hvilken art man ønsker at søge på, om man vil søge på nukleotidsekvenser, proteiner eller oversættelser mellem nukleotider og aminosyrer. Søg i det menneskelige genom ved at vælge human. 2. Sæt sekvensen ind i søgefeltet (Enter an accession). Kopier ovenstående sekvens og sæt den ind.

3 3. Herefter er der flere muligheder: a. Set subsequence: Her kan man udvælge dele af sekvensen for søgningen. b. Database: Her kan man vælge mellem forskellige databaser. I dette tilfælde vælges genome (all assemblies) hvorved søgningen sker i forskelllige sekventerede genomer. c. Program: Her vælger man om man vil sammenligne med andre nukleotidsekvenser, med proteinsekvenser som kan være resultat af oversættelse af nukleotidsekvensen eller med andre arters genom. Vælg megablast. d. Expect: Dette tal angiver sandsynligheden for at den fundne sekvens stemmer overens med den indtastede ved et tilfælde. 0,01 angiver således at det vil kunne forventes i 1 ud af 100 gange. Ofte sættes værdien til 10 i første søgning. Resultater med en højere sandsynlighed end den angivne vises ikke. e. Filter: Her kan man aktivere et filter som frasorterer visse sekvenser som går igen mange steder på genomet. f. Descriptions og alignments: Her vælger man antallet af korte beskrivelser og sekvenser man ønsker at se. De sorteres efter hvilke der passer bedst med den indtastede, så selvom der vises mange, vil de først viste være dem der passer bedst 4. Begin search bringer næste side frem hvor man kan foretage yderligere valg for at begrænse søgningen. Her kan man bl.a. med flueben i graphical overview få en farveindikation for hvor sekvensen passer bedst med de fundne (alignment score). 5. Tryk på view report og se resultatet. a. Øverst vises i hvilken database matchene er fundet. Ved søgning i genomer kan man med Genome View se placeringen af sekvensen i genomet. På hvilket kromosom befinder sekvensen sig? Vælger du Genome view kan du blive nødt til at søge igen fordi siden forældes. b. Herefter følger en grafisk gengivelse af hvor godt de fundne sekvenser matcher. Hvad viser farven? Passer de fundne sekvenser godt med den indtastede? c. Referencen nedenunder virker som et direkte link til den database hvor sekvensen er fundet. Under referencen er evt. beskrevet features, dvs. egenskaber, for denne del af genomet. Hvilket gen stammer denne sekvens fra? Slå navnet efter i Biokemibogen, og find ud af hvilken funktion det har i cellen. d. Herefter følger en direkte sammenligning af baserne mellem Query, den indtastede forespørgsel, og Sbjct, den tilbageleverede sekvens. Er der fuld overensstemmelse? Er der baser som ikke stemmer overens? (De angives ved at der ikke er streger imellem dem). 6. Prøv nu at gå tilbage og lav en ny søgning på en mindre del af sekvensen. Gå tilbage og vælg fx set subsequence til a. Hvor høj er alignmentscoren nu? Hvorfor kan man ikke have så stor tillid til resultatet når sekvensen bliver kortere? 7. For meget korte sekvenser skal man bruge andre søgeprogrammer. Prøv fx at sammenligne en sekvens på 30 nukleotider. 8. Lav mutationer i sekvensen. Byt baser ud, søg og se hvad der sker. Prøv også at indsætte eller fjerne baser. Hvordan gengives disse huller eller gaps? Hvad kalder man disse typer af mutationer? Se Biokemibogen side 61. Har andre arter gener for helikase der minder om vores? Gå tilbage til BLAST-startsiden, hvor du kan vælge at søge i andre arters genom. Ud over menneske, mus og rotte, anvendes arternes latinske navne. Vælg evt. søgeprogrammet blastn i stedet for megablast, idet det tager flere sekvenser med og reguler evt. på expect. Hvor finders tilsvarende sekvenser?

4 Proteiner Søgning på aminosyresekvenser Søgning på aminosyresekvenser kan også foretages vha. BLAST. I databaser som disse gengives aminosyrernes navne normalt med ét-bogstav-forkortelser, i stedet for de tre som er brugt i Biokemibogen, side 72: Aminosyre Forkortelser Alanin Ala A Arginin Arg R Asparagin Asn N Aspartat Asp D Cystein Cys C Glutamat Glu E Glutamin Gln Q Glycin Gly G Histidin His H Isoleucin Ile I Leucin Leu L Lysin Lys K Methionin Met M Phenylalanin Phe F Prolin Pro P Serin Ser S Threonin Thr T Tryptofan Trp W Tyrosin Tyr Y Valin Val V Hvor stammer følgende aminosyresekvens fra? TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTV Har du allerede prøvet at søge på nukleotidsekvenser, kan du også her bruge Genbank på adressen www. 1. Vælg BLAST i menuen. Vælg derefter protein blast under Basic BLAST 2. Aminosyresekvensen kopieres til søgefeltet. 3. I databasen kan man vælge mellem flere muligheder. Både pdb (Protein Data Bank) og Swissprot er databaser hvor proteinerne er godt annoterede, og det er let at arbejde videre med deres tredimensionelle strukturer. Vælg non-redundant protein sequences (nr). 4. Tryk BLAST og vurder resultatet. a. Først vises referencer til søgningen, og hvor mange sekvenser der er fundet. b. Dernæst vises med en farvekode hvor sandsynligt det er at de fundne sekvenser matcher den indtastede (Query). Sammenlign farverne med farveskalaen (alignment scores). Hvor godt stemmer de overens? c. Herefter følger referencer til databaser og artikler for de fundne sekvenser. Øverst vises de sekvenser der matcher bedst. Se de øverste titler igennem. Giver de et hint om hvilket protein der er tale om? Find proteinet i Biokemibogen. Hvad er det for et protein? d. Se listen over søgeresultater igennem. Hvilke arter kan du finde referencer til? Hvad fortæller det om proteinet at sekvenserne er forholdsvis ens? Sammenlign evt. afstanden mellem sekvenserne vha. distance tree of results. e. Søgningen finder også et andet protein, som du kan finde i Biokemibogen (se fx side 80-81). Er det overraskende at begge proteiner matcher sekvensen? Det kan alternativt være en god ide at søge i en database med mere fyldestgørende beskrivelser af proteinerne. Gå fx tilbage, indsæt sekvensen og vælg i stedet Protein Data Bank, pdb. Hvordan ser søgeresultaterne nu ud? Koden til venstre (fx pdb 1GCT A) er molekylets PDB ID. 1GCT kan således bruges til at søge videre på proteinets struktur, bl.a. på den følgende database.

5 Søgning på proteiners 3-D-struktur Nogle databaser indeholder lettilgængelig information om proteiners tredimensionelle struktur, både strukturer bestemt eksperimentelt og teoretisk beregnede modeller, se Biokemibogen side 78. Her bruger vi Orienter dig på hjemmesiden. Under General education og Educational resources er der fx gode animationer, posters, flash tutorials (vejledninger til databasen), vejledninger til at bygge fysiske modeller af proteinerne o.l. Udskriv fx posteren Molecular Machinery: A Tour of the Protein Data Bank og hæng den op i klasselokalet. Hvem kan forsyne flest af molekylerne med sidehenvisninger til bogen? Søgning på baggrund af aminosyresekvens I det følgende ser vi nærmere på et af bogens molekyler. 1. Vælg search. 2. Starter man med en aminosyresekvens, vælges sequence, og sekvensen kopiers til søgefeltet. Marker feltet use sequence. 3. Tryk search og vurder resultatet. Antallet af søgeresultater kan indsnævres ved at justere Expect-værdien (Her hedder den: E cut off) ned til fx Til venstre for hvert søgeresultat er en lille molekyltegning. Aktiveres linket kommer molekyltegningen frem i højre side. Under tegningen er der links til forskellige hjælpeprogrammer som kan bruges til at undersøge og arbejde videre med strukturen. Søgning på baggrund af navn, art el. lign. Da mange af molekylerne i databasen er modificerede i forbindelse med de forsøg de stammer fra, kan dette være vanskeligt. 1. Vælg search i venstre side Dette giver forskellige muligheder for søgninger. 2. Vælg advanced search. 3. Under Choose a query type vælges fx molecule name. 4. Skriv molekylets engelske navn i søgefeltet og tryk på evaluate subquery. Du kan nu se hvor mange resultater du får. 5. Vælg evt. at indsnævre søgningen ved at trykke på Vælg fx hvilken organisme, Source Organism du søger indenfor. 7. Tryk evaluate query. Du får nu de fundne molekyler. Søgning på baggrund af PDB ID De molekyler som indrapporteres til databasen forsynes med et PDB ID. Med PDB ID kan man søge på molekylet, dels i søgebjælken for oven på hjemmesiden, dels via de øvrige søgemuligheder. PDB ID for de vigtigste af Biokemibogens proteiner er gengivet i tabellen under Søg videre nedenfor. 1. Skriv fx PDB ID for Carboxypeptidase, 1M4L i søgefeltet. Tryk Site Search. 2. Hvilke oplysninger får man om proteinet? Undersøgelse af proteinets tredimensionelle struktur Under tegningen til højre er der links til forskellige hjælpeprogrammer som kan bruges til at undersøge og arbejde videre med strukturen. Vælg fx MBT ProteinWorkshop. Flere af programmerne kræver at java er installeret på computeren. Det kan downloades gratis her. 1. Drej molekylet med musen ved at holde venstre museknap nede, og trække i molekylet. Ved at holde shift nede samtidig, kan der zoomes ud og ind. Sammenlign med Biokemibogen figur 87. Identificer zink-ionen, den hydrofobe grube og lukkearmen. 2. Programmet giver mulighed for at fremhæve egenskaber ved molekylet, og ændre i det. a. Vælg shortcuts. Giv proteinet farve efter hvor hydrofobe aminosyrerne er (Hydrophobicity). Sammenlign med Biokemibogens s. 76. Er der også en tendens til at hydrofobe aminosyrer vender indad og hydrofile vender udad på dette molekyle? Hvad betyder det for molekylet? Er den hydrofobe grube hydrofob? b. Farvelæg på baggrund af sekundærstruktur (Conformation Type). Hvor mange helix er og foldeblade, strands, kan du tælle? 3. Hvor sidder de tre aktive aminosyrer i det aktive område? a. Vælg Tools og Colors.

6 b. Vælg Ribbons. Dette giver mulighed for at ændre farverne på enkelte aminosyrer og større afsnit. c. Marker farvefeltet, og vælg en markant aktiv farve fra farveskemaet. d. Marker herefter de aktive aminosyrer, 145 arg, 248 tyr og 270 glu. Åben først A-kæden, Chain A ved at trykke på +. Herved bliver de enkelte aminosyrer synlige. Derefter markeres de udvalgte aminosyrer. 4. De pågældende aminosyrers radikaler kan tilsvarende gøres synlige. a. Vælg Tools og Visibility. b. Marker Atoms and Bonds. c. Åben A-kæden som før, og marker aminosyrerne. Hvordan sidder de tre aminosyrers radikaler i forhold til hinanden? hvad er biokemi? Find tilsvarende forstadiet til carboxypeptidase, Procarboxypeptidase, 1AYE. Sammenlign de to molekylers tredimensionelle struktur. 1. Hvad er der sket ved aktiveringen af molekylet? 2. Hvilken type enzym skal der bruges for at aktivere enzymet på den måde? Hvilken type binding skal det kunne spalte? Sammenlign med Biokemibogen side 89. Søg videre Andre af Biokemibogen s proteiner kan tilsvarende findes vha. deres PDB ID og undersøges nærmere. Suppler bogens informationer med oplysninger om molekylet fra andre kilder, fx ved en Google-søgning. Du kan finde molekylernes engelske stavemåde i bogens stikordsregister. Forklar hvordan molekylet virker for klassen. Gengiv molekylets vinkel, farver osv., på den måde der bedst viser de vigtige pointer. Brug ideerne ovenfor. Flere af molekylerne er symmetriske idet de består af flere ens underenheder. Ved flere af modellerne kan man skifte mellem hele komplekset og underenheden, den asymmetriske enhed. Nogle filer er store og kræver lidt tålmodighed.

7 Proteiner fra kapitel 3 DNA-polymerase I enzymkomplekset består af mange underenheder. Her ses den DNA-bindende del. Side i Biokemibogen PDB ID 45 1D8Y RNA-polymerase med en DNA-streng der deles. 54 1I6H RISC s binding til dsrna 69 1ytu Proteiner fra kapitel 4 Insulin 74 IB2F Hæmoglobin /Hemoglobin A3N Kymotrypsin /Chymotrypsin GCT Kymotrypsinogen /Chymotrypsinogen 89 1CHG Elastase (her med bundet kulhydrat). Sammenlign med de øvrige proteaser i Biokemibogen, særlig kymotrypsin og trypsin. Marker evt. den ladede asp 189 i gruben. Er denne grube hydrofob? Trypsin. Sammenlign med kymotrypsin og elastase. Marker evt. val 190 og val 216 som fylder op i den hydrofobe grube. Pepsin. Pepsin afsondres i maven og virker ikke i tolvfingertarmen hvor de øvrige proteaser tilsættes føden. Hvorfor kan vi ikke bruge det samme enzym begge steder? Læs evt. mere side eller i en fysiologibog BOF PTP 87 3PSG P-loop ATP-ase I6I og 1I5S Myosin (kan du finde P-loop ATP-asen?) 90, DFL Aktin-figuren viser en af monomererne, underenhederne i aktinfilamentet. Sammenlign med gengivelsen i bogen. 90, ATN Kinesin 94 1I6I K + -kanal K4C Na + /K + -pumpe SV4 ABC-transporter /ATP Binding Casette-protein. Modellen viser Casettedelen, hvor ATP bindes og spaltes. Sammenlign med P-loop ATP-asen s Antistof. Identificer de lette og tunge kæder, de konstante og de variable dele. Hvor er det præcist at antigenet bindes? Sammenlign med figuren i bogen. Proteiner fra kapitel F3O 102 1IGT Fotosystem I 115 1JBO Fotosystem II 114 1S5L Cytokromer er oxidoreduktaser, dvs. enzymer som kan optage og afgive elektroner, de reduceres og oxideres. De indeholder oftest hæm-gruppen som en prostetisk gruppe. Her følger henvisninger for cytokrom bf fra kloroplasternes og elektrontransportkædens enzymkompleks III og IV (cytokrom bc og cytokrom c-oxidase). Sammenlign deres funktioner vha. Biokemibogen side 115 og 128.

8 Cytokrom bf /cytochrome bf er et kompleks bestående bl.a. af tre cytokromer, af cytokrom b-typen og cytokrom f, som er et c-type kromosom. Her er cytokrom f. Bemærk hæm-gruppen, som optræder i alle cytokromerne. Cytokrom bc. Elektrontransportkædens enzymkompleks III, minder i opbygning om cytokrom bf, og består ligeledes af to asymmetriske enheder. Filen viser en asymmetrisk enhed. Farvelæg den efter polaritet (shortcuts og hydrophobicity). Molekylet er indlejret i mitokondriemembranen ved at midterafsnittet består af hydrofobe helixer som når gennem membranen. Passer det med farverne? Forklar princippet ud fra cellemembranens opbygning. Sammenlign med andre proteiner i cellemembranen, som optræder i Biokemibogen. Cytokrom c-oxidase, elektrontransportkædens enzymkompleks IV. Orienter dig i forhold til de parallelle helixer, som er indlejret i membranen. Elektroner overføres mellem kompleks III og IV af Cytokrom c, som kan bindes i gruben dannet af parallelle β-foldeblade. Cytokrom c. Molekylets struktur er stort set ens i alle organismer som respirerer CTM BCC 128 2OCC 128 3CYT Nitratreduktase 135 1R27 Proteiner fra kapitel 6 Nitrogenase består af to dele, reduktasen og nitrogenasen. Reduktasen. Find det kubiske Fe-S-kompleks. Her binder molekylet elektroner. Find også ATP-bindingsstederne. Disse bindingssteder er specialiserede P-loop ATP-aser. Når de spaltes ændrer reduktasen facon, FeS-komplekset bevæges ned til nitrogenasen og afleverer elektronerne. Processen er altså energikrævende. Nitrogenasen. Find cofaktoren i det aktive område, et kompleks som består af ni sulfider bundet til seks omkringliggende cystein-aminosyrer, syv jernatomer og et molybdænatom. Det er her N 2 modtager elektroner og reduceres. Leghæmoglobin. Identificer hæmgruppen, og sammenlign molekylet med myoglobin og hæmoglobin N2C 1M1N 154 1BIN Proteiner fra kapitel 7 Fosforylase a og b. Identificer de to asymmetriske enheder og ATP s bindingssteder. Sammenlign med bogens figur. Hvilke forskelle er der på de to former. Hvad er der sket med ATP? HGH /human growth hormone /somatotropin. Sammenlign med figur 209, side 185 i Biokemibogen GPA og 1NOJ 185 1HGU

Side 1 af 14. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 14. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side 1 af 14 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

Bioinformatik Open Source Software i biologiens tjeneste

Bioinformatik Open Source Software i biologiens tjeneste Bioinformatik Open Source Software i biologiens tjeneste Kenneth Geisshirt Silex Science ApS Bioinformatik p.1/19 Om Silex Science ApS Grundlagt maj 2002 Ejeren er Cortex Holding Fokusområderne

Læs mere

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Enzymkemi H. C. Ørsted Ungdomslaboratorium Kemisk Institut Københavns Universitet august 2001

Enzymkemi H. C. Ørsted Ungdomslaboratorium Kemisk Institut Københavns Universitet august 2001 Enzymkemi H.. Ørsted Ungdomslaboratorium Kemisk Institut Københavns Universitet august 2001 2 Indholdsfortegnelse Enzymkinetik Indledning...2 Teori:...2 Mekanismen...2 Reaktionshastigheden:...5 Fremgangsmåde:...7

Læs mere

Proteiner. Proteiner er molekyler der er opbygget af "aminosyrer",nogle er sammensat af få aminosyrer medens andre er opbygget af mange tusinde

Proteiner. Proteiner er molekyler der er opbygget af aminosyrer,nogle er sammensat af få aminosyrer medens andre er opbygget af mange tusinde Proteiner Proteiner er molekyler der er opbygget af "aminosyrer",nogle er sammensat af få aminosyrer medens andre er opbygget af mange tusinde Der findes ca. 20 aminosyrer i menneskets organisme. Nogle

Læs mere


BIOTEKNOLOGI HØJT NIVEAU STUDENTEREKSAMEN 2007 2007-BT-1 BITEKNLGI HØJT NIVEAU Torsdag den 31. maj 2007 kl. 9.00 14.00 Sættet består af 1 stor og 2 små opgaver samt 1 bilag i 2 eksemplarer. Det ene eksemplar af bilaget afleveres

Læs mere


BIOTEKNOLOGI HØJT NIVEAU STUDETEREKSAME 2006 2006-BT-2 BIOTEKOLOGI HØJT IVEAU Onsdag den 16. august 2006 kl. 9.00 14.00 Sættet består af 1 stor og 2 små opgaver. Alle hjælpemidler tilladt. STOR OPGAVE 1. Myoglobin A. Den røde

Læs mere

På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men

På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men skrevet hvorfra de er taget. De tre bøger, hvorfra illustrationerne

Læs mere

Proteiners byggesten er aminosyrer

Proteiners byggesten er aminosyrer PTEIE G EZYME Proteiners byggesten er aminosyrer Lad os se på den kemiske opbygning af et protein. Proteiner er store molekyler der er opbygget af mindre molekyler, som man kalder aminosyrer. Der findes

Læs mere

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer)

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer) Elevvejledning til det Virtuelle Kræftlaboratorium Det Virtuelle Kræftlaboratorium stiller krav til en grundig forståelse af det centrale dogme inden for molekylærbiologien, hvordan DNA oversættes til

Læs mere

Aminosyreanalyser i enkeltråvarer, der kan anvendes i fjerkræbiprodukt fra Farmfood A/S (F290)

Aminosyreanalyser i enkeltråvarer, der kan anvendes i fjerkræbiprodukt fra Farmfood A/S (F290) Aminosyreanalyser i enkeltråvarer, der kan anvendes i fjerkræbiprodukt fra Farmfood A/S (F290) Formålet med projektet var at beskrive aminosyreindholdet i de enkeltdele, der kan indgå i fjerkræbiprodukt

Læs mere

Protein syntese. return

Protein syntese. return Protein syntese. I artiklen redegøres for principperne i, hvordan octapeptidet SCHTFGDI kan syntetiseres. Som yderligere illustration heraf kan peptidet opbygges og visualiseres i Chem3D-Pro. Herved kan

Læs mere

27611 Eksamen Sommer 2008

27611 Eksamen Sommer 2008 27611 Eksamen Sommer 2008 Dette sæt indeholder 10 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan under selve eksamen ( juni 2008 klokken 15:00-19:00). DNA/Protein

Læs mere

Databasesøgning med BLAST

Databasesøgning med BLAST Databasesøgning med BLAST Denne vejledning giver en introduktion til databasesøgning med forskellige programmer i BLAST-familien. Vejledningen indeholder først en grundig introduktion og gennemgang af

Læs mere

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik Danmarks Tekniske Universitet Løsningsforslag til Øvelse i Immonologisk Bioinformatik Indledning De følgende sider giver en gennemgang af de øverlser i har lavet under jeres besøg på DTU, som en del af

Læs mere

Specifik mutation med nålestiksoperation

Specifik mutation med nålestiksoperation Specifik mutation med nålestiksoperation Mutanter af byg er vigtige i forskningen og benyttes også, når der forædles nye sorter til dyrkning. Hidtil har det kun været muligt at inducere mutationer tilfældige

Læs mere

Enzymer og katalysatorer

Enzymer og katalysatorer Enzymer og katalysatorer Reaktionsligningen: viser den kemiske reaktion, der leverer energi til alle stofskifteprocesser i cellerne i kroppen. Kemisk er der tale om en forbrændingsproces, hvori atmosfærisk

Læs mere

Bioteknologi A. Gymnasiale uddannelser. Vejledende opgavesæt 1. Mandag den 31. maj 2010 kl. 9.40-14.40. 5 timers skriftlig prøve

Bioteknologi A. Gymnasiale uddannelser. Vejledende opgavesæt 1. Mandag den 31. maj 2010 kl. 9.40-14.40. 5 timers skriftlig prøve Vejledende opgavesæt 1 Bioteknologi A Gymnasiale uddannelser 5 timers skriftlig prøve Vejledende opgavesæt 1 Mandag den 31. maj 2010 kl. 9.40-14.40 Side 1 af 8 sider pgave 1. Genmodificeret ris Vitamin

Læs mere

Opgave 1 Listeria. mørkviolette bakteriekolonier, se figur 1a. og b. 1. Angiv reaktionstypen for reaktion. 1 vist i figur 1b.

Opgave 1 Listeria. mørkviolette bakteriekolonier, se figur 1a. og b. 1. Angiv reaktionstypen for reaktion. 1 vist i figur 1b. Opgave 1 Listeria Bakterien Listeria monocytogenes kan være sygdomsfremkaldende for personer, der i forvejen er svækkede. For at identificere Listeria kan man anvende indikative agarplader. Her udnyttes

Læs mere

Immunologisk bioinformatik

Immunologisk bioinformatik Immunologisk bioinformatik Øvelsesvejledning Introduktion til øvelsen Når man i dagligdagen taler om influenza, bliver virussen ofte forbundet med forbigående og ufarlig sygdom. Som regel har mennesker

Læs mere

Vejledning i brugen af det digitale plantesøgningsprogram

Vejledning i brugen af det digitale plantesøgningsprogram Vejledning i brugen af det digitale plantesøgningsprogram Opsætning af pc Brugen af det digitale plantesøgningsprogram og kortet forudsætter at din computer tillader popups fra netadressen

Læs mere

Redoxprocessernes energiforhold

Redoxprocessernes energiforhold Bioteknologi 2, Tema 3 Opgave 8 Redoxprocessernes energiforhold Dette link uddyber energiforholdene i redoxprocesser. Stofskiftet handler jo netop om at der bindes energi i de organiske stoffer ved de

Læs mere

Proteiner. - til glæde og gavn

Proteiner. - til glæde og gavn Proteiner - til glæde og gavn Proteiner er essentielle for vores organisme fungerer som byggematerialer overalt i vores krop behovet afhænger af mange faktorer Proteiner er aminosyrer bygget sammen i lange

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Fra DNA til protein - lærerens tekst

Fra DNA til protein - lærerens tekst Fra DNA til protein - lærerens tekst Af sidsel sangild Denne øvelse handler om proteinsyntese og proteiners foldning. Den giver mulighed for at danne nogle andre billeder af fænomenet, end man får ved

Læs mere


SÅDAN BRUGER DU TEKST- BEHANDLING INTRODUKTION SÅDAN BRUGER DU TEKST- BEHANDLING INTRODUKTION I vejledningen bruger vi det gratis program Writer fra OpenOffice som eksempel til at vise, hvordan man bruger nogle helt grundlæggende funktioner i tekstbehandling.

Læs mere Forskelle version 6 til 7 01-12-2008 ID Navn c_id Komponent Før Nu 0001 Abrikos, tørret 0005 monoumætt. fedtsyrer 0.84 0. Forskelle version 6 til 7 01-12-2008 ID Navn c_id Komponent Før Nu 0001 Abrikos, tørret 0005 monoumætt. fedtsyrer 0.84 0. 0001 Abrikos, tørret 0005 monoumætt. fedtsyrer 0.84 0.610 0001 Abrikos, tørret 0006 polyumætt. fedtsyrer 0.38 0.610 0001 Abrikos, tørret 0007 kulhydrat, tilgængelig 57.2 66.5 0001 Abrikos, tørret 0013

Læs mere

Genetiske afstande og afstandsmatricer

Genetiske afstande og afstandsmatricer Genetiske afstande og afstandsmatricer Denne vejledning indeholder en række små øvelser og opgaver der illustrerer, hvordan man ud fra genetiske sekvenser kan udregne en gennemsnitlig evolutionær afstand

Læs mere

PCR (Polymerase Chain Reaction): Opkopiering af DNA

PCR (Polymerase Chain Reaction): Opkopiering af DNA PCR (Polymerase Chain Reaction): Opkopiering af DNA PCR til at opkopiere bestemte DNA-sekvenser i en prøve er nu en af genteknologiens absolut vigtigste værktøjer. Peter Rugbjerg, Biotech Academy PCR (Polymerase

Læs mere

Søgevejledning til Cinahl Plus with Full Text (Ebsco) Bibliotekerne i Professionshøjskolen Metropol. Søgevejledning til CINAHL Plus with Full Text

Søgevejledning til Cinahl Plus with Full Text (Ebsco) Bibliotekerne i Professionshøjskolen Metropol. Søgevejledning til CINAHL Plus with Full Text Søgevejledning til CINAHL Plus with Full Text Revideret af: Vibeke Witt, Professionshøjskolen Metropol, August 2013 1 Indholdsfortegnelse Databasens indhold... 3 Adgang til Cinahl... 3 Søgning i Cinahl

Læs mere

Sundheds CVU Nordjylland INTERN PRØVE ANATOMI, FYSIOLOGI OG BIOKEMI S06V D. 15. JUNI 2006 KL. 09.00 13.00

Sundheds CVU Nordjylland INTERN PRØVE ANATOMI, FYSIOLOGI OG BIOKEMI S06V D. 15. JUNI 2006 KL. 09.00 13.00 INTERN PRØVE ANATOMI, FYSIOLOGI OG BIOKEMI S06V D. 15. JUNI 2006 KL. 09.00 13.00 ANATOMI OG FYSIOLOGI Opgave 1 Den menneskelige organisme er opbygget af celler. a. Beskriv cellens opbygning, heri skal

Læs mere

Blodets kemi. Bioteknologi 4. Figurer. Tema 8

Blodets kemi. Bioteknologi 4. Figurer. Tema 8 Bioteknologi 4 Figurer Tema 8 Blodets kemi Bioteknologi 4 ISBN: 978-87-90363-50-5 Nucleus Forlag ApS Eksemplarfremstilling af papirkopier/prints fra denne hjemmeside til undervisningsbrug på uddannelsesinstitutioner

Læs mere

Test Canvas: Eksamen i BMB502 Januar 2012

Test Canvas: Eksamen i BMB502 Januar 2012 BMB502, Enzymer og membraner, efterår 11. f Tests, Surveys and Pools Tests Test Canvas : Eksamen i BMB502 Januar 2012 Edit Mode is: Test Canvas: Eksamen i BMB502 Januar 2012 Create Reuse Upload s Settings

Læs mere

Søgeeksempel i CINAHL:

Søgeeksempel i CINAHL: 1 Søgeeksempel i CINAHL: Denne vejledning gælder også for baserne PsycINFO; ERIC; GreenFILE; Teacher Reference Center; Regional Business News; Library, Information Sciene & Technology Abstracts; Business

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 16 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

FORCE Inspect Online Manual v. 1.02. FORCE Inspect Online Manual. 1 af 18

FORCE Inspect Online Manual v. 1.02. FORCE Inspect Online Manual. 1 af 18 FORCE Inspect Online Manual 1 af 18 Indholdsfortegnelse Indholdsfortegnelse... 2 FORCE Inspect Online Manual... 3 Generelt... 3 Login... 3 Main... 4 Intro sektion... 4 Links sektion... 4 News sektion...

Læs mere

PsycINFO (Ebsco) VIA manual

PsycINFO (Ebsco) VIA manual PsycINFO (Ebsco) VIA manual Udgiver American Psychological Association (APA). For nærmere beskrivelse af basen, se APA Databases Psycinfo: Indhold Basen dækker alle discipliner

Læs mere

Lav din egen forside i webtrees

Lav din egen forside i webtrees Lav din egen forside i webtrees Du behøver ikke at kunne kode eller gøre noget advanceret for at designe din helt egen forside i webtrees. Alt du skal gøre er bare at gøre brug af den indbygget editor.

Læs mere

Brugervejledning til databrowseren

Brugervejledning til databrowseren Brugervejledning til databrowseren Indholdsfortegnelse Indledning...2 Hvordan tilgås browseren og api et...2 Databrowseren...2 Søgning...2 Visning...4 Features i listevisningen...4 Detaljeret visning...5

Læs mere

PsycINFO (Ebsco) VIA manual

PsycINFO (Ebsco) VIA manual PsycINFO (Ebsco) VIA manual Udgiver American Psychological Association (APA). For en generel beskrivelse af basen, se APA Databases Psycinfo: Indhold Basen dækker alle discipliner

Læs mere

Vejledning til opbygning af hjemmesider

Vejledning til opbygning af hjemmesider Side 1 af 9 Vejledning til opbygning af hjemmesider Hvis du er inde på din klubs hjemmeside, fx på forsiden, kan du nu gå i gang med at redigere. For at få redigeringsværktøjet frem, skal du klikke på

Læs mere

Søgeeksempel i CINAHL:

Søgeeksempel i CINAHL: 1 Søgeeksempel i CINAHL: Denne vejledning gælder også for baserne PsycINFO; ERIC; GreenFILE; Teacher Reference Center; Regional Business News; Library, Information Sciene & Technology Abstracts; Business

Læs mere

Interaktiv ebog til biologi B

Interaktiv ebog til biologi B Interaktiv ebog til biologi B 2016 Indholdsfortegnelse til bogen Indholdsfortegnelse Kapitel 1: Kapitel 2: Kapitel 3: Kapitel 4: Kapitel 5: Liv, evolution og celler Lunger og blod Kost, fordøjelse og sundhed

Læs mere

FSFIs lynguide til DFRs elektronisk bevissystem

FSFIs lynguide til DFRs elektronisk bevissystem FSFIs lynguide til DFRs elektronisk bevissystem Dette er en kort guide i anvendelsen af Dansk Førstehjælpsråd elektroniske bevissystem. Guiden viser og forklarer hvordan du som instruktør og medlem af

Læs mere

Web of Science Vejledning

Web of Science Vejledning Web of Science Vejledning Der er adgang til Web of Science fra databaselisten på Fagbibliotekets hjemmeside, eller hvis du er udenfor hospitalets netværk via fjernadgang til DEFF (

Læs mere

Struktur og funktion af gener

Struktur og funktion af gener Molekylærbiologi og genetik S4, F2008 f Malene Munk Jørgensen Emne: Struktur og funktion af gener Link: undervisningsplanen for S4-molekylærbiologi og genetik MMJ, VI niversity ollege Bioanalytikeruddannelsen

Læs mere

Immunologisk Bioinformatik

Immunologisk Bioinformatik Immunologisk Bioinformatik Et undervisningsmateriale til de danske gymnasier Af Isa Kristina Kirk Materialet er lavet af Isa Kristina Kirk for Biotech Academy ved Danmarks Tekniske Universitet, DTU, i

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 af 1 Danmarks Tekniske Universitet Side 1 af 11 sider Skriftlig prøve, den 27/5-2010 Kursus navn: Kursus nr. 27611 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved

Læs mere

Terminsprøve. Mandag den 20. marts 2017 Kl

Terminsprøve. Mandag den 20. marts 2017 Kl Terminsprøve Mandag den 20. marts 2017 Kl. 9.00 14.00 Bioteknologi A Studentereksamen Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares. frs162-btk/a-12082016

Læs mere

MANUAL. Siteloom CMS

MANUAL. Siteloom CMS MANUAL Siteloom CMS Brugernavn: Password: 3. september, 2012 BASIS FUNKTIONER 1. Kalender... 4 1.a. Opret... 5 1.b. Rediger eller slet... 8 2. Sider... 10 2.a Opret side...

Læs mere

Manual til Kundekartotek

Manual til Kundekartotek 2016 Manual til Kundekartotek ShopPlanner Customers Med forklaring og eksempler på hvordan man håndterer kundeoplysninger 1 Introduktion... 3 1.1 Formål... 3 1.2 Anvendelse... 3 2 Referencer...

Læs mere

Zotero er et smart værktøj til at få styr på dine referencer og litteraturlister. Zotero er gratis og på dansk.

Zotero er et smart værktøj til at få styr på dine referencer og litteraturlister. Zotero er gratis og på dansk. 1 Indhold: Hvorfor Zotero?... 3 Installation... 3 Firefox... 3 Installation af Zotero... 3 Registrer dig som bruger af Zotero... 4 Zotero oversigt over programmet... 4 Tilføj referencer manuelt... 5 Eksempel

Læs mere

Opdateret: Vejledning i WebKort. Gennemgang af basale funktioner i Esbjerg kommunes WebKort

Opdateret: Vejledning i WebKort. Gennemgang af basale funktioner i Esbjerg kommunes WebKort Vejledning i WebKort Gennemgang af basale funktioner i Esbjerg kommunes WebKort 1 Indhold Zoom og panorér mm.... 3 Temavælger... 5 Gennemsigtighed (transparents)... 6 Menu-bjælken... 7 Søg... 7 Søg en

Læs mere

Kromosomer med genet: Genotype (= arveformel): RR Rr rr Fænotype (= fremtoning): Rød Rød Hvid

Kromosomer med genet: Genotype (= arveformel): RR Rr rr Fænotype (= fremtoning): Rød Rød Hvid Kromosomer med genet: R R R r r r Genotype (= arveformel): RR Rr rr Fænotype (= fremtoning): Rød Rød Hvid P-generation: Kønsceller: RR rr Meiose R R r r Befrugtning F 1-generation: Meiose Rr Rr Kønsceller:

Læs mere

Daglig brug af JitBesked 2.0

Daglig brug af JitBesked 2.0 Daglig brug af JitBesked 2.0 Indholdsfortegnelse Oprettelse af personer (modtagere)...3 Afsendelse af besked...4 Valg af flere modtagere...5 Valg af flere personer der ligger i rækkefølge...5 Valg af flere

Læs mere

Business Source Premier EBSCO

Business Source Premier EBSCO Få viden til at vælge VIA University College Dato: 8. juni 2015 Ref.: Robin Milner Business Source Premier EBSCO Indhold Om Business Source Premier Søgning Advanced Search Basic Search Thesaurus Søgehistorie

Læs mere

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Per Tøfting 23. september 2008 Speciale i softwarekonstruktion IT-Vest Aarhus Universitet Agenda Formål microrna Strategien

Læs mere

PubMed - tips til søgning

PubMed - tips til søgning EN VEJLEDNING FRA UCL BIBLIOTEKET PubMed - tips til søgning December 2017 Indholdsfortegnelse 1 Basens indhold... 1 2 Adgang til basen... 1 3 Søgemetoder... 2 3.1 Fritekstsøgning... 2 3.1.1 Muligheder

Læs mere

APPENDIKS 4. Uddybende figurer

APPENDIKS 4. Uddybende figurer Appendiks AENDIKS 4 Uddybende figurer å de følgende sider findes uddybende materialer. Af hensyn til biologi A er der foretaget en uddybning af delprocesserne i kulhydraternes intermediære stofskifte.

Læs mere

Er der flere farver i sort?

Er der flere farver i sort? Er der flere farver i sort? Hvad er kromatografi? Kromatografi benyttes inden for mange forskellige felter og forskningsområder og er en anvendelig og meget benyttet analytisk teknik. Kromatografi bruges

Læs mere

Zotero. En praktisk guide - sådan henter du referencer - sådan redigerer du referencer - sådan indsætter du referencer i Word

Zotero. En praktisk guide - sådan henter du referencer - sådan redigerer du referencer - sådan indsætter du referencer i Word EN VEJLEDNING FRA UCL BIBLIOTEKET Zotero En praktisk guide - sådan henter du referencer - sådan redigerer du referencer - sådan indsætter du referencer i Word Maj 2017 Indholdsfortegnelse Tilføj/Download

Læs mere

Indholdsfortegnelse Opret engelsk version af hjemmesiden... 2

Indholdsfortegnelse Opret engelsk version af hjemmesiden... 2 Indholdsfortegnelse Opret engelsk version af hjemmesiden... 2 Indledning:... 2 Metode 1 en samling af sider, med kun en engelsk version:... 3 Metode 2 Eksisterende sider med både en dansk og en engelsk

Læs mere

Dette er en vejledning til hvordan nye skarvkolonier oprettes og hvordan resultater fra optællinger af kolonier indtastes.

Dette er en vejledning til hvordan nye skarvkolonier oprettes og hvordan resultater fra optællinger af kolonier indtastes. Dette er en vejledning til hvordan nye skarvkolonier oprettes og hvordan resultater fra optællinger af kolonier indtastes. De tre trin Trin 1 Opret ny bruger Som optæller af skarvkolonier får du her mulighed

Læs mere

Cellekernen (Nucleus) Sebastian Frische Anatomisk Institut

Cellekernen (Nucleus) Sebastian Frische Anatomisk Institut Cellekernen (Nucleus) Sebastian Frische Anatomisk Institut Cellekernen Cellekernens overordnede struktur kernemembranen/nucleolemma kromatin nucleolus Cellecyklus faser i cellecyklus faser i mitosen Størrelse:

Læs mere

Den digitale Underviser. Videoredigering. Windows Live Movie Maker

Den digitale Underviser. Videoredigering. Windows Live Movie Maker Den digitale Underviser Videoredigering Windows Live Movie Maker Indhold Indhold... 1 Windows Movie Maker... 2 Om at oprette et projekt... 3 Optage og downloade video... 4 A. Optage din egen video:...

Læs mere

Kort brugervejledning - Global Issues in Context

Kort brugervejledning - Global Issues in Context Kort brugervejledning - Global Issues in Context Indholdsfortegnelse: 1. Global Issues in Context... 2 2. Dine søgemuligheder i Global Issues in Context.... 3 2.1 Basic Search... 3 2.2 Advanced Search...

Læs mere

Statistik på

Statistik på Statistik på Hvis vi gerne vil have statistik på vores profil på, vel at mærke en statistik der er lidt mere spændende end den der findes der i forvejen, kan vi genere en

Læs mere

Vejledning til Politikens Retskrivnings- og Betydningsordbog


Læs mere

Søgning i EBSCO. Ebsco baserne omfatter: CINAHL * PsycInfo * AMED. Business Source Premier * e-book Community College

Søgning i EBSCO. Ebsco baserne omfatter: CINAHL * PsycInfo * AMED. Business Source Premier * e-book Community College 1 Søgning i EBSCO Ebsco baserne omfatter: CINAHL * PsycInfo * AMED Business Source Premier * e-book Community College ebook Collection * Political Science Complete ebook Community College Collection ERIC

Læs mere

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013 Proteiner: en introduktion Modul 1; F13 Rolf Andersen, 18/2-2013 4 facts om proteiner Proteiner udgør én af de vigtigste stofgrupper i vores organisme; de varetager en lang række forskellige funktioner.

Læs mere

Modul 16, Word 5 Felter, tabeller og breve

Modul 16, Word 5 Felter, tabeller og breve 60+Bornholm Videregående pc-vejledning Modul 16, Word 5 Felter, tabeller og breve Felter Et felt er et område i dokumentteksten, hvor der automatisk indsættes en værdi. Eksempler: Aktuelle sidenummer eller

Læs mere Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Indholdsfortegnelse 1 Indledning... 3 1.1 Anbefalinger... 4 1.2 Datahjælp... 4 1.3 Brugerindstillinger... 5 2 Generel funktionalitet... 6 2.1

Læs mere



Læs mere

Online hjælpeguide FAQ V1.2

Online hjælpeguide FAQ V1.2 Online hjælpeguide FAQ V1.2 Spørgsmål: Hvordan kan jeg finde fly ved hjælp af kortet? Klik på en prik på kortet for at starte en søgning. Vælg derefter dit foretrukne valg fra menuen på skærmen for at

Læs mere

Vejledning Bilindretning

Vejledning Bilindretning Klik for at acceptere installation af TurnTool værktøj. Start med at lave en ny konfiguration ved at klikke på Start indretning. Du har mulighed for at vælge disse sprog og valuta

Læs mere

elib Aleph, ver.18 Introduktion til GUI FUJITSU SERVICES A/S

elib Aleph, ver.18 Introduktion til GUI FUJITSU SERVICES A/S Introduktion til GUI FUJITSU SERVICES A/S, 2008 Indholdsfortegnelse 1. Skrivebordet... 3 2. Flytte rundt m.m.... 4 3. Log ind... 6 4. Valg af database... 7 5. Rudernes størrelse... 8 6. Kolonner... 9 7.

Læs mere

Mini-vejledning til. PubMed

Mini-vejledning til. PubMed Mini-vejledning til PubMed Udarbejdet af bibliotekar Helen Grundtvig Kristensen. Revideret Januar 2010 1 Indholdsfortegnelse Pubmed: introduktionsside side 3 Enkel søgning side 4 Advanced Search side 4

Læs mere

Advanced Word Template Brugermanual

Advanced Word Template Brugermanual Advanced Word Template Brugermanual Forord: Advanced Word Template er et værktøj, der anvendes sammen med Microsoft Word til at opbygge ensartet beskrivelser på en mere intelligent måde end Copy and Paste

Læs mere

Søgevejledning til SocINDEX with Full Text - 1

Søgevejledning til SocINDEX with Full Text - 1 Søgevejledning til SocINDEX with Full Text Søgevejledning til SocINDEX with Full Text Indholdsfortegnelse Søgning i SocINDEX Advanced Search Felter der afgrænser søgningen Søgehistorie Kombinatorisk søgning

Læs mere

Eksamensnummer. Multiple choice opgaver. Side 1 af 10. Hvert svar vægtes 1 point 1.1 A 1.2 E 1.3 C 1.4 B 2.1 F 2.2 C 2.3 D 3 D 4 E

Eksamensnummer. Multiple choice opgaver. Side 1 af 10. Hvert svar vægtes 1 point 1.1 A 1.2 E 1.3 C 1.4 B 2.1 F 2.2 C 2.3 D 3 D 4 E Multiple choice opgaver. Hvert svar vægtes 1 point Opgave Svar 1.1 A 1.2 E 1.3 C 1.4 B 2.1 F 2.2 C 2.3 D 3 D 4 E 5 C 6 B 7 B 8 C 9 B 10 E 11.1 A 11.2 A 11.3 I 12 E 13 E 14 A 15 A 16.1 K 16.2 A 16.3 M Side

Læs mere

Herunder er vist en afstandsmatrice for fem pattedyr: Ulv (U), moskusokse (M), kænguru (K), isbjørn (I) og vildsvin (V).

Herunder er vist en afstandsmatrice for fem pattedyr: Ulv (U), moskusokse (M), kænguru (K), isbjørn (I) og vildsvin (V). Fylogenetiske træer Dette dokument indeholder først et eksempel på hvordan man kan bruge UPGMA-metoden til at danne fylogenetiske træer ud fra en afstandsmatrice, og derefter en række øvelser der illustrerer

Læs mere

Solid Edge 2D Drafting

Solid Edge 2D Drafting Solid Edge 2D version 106 - tutorial: Solid edge 2d er et gratis tegneprogram, der er genialt til Teknologi. Det kan bruges til at tegne maskintegninger med mål, til at tegne skitser til fysik-afleveringer,

Læs mere

Du skal have en Google konto for at kunne anvende Webalbum! Har du ikke det, så får du her en kort orientering om, hvorledes du kan få en konto.

Du skal have en Google konto for at kunne anvende Webalbum! Har du ikke det, så får du her en kort orientering om, hvorledes du kan få en konto. Indhold Webalbum...2 Google-konto...2 Brug af webalbum...5 Overføre billeder til album...5 Se og bruge sine billeder i webalbummet...6 E-mail...9 Udskriv...12 Bestil udskrifter...13 Blog This...13 Collage...14

Læs mere

Vejledning i visning af udvalgte adresser på Google

Vejledning i visning af udvalgte adresser på Google Vejledning i visning af udvalgte adresser på Google Udarbejdet af Lars P. Beck Side 2 af 19 Indledning Det er den almindelige opfattelse at når vi taler om kort på Internettet, så taler vi om Google Maps.

Læs mere

tdp 12-7Z (12) PATENTSKRIFT

tdp 12-7Z (12) PATENTSKRIFT (19) DANMARK DK 173629 B1 tdp 12-7Z (12) PATENTSKRIFT Patent- og Varemærkestyrelsen (51) Int.C1 7.: C 07 K 141315 A 61 K 39/09 C 12 N 15/31 (21) Patentansøgning nr: PA 1991 01155 (22) Indleveringsdag:

Læs mere

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Isa Kirk Biotech Academy Institut for Systembiologi, Danmarks Tekniske Universitet 2. november 2010 1 Indhold 1 Introduktion

Læs mere

Table of Contents. Prøveværktøj

Table of Contents. Prøveværktøj PRØVEVÆRKTØJ Table of Contents Opret prøve og tilpas dit fronter-rum... 3 Opret prøve... 4 Tilføj prøveværktøj... 6 Fanen "Indstillinger"... 11 Indstillinger for vindue... 15 Mappe til billeder/multimedier...

Læs mere

Vejledning til CINAHL Plus with Full Text

Vejledning til CINAHL Plus with Full Text Vejledning til CINAHL Plus with Full Text Vibeke Witt, Professionshøjskolen Metropol, 2013 Revideret af: Ester Hørmann, Professionshøjskolen Metropol, september 2015 Indholdsfortegnelse Databasens indhold...

Læs mere

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på Rigspolitiets websektion

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på Rigspolitiets websektion RIGSPOLITIET Vejledning i konvertering fra Word -dokument til PDF-fil på Rigspolitiets websektion Indledning Da vi skal leve op til kravene om tilgængelighed på Internettet, skal alle tekster

Læs mere

Vejledning til referencehåndteringssystemet. Forsvarets Bibliotekscenter Anita Elleby

Vejledning til referencehåndteringssystemet. Forsvarets Bibliotekscenter Anita Elleby Vejledning til referencehåndteringssystemet Forsvarets Bibliotekscenter Anita Elleby Jeg håber, at du vil få glæde af denne vejledning til referencehåndteringssystemet Zotero. Hvis du får problemer undervejs

Læs mere

Easy Guide i GallupPC

Easy Guide i GallupPC Easy Guide i GallupPC Version. 6.00.00 Gallup A/S Masnedøgade 22-26 DK 2100 København Ø Telefon 39 27 27 27 Fax 39 27 50 80 Indhold SÅDAN KOMMER DU I GANG MED AT ANVENDE GALLUPPC... 2 TILFØJELSE AF UNDERSØGELSER

Læs mere

Tlf. +45 7027 1699 Fax + 45 7027 1899

Tlf. +45 7027 1699 Fax + 45 7027 1899 Firmaordninger I firmaoversigten kan du holde styr på dit kundekartotek samt disses bookinger. Der kan desuden oprettes andre firmaer end dit eget. Herved kan der udbydes særlige ydelser på med egne arbejdstider.

Læs mere