Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle

Størrelse: px
Starte visningen fra side:

Download "Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle"

Transkript

1 BIOINFORMATIK Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle indhold DNA 2 Hvilke databaser skal man vælge? 2 Søgning på en nukleotidsekvens 2 Proteiner 4 Søgning på aminosyresekvenser 4 Søgning på proteiners 3-D-struktur 5 Søgning på baggrund af aminosyresekvens 5 Søgning på baggrund af navn, art el. lign. 5 Søgning på baggrund af PDB ID 5 Undersøgelse af proteinets tredimensionelle struktur 5 Søg videre 6 Proteiner fra kapitel 3 7 Proteiner fra kapitel 4 7 Proteiner fra kapitel 5 7 Proteiner fra kapitel 6 8 Proteiner fra kapitel 7 8 BIOINFORMATIK Supplerende materiale til Biokemibogen liv, funktion, molekyle Kresten Cæsar Torp og Nucleus Forlag ApS Eksemplarfremstilling af papirkopier/prints fra denne hjemmeside til undervisningsbrug på uddannelsesinstitutioner og intern administrativ brug er tilladt med en aftale med Copydan Tekst & Node. Eksemplarfremstillingen skal ske inden for aftalens begrænsninger.

2 DNA DNA s struktur og metoderne til sekventering af DNA er beskrevet i Biokemibogen side På side 51 opsummeres nogle af de vigtigste problemer man kan behandle vha. www-baserede databaser: Søge efter bestemte sekvenser eller gener. Sammenligne sekvenser af ønskede gener (alignment). Søge efter homologe sekvenser, dvs. sekvenser der går igen i gener fra forskellige arter. Søge efter hvor et bestemt gen kan klippes med bestemte enzymer. Søge på oversættelser af generne til protein. Her er en praktisk vejledning til hvordan man kan prøve nogle af disse funktioner af. Hvilke databaser skal man vælge? DNA-sekvenser ligger på tre primære databaser, EMBL (Europa), GenBank (USA) og DDJB (Japan), som opdateres dagligt. Her ud over findes der et antal særlige databaser som letter specielle former for søgning. Non-redundant (nr)-databaser er omfattende databaser som har den fordel at man kan undgå flere udgaver af samme resultat. De mindre databaser, fx expressed sequence tags (EST) har flere referencer og kommentarer til søgeresultatet. Fra databaserne er der adgang til forskellige søgeprogrammer og hjælpeværktøjer. Her starter vi på GenBank, Det kan være en god ide først at orientere sig på siden. Under fanerne for oven på siden er der adgang til forskellige databaser og søgeprogrammer der går på tværs af disse. Der er også adgang til artikelsamlinger som dog kræver registrering. Se fx på kromosomkortene som du finder under Entrez, Human Genome og Browse Genome. Tryk på kromosomerne og se om du kan finde gener du kender fra Biokemibogen. Søgning på en nukleotidsekvens Vi har en nukleotidsekvens: TTAATAATGTATTCCAGAGTGAAGCAGATATGTAGAGAAGATGGGCACACATATGTTGAAGTGAATGACTTAACTTTGAC ATTGTCAAATCATTTGTCATTTCATGCTGCTTCAGAGTCTCTGAAGTTTTTGAAGGATATTGGTGTGGTGACATATGAGA AGTCCTGTGTCTTCCCTTATGACCTTTACCATGCTGAAAGAGCCATGGCCTTTTCAATTTGTGACCTGATGAAGAAACCT CCTTGGCATTTATGTGTCGATGTCGTAAAGGTGCTTGCCTCTATTCACACCACAAAACCTGAGAATTCAAGCGATGATGC ATTGAATGAGAGCAAACCTGATGAATTAAGATTAGAAAATCCTGTGGATGTTGTGGACACACAGGACAATGGTGACCATA TTTGGACTAATGGTGAAAAT Hvor i det menneskelige genom hører den hjemme? For at finde ud af det laver vi en homologisøgning med søgeprogrammet BLAST (Basic Local Alignment Search Tool). Homologi, enslydende, refererer egentlig til en antagelse om at to gener er evolutionært beslægtede fordi de stammer fra beslægtede organismer. Her anvendes det dog om i hvor høj grad nukleotiderne i to sekvenser stemmer overens, slægtskab eller ej. 1. Vælg BLAST i menuen. Herfra vil der være forskellige muligheder for søgning. Man kan vælge hvilken art man ønsker at søge på, om man vil søge på nukleotidsekvenser, proteiner eller oversættelser mellem nukleotider og aminosyrer. Søg i det menneskelige genom ved at vælge human. 2. Sæt sekvensen ind i søgefeltet (Enter an accession). Kopier ovenstående sekvens og sæt den ind.

3 3. Herefter er der flere muligheder: a. Set subsequence: Her kan man udvælge dele af sekvensen for søgningen. b. Database: Her kan man vælge mellem forskellige databaser. I dette tilfælde vælges genome (all assemblies) hvorved søgningen sker i forskelllige sekventerede genomer. c. Program: Her vælger man om man vil sammenligne med andre nukleotidsekvenser, med proteinsekvenser som kan være resultat af oversættelse af nukleotidsekvensen eller med andre arters genom. Vælg megablast. d. Expect: Dette tal angiver sandsynligheden for at den fundne sekvens stemmer overens med den indtastede ved et tilfælde. 0,01 angiver således at det vil kunne forventes i 1 ud af 100 gange. Ofte sættes værdien til 10 i første søgning. Resultater med en højere sandsynlighed end den angivne vises ikke. e. Filter: Her kan man aktivere et filter som frasorterer visse sekvenser som går igen mange steder på genomet. f. Descriptions og alignments: Her vælger man antallet af korte beskrivelser og sekvenser man ønsker at se. De sorteres efter hvilke der passer bedst med den indtastede, så selvom der vises mange, vil de først viste være dem der passer bedst 4. Begin search bringer næste side frem hvor man kan foretage yderligere valg for at begrænse søgningen. Her kan man bl.a. med flueben i graphical overview få en farveindikation for hvor sekvensen passer bedst med de fundne (alignment score). 5. Tryk på view report og se resultatet. a. Øverst vises i hvilken database matchene er fundet. Ved søgning i genomer kan man med Genome View se placeringen af sekvensen i genomet. På hvilket kromosom befinder sekvensen sig? Vælger du Genome view kan du blive nødt til at søge igen fordi siden forældes. b. Herefter følger en grafisk gengivelse af hvor godt de fundne sekvenser matcher. Hvad viser farven? Passer de fundne sekvenser godt med den indtastede? c. Referencen nedenunder virker som et direkte link til den database hvor sekvensen er fundet. Under referencen er evt. beskrevet features, dvs. egenskaber, for denne del af genomet. Hvilket gen stammer denne sekvens fra? Slå navnet efter i Biokemibogen, og find ud af hvilken funktion det har i cellen. d. Herefter følger en direkte sammenligning af baserne mellem Query, den indtastede forespørgsel, og Sbjct, den tilbageleverede sekvens. Er der fuld overensstemmelse? Er der baser som ikke stemmer overens? (De angives ved at der ikke er streger imellem dem). 6. Prøv nu at gå tilbage og lav en ny søgning på en mindre del af sekvensen. Gå tilbage og vælg fx set subsequence til a. Hvor høj er alignmentscoren nu? Hvorfor kan man ikke have så stor tillid til resultatet når sekvensen bliver kortere? 7. For meget korte sekvenser skal man bruge andre søgeprogrammer. Prøv fx at sammenligne en sekvens på 30 nukleotider. 8. Lav mutationer i sekvensen. Byt baser ud, søg og se hvad der sker. Prøv også at indsætte eller fjerne baser. Hvordan gengives disse huller eller gaps? Hvad kalder man disse typer af mutationer? Se Biokemibogen side 61. Har andre arter gener for helikase der minder om vores? Gå tilbage til BLAST-startsiden, hvor du kan vælge at søge i andre arters genom. Ud over menneske, mus og rotte, anvendes arternes latinske navne. Vælg evt. søgeprogrammet blastn i stedet for megablast, idet det tager flere sekvenser med og reguler evt. på expect. Hvor finders tilsvarende sekvenser?

4 Proteiner Søgning på aminosyresekvenser Søgning på aminosyresekvenser kan også foretages vha. BLAST. I databaser som disse gengives aminosyrernes navne normalt med ét-bogstav-forkortelser, i stedet for de tre som er brugt i Biokemibogen, side 72: Aminosyre Forkortelser Alanin Ala A Arginin Arg R Asparagin Asn N Aspartat Asp D Cystein Cys C Glutamat Glu E Glutamin Gln Q Glycin Gly G Histidin His H Isoleucin Ile I Leucin Leu L Lysin Lys K Methionin Met M Phenylalanin Phe F Prolin Pro P Serin Ser S Threonin Thr T Tryptofan Trp W Tyrosin Tyr Y Valin Val V Hvor stammer følgende aminosyresekvens fra? TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTV Har du allerede prøvet at søge på nukleotidsekvenser, kan du også her bruge Genbank på adressen www. ncbi.nlm.nih.gov. 1. Vælg BLAST i menuen. Vælg derefter protein blast under Basic BLAST 2. Aminosyresekvensen kopieres til søgefeltet. 3. I databasen kan man vælge mellem flere muligheder. Både pdb (Protein Data Bank) og Swissprot er databaser hvor proteinerne er godt annoterede, og det er let at arbejde videre med deres tredimensionelle strukturer. Vælg non-redundant protein sequences (nr). 4. Tryk BLAST og vurder resultatet. a. Først vises referencer til søgningen, og hvor mange sekvenser der er fundet. b. Dernæst vises med en farvekode hvor sandsynligt det er at de fundne sekvenser matcher den indtastede (Query). Sammenlign farverne med farveskalaen (alignment scores). Hvor godt stemmer de overens? c. Herefter følger referencer til databaser og artikler for de fundne sekvenser. Øverst vises de sekvenser der matcher bedst. Se de øverste titler igennem. Giver de et hint om hvilket protein der er tale om? Find proteinet i Biokemibogen. Hvad er det for et protein? d. Se listen over søgeresultater igennem. Hvilke arter kan du finde referencer til? Hvad fortæller det om proteinet at sekvenserne er forholdsvis ens? Sammenlign evt. afstanden mellem sekvenserne vha. distance tree of results. e. Søgningen finder også et andet protein, som du kan finde i Biokemibogen (se fx side 80-81). Er det overraskende at begge proteiner matcher sekvensen? Det kan alternativt være en god ide at søge i en database med mere fyldestgørende beskrivelser af proteinerne. Gå fx tilbage, indsæt sekvensen og vælg i stedet Protein Data Bank, pdb. Hvordan ser søgeresultaterne nu ud? Koden til venstre (fx pdb 1GCT A) er molekylets PDB ID. 1GCT kan således bruges til at søge videre på proteinets struktur, bl.a. på den følgende database.

5 Søgning på proteiners 3-D-struktur Nogle databaser indeholder lettilgængelig information om proteiners tredimensionelle struktur, både strukturer bestemt eksperimentelt og teoretisk beregnede modeller, se Biokemibogen side 78. Her bruger vi Orienter dig på hjemmesiden. Under General education og Educational resources er der fx gode animationer, posters, flash tutorials (vejledninger til databasen), vejledninger til at bygge fysiske modeller af proteinerne o.l. Udskriv fx posteren Molecular Machinery: A Tour of the Protein Data Bank og hæng den op i klasselokalet. Hvem kan forsyne flest af molekylerne med sidehenvisninger til bogen? Søgning på baggrund af aminosyresekvens I det følgende ser vi nærmere på et af bogens molekyler. 1. Vælg search. 2. Starter man med en aminosyresekvens, vælges sequence, og sekvensen kopiers til søgefeltet. Marker feltet use sequence. 3. Tryk search og vurder resultatet. Antallet af søgeresultater kan indsnævres ved at justere Expect-værdien (Her hedder den: E cut off) ned til fx Til venstre for hvert søgeresultat er en lille molekyltegning. Aktiveres linket kommer molekyltegningen frem i højre side. Under tegningen er der links til forskellige hjælpeprogrammer som kan bruges til at undersøge og arbejde videre med strukturen. Søgning på baggrund af navn, art el. lign. Da mange af molekylerne i databasen er modificerede i forbindelse med de forsøg de stammer fra, kan dette være vanskeligt. 1. Vælg search i venstre side Dette giver forskellige muligheder for søgninger. 2. Vælg advanced search. 3. Under Choose a query type vælges fx molecule name. 4. Skriv molekylets engelske navn i søgefeltet og tryk på evaluate subquery. Du kan nu se hvor mange resultater du får. 5. Vælg evt. at indsnævre søgningen ved at trykke på Vælg fx hvilken organisme, Source Organism du søger indenfor. 7. Tryk evaluate query. Du får nu de fundne molekyler. Søgning på baggrund af PDB ID De molekyler som indrapporteres til databasen forsynes med et PDB ID. Med PDB ID kan man søge på molekylet, dels i søgebjælken for oven på hjemmesiden, dels via de øvrige søgemuligheder. PDB ID for de vigtigste af Biokemibogens proteiner er gengivet i tabellen under Søg videre nedenfor. 1. Skriv fx PDB ID for Carboxypeptidase, 1M4L i søgefeltet. Tryk Site Search. 2. Hvilke oplysninger får man om proteinet? Undersøgelse af proteinets tredimensionelle struktur Under tegningen til højre er der links til forskellige hjælpeprogrammer som kan bruges til at undersøge og arbejde videre med strukturen. Vælg fx MBT ProteinWorkshop. Flere af programmerne kræver at java er installeret på computeren. Det kan downloades gratis her. 1. Drej molekylet med musen ved at holde venstre museknap nede, og trække i molekylet. Ved at holde shift nede samtidig, kan der zoomes ud og ind. Sammenlign med Biokemibogen figur 87. Identificer zink-ionen, den hydrofobe grube og lukkearmen. 2. Programmet giver mulighed for at fremhæve egenskaber ved molekylet, og ændre i det. a. Vælg shortcuts. Giv proteinet farve efter hvor hydrofobe aminosyrerne er (Hydrophobicity). Sammenlign med Biokemibogens s. 76. Er der også en tendens til at hydrofobe aminosyrer vender indad og hydrofile vender udad på dette molekyle? Hvad betyder det for molekylet? Er den hydrofobe grube hydrofob? b. Farvelæg på baggrund af sekundærstruktur (Conformation Type). Hvor mange helix er og foldeblade, strands, kan du tælle? 3. Hvor sidder de tre aktive aminosyrer i det aktive område? a. Vælg Tools og Colors.

6 b. Vælg Ribbons. Dette giver mulighed for at ændre farverne på enkelte aminosyrer og større afsnit. c. Marker farvefeltet, og vælg en markant aktiv farve fra farveskemaet. d. Marker herefter de aktive aminosyrer, 145 arg, 248 tyr og 270 glu. Åben først A-kæden, Chain A ved at trykke på +. Herved bliver de enkelte aminosyrer synlige. Derefter markeres de udvalgte aminosyrer. 4. De pågældende aminosyrers radikaler kan tilsvarende gøres synlige. a. Vælg Tools og Visibility. b. Marker Atoms and Bonds. c. Åben A-kæden som før, og marker aminosyrerne. Hvordan sidder de tre aminosyrers radikaler i forhold til hinanden? hvad er biokemi? Find tilsvarende forstadiet til carboxypeptidase, Procarboxypeptidase, 1AYE. Sammenlign de to molekylers tredimensionelle struktur. 1. Hvad er der sket ved aktiveringen af molekylet? 2. Hvilken type enzym skal der bruges for at aktivere enzymet på den måde? Hvilken type binding skal det kunne spalte? Sammenlign med Biokemibogen side 89. Søg videre Andre af Biokemibogen s proteiner kan tilsvarende findes vha. deres PDB ID og undersøges nærmere. Suppler bogens informationer med oplysninger om molekylet fra andre kilder, fx ved en Google-søgning. Du kan finde molekylernes engelske stavemåde i bogens stikordsregister. Forklar hvordan molekylet virker for klassen. Gengiv molekylets vinkel, farver osv., på den måde der bedst viser de vigtige pointer. Brug ideerne ovenfor. Flere af molekylerne er symmetriske idet de består af flere ens underenheder. Ved flere af modellerne kan man skifte mellem hele komplekset og underenheden, den asymmetriske enhed. Nogle filer er store og kræver lidt tålmodighed.

7 Proteiner fra kapitel 3 DNA-polymerase I enzymkomplekset består af mange underenheder. Her ses den DNA-bindende del. Side i Biokemibogen PDB ID 45 1D8Y RNA-polymerase med en DNA-streng der deles. 54 1I6H RISC s binding til dsrna 69 1ytu Proteiner fra kapitel 4 Insulin 74 IB2F Hæmoglobin /Hemoglobin A3N Kymotrypsin /Chymotrypsin GCT Kymotrypsinogen /Chymotrypsinogen 89 1CHG Elastase (her med bundet kulhydrat). Sammenlign med de øvrige proteaser i Biokemibogen, særlig kymotrypsin og trypsin. Marker evt. den ladede asp 189 i gruben. Er denne grube hydrofob? Trypsin. Sammenlign med kymotrypsin og elastase. Marker evt. val 190 og val 216 som fylder op i den hydrofobe grube. Pepsin. Pepsin afsondres i maven og virker ikke i tolvfingertarmen hvor de øvrige proteaser tilsættes føden. Hvorfor kan vi ikke bruge det samme enzym begge steder? Læs evt. mere side eller i en fysiologibog BOF PTP 87 3PSG P-loop ATP-ase I6I og 1I5S Myosin (kan du finde P-loop ATP-asen?) 90, DFL Aktin-figuren viser en af monomererne, underenhederne i aktinfilamentet. Sammenlign med gengivelsen i bogen. 90, ATN Kinesin 94 1I6I K + -kanal K4C Na + /K + -pumpe SV4 ABC-transporter /ATP Binding Casette-protein. Modellen viser Casettedelen, hvor ATP bindes og spaltes. Sammenlign med P-loop ATP-asen s Antistof. Identificer de lette og tunge kæder, de konstante og de variable dele. Hvor er det præcist at antigenet bindes? Sammenlign med figuren i bogen. Proteiner fra kapitel F3O 102 1IGT Fotosystem I 115 1JBO Fotosystem II 114 1S5L Cytokromer er oxidoreduktaser, dvs. enzymer som kan optage og afgive elektroner, de reduceres og oxideres. De indeholder oftest hæm-gruppen som en prostetisk gruppe. Her følger henvisninger for cytokrom bf fra kloroplasternes og elektrontransportkædens enzymkompleks III og IV (cytokrom bc og cytokrom c-oxidase). Sammenlign deres funktioner vha. Biokemibogen side 115 og 128.

8 Cytokrom bf /cytochrome bf er et kompleks bestående bl.a. af tre cytokromer, af cytokrom b-typen og cytokrom f, som er et c-type kromosom. Her er cytokrom f. Bemærk hæm-gruppen, som optræder i alle cytokromerne. Cytokrom bc. Elektrontransportkædens enzymkompleks III, minder i opbygning om cytokrom bf, og består ligeledes af to asymmetriske enheder. Filen viser en asymmetrisk enhed. Farvelæg den efter polaritet (shortcuts og hydrophobicity). Molekylet er indlejret i mitokondriemembranen ved at midterafsnittet består af hydrofobe helixer som når gennem membranen. Passer det med farverne? Forklar princippet ud fra cellemembranens opbygning. Sammenlign med andre proteiner i cellemembranen, som optræder i Biokemibogen. Cytokrom c-oxidase, elektrontransportkædens enzymkompleks IV. Orienter dig i forhold til de parallelle helixer, som er indlejret i membranen. Elektroner overføres mellem kompleks III og IV af Cytokrom c, som kan bindes i gruben dannet af parallelle β-foldeblade. Cytokrom c. Molekylets struktur er stort set ens i alle organismer som respirerer CTM BCC 128 2OCC 128 3CYT Nitratreduktase 135 1R27 Proteiner fra kapitel 6 Nitrogenase består af to dele, reduktasen og nitrogenasen. Reduktasen. Find det kubiske Fe-S-kompleks. Her binder molekylet elektroner. Find også ATP-bindingsstederne. Disse bindingssteder er specialiserede P-loop ATP-aser. Når de spaltes ændrer reduktasen facon, FeS-komplekset bevæges ned til nitrogenasen og afleverer elektronerne. Processen er altså energikrævende. Nitrogenasen. Find cofaktoren i det aktive område, et kompleks som består af ni sulfider bundet til seks omkringliggende cystein-aminosyrer, syv jernatomer og et molybdænatom. Det er her N 2 modtager elektroner og reduceres. Leghæmoglobin. Identificer hæmgruppen, og sammenlign molekylet med myoglobin og hæmoglobin N2C 1M1N 154 1BIN Proteiner fra kapitel 7 Fosforylase a og b. Identificer de to asymmetriske enheder og ATP s bindingssteder. Sammenlign med bogens figur. Hvilke forskelle er der på de to former. Hvad er der sket med ATP? HGH /human growth hormone /somatotropin. Sammenlign med figur 209, side 185 i Biokemibogen GPA og 1NOJ 185 1HGU

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

Databasesøgning med BLAST

Databasesøgning med BLAST Databasesøgning med BLAST Denne vejledning giver en introduktion til databasesøgning med forskellige programmer i BLAST-familien. Vejledningen indeholder først en grundig introduktion og gennemgang af

Læs mere

Immunologisk bioinformatik

Immunologisk bioinformatik Immunologisk bioinformatik Øvelsesvejledning Introduktion til øvelsen Når man i dagligdagen taler om influenza, bliver virussen ofte forbundet med forbigående og ufarlig sygdom. Som regel har mennesker

Læs mere

Fra DNA til protein - lærerens tekst

Fra DNA til protein - lærerens tekst Fra DNA til protein - lærerens tekst Af sidsel sangild Denne øvelse handler om proteinsyntese og proteiners foldning. Den giver mulighed for at danne nogle andre billeder af fænomenet, end man får ved

Læs mere

SÅDAN BRUGER DU TEKST- BEHANDLING INTRODUKTION

SÅDAN BRUGER DU TEKST- BEHANDLING INTRODUKTION SÅDAN BRUGER DU TEKST- BEHANDLING INTRODUKTION I vejledningen bruger vi det gratis program Writer fra OpenOffice som eksempel til at vise, hvordan man bruger nogle helt grundlæggende funktioner i tekstbehandling.

Læs mere

Redoxprocessernes energiforhold

Redoxprocessernes energiforhold Bioteknologi 2, Tema 3 Opgave 8 Redoxprocessernes energiforhold Dette link uddyber energiforholdene i redoxprocesser. Stofskiftet handler jo netop om at der bindes energi i de organiske stoffer ved de

Læs mere

Struktur og funktion af gener

Struktur og funktion af gener Molekylærbiologi og genetik S4, F2008 f Malene Munk Jørgensen Emne: Struktur og funktion af gener Link: undervisningsplanen for S4-molekylærbiologi og genetik MMJ, VI niversity ollege Bioanalytikeruddannelsen

Læs mere

Vejledning Bilindretning

Vejledning Bilindretning http://vanconfig.raaco.com Klik for at acceptere installation af TurnTool værktøj. Start med at lave en ny konfiguration ved at klikke på Start indretning. Du har mulighed for at vælge disse sprog og valuta

Læs mere

BIOS. Celledeling hos en bananflue KOPIARK 135 GENETIK

BIOS. Celledeling hos en bananflue KOPIARK 135 GENETIK KOPIARK 135 GENETIK Celledeling hos en bananflue Her er en celle fra en bananflue. Tegn det rigtige antal kromosomer i cellekernen. Se Grundbog B, s. 106. Hvor mange kromosomer har en bananflue i hver

Læs mere

Web of Science Vejledning

Web of Science Vejledning Web of Science Vejledning Der er adgang til Web of Science fra databaselisten på Fagbibliotekets hjemmeside, eller hvis du er udenfor hospitalets netværk via fjernadgang til DEFF (www.tidsskrifter.deff.dk)

Læs mere

FSFIs lynguide til DFRs elektronisk bevissystem

FSFIs lynguide til DFRs elektronisk bevissystem FSFIs lynguide til DFRs elektronisk bevissystem Dette er en kort guide i anvendelsen af Dansk Førstehjælpsråd elektroniske bevissystem. Guiden viser og forklarer hvordan du som instruktør og medlem af

Læs mere

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på politi.dk. Rigspolitiets websektion

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på politi.dk. Rigspolitiets websektion RIGSPOLITIET Vejledning i konvertering fra Word -dokument til PDF-fil på politi.dk Rigspolitiets websektion Indledning Da vi skal leve op til kravene om tilgængelighed på Internettet, skal alle tekster

Læs mere

7DVWHYHMOHGQLQJ#²#,QWHUQHW#([SORUHU

7DVWHYHMOHGQLQJ#²#,QWHUQHW#([SORUHU 7DVWHYHMOHGQLQJ#²#,QWHUQHW#([SORUHU,QGKROGVIRUWHJQHOVH BROWSEREN - DE VIGTIGSTE FUNKTIONER OG BEGREBER.... 2 TILPAS BROWSEREN... 3 GÅ DIREKTE TIL EN KENDT ADRESSE... 5 LAV ET BOGMÆRKE... 6 ORGANISÉR DINE

Læs mere

Statistik på Geocaching.com

Statistik på Geocaching.com Statistik på Geocaching.com Hvis vi gerne vil have statistik på vores profil på Geocaching.com, vel at mærke en statistik der er lidt mere spændende end den der findes der i forvejen, kan vi genere en

Læs mere

Daglig brug af JitBesked 2.0

Daglig brug af JitBesked 2.0 Daglig brug af JitBesked 2.0 Indholdsfortegnelse Oprettelse af personer (modtagere)...3 Afsendelse af besked...4 Valg af flere modtagere...5 Valg af flere personer der ligger i rækkefølge...5 Valg af flere

Læs mere

Qbrick s krav til video filtyper

Qbrick s krav til video filtyper Indhold Qbrick s krav til video filtyper... 1 Krav til ordningen/området... 1 Qbrick s krav til video leverandør... 1 Video og billede størrelser i WCM:... 1 Upload en video... 2 Trin 1: Mediefiler...

Læs mere

vejman.dk Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9

vejman.dk Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Indholdsfortegnelse 1 Indledning... 3 1.1 Anbefalinger... 4 1.2 Datahjælp... 4 1.3 Brugerindstillinger... 5 2 Generel funktionalitet... 6 2.1

Læs mere

Mindmapping med FreeMind. En Introduktion til programmet FreeMind

Mindmapping med FreeMind. En Introduktion til programmet FreeMind En Introduktion til programmet FreeMind Jan Leffers 2006 Indholdsfortegnelse Indledning...2 Hvad er et mindmap...2 Mindmap guidelines...3 Download og installation...3 Kom hurtigt i gang...4 Det første

Læs mere

Tips til søgning Lørdag d. 2. november 2013 Campus Roskilde

Tips til søgning Lørdag d. 2. november 2013 Campus Roskilde Tips til søgning Lørdag d. 2. november 2013 Campus Roskilde Biblioteket Campus Roskilde 29. oktober 2013 Side 1 Hvilke baser kan jeg vælge? ARTESIS: Dette er Campus Roskildes egen søgebase. Indeholder

Læs mere

Advanced Word Template Brugermanual

Advanced Word Template Brugermanual Advanced Word Template Brugermanual Forord: Advanced Word Template er et værktøj, der anvendes sammen med Microsoft Word til at opbygge ensartet beskrivelser på en mere intelligent måde end Copy and Paste

Læs mere

Vejledning til Politikens Retskrivnings- og Betydningsordbog

Vejledning til Politikens Retskrivnings- og Betydningsordbog Vejledning til Politikens Retskrivnings- og Betydningsordbog INDHOLD VALGMULIGHEDER UNDER MENUEN FILER UDSKRIV KOPIER AFSLUT VALGMULIGHEDER UNDER MENUEN SØGEMULIGHEDER OPSLAGSORD ORDFORBINDELSER AL TEKST

Læs mere

Zotero er et smart værktøj til at få styr på dine referencer og litteraturlister. Zotero er gratis og på dansk.

Zotero er et smart værktøj til at få styr på dine referencer og litteraturlister. Zotero er gratis og på dansk. 1 Indhold: Hvorfor Zotero?... 3 Installation... 3 Firefox... 3 Installation af Zotero... 3 Registrer dig som bruger af Zotero... 4 Zotero oversigt over programmet... 4 Tilføj referencer manuelt... 5 Eksempel

Læs mere

Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS).

Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS). Teori til elevforløb på Institut for Biokemi og Molekylærbiologi på Syddansk Universitet: Protein identifikation ved hjælp af Matrix- Assisted Laser Desorption Masse Spektrometri (MALDI-MS). Peter Windfeldt

Læs mere

Dalux Field Brugermanual Registrering og oprette opgaver

Dalux Field Brugermanual Registrering og oprette opgaver Dalux Field Brugermanual Registrering og oprette opgaver Dalux Field Brugermanual Registrering og oprette opgaver Side 1 af 14 Indholdsfortegnelse Om denne brugermanual... 3 Registrering af bruger... Error!

Læs mere

SMART Ink 3.0 BRUGERVEJLEDNING FOR MAC OS X-OPERATIVSYSTEMSOFTWARE

SMART Ink 3.0 BRUGERVEJLEDNING FOR MAC OS X-OPERATIVSYSTEMSOFTWARE SMART Ink 3.0 BRUGERVEJLEDNING FOR MAC OS X-OPERATIVSYSTEMSOFTWARE Meddelelse om varemærker SMART Ink, SMART Meeting Pro, smarttech, SMART-logoet og alle SMART-sloganer er varemærker eller registrerede

Læs mere

Den digitale Underviser. Videoredigering. Windows Live Movie Maker

Den digitale Underviser. Videoredigering. Windows Live Movie Maker Den digitale Underviser Videoredigering Windows Live Movie Maker Indhold Indhold... 1 Windows Movie Maker... 2 Om at oprette et projekt... 3 Optage og downloade video... 4 A. Optage din egen video:...

Læs mere

Easy Guide i GallupPC

Easy Guide i GallupPC Easy Guide i GallupPC Version. 6.00.00 Gallup A/S Masnedøgade 22-26 DK 2100 København Ø Telefon 39 27 27 27 Fax 39 27 50 80 Indhold SÅDAN KOMMER DU I GANG MED AT ANVENDE GALLUPPC... 2 TILFØJELSE AF UNDERSØGELSER

Læs mere

Vejledning KPK Online Prøverum

Vejledning KPK Online Prøverum Vejledning KPK Online Prøverum INDHOLD Introduktion side 2 Funktionsliste side 2 Få adgang til systemet side 3 Opload dine billeder side 4 Sådan bruges systemet side 5 Gem dine eksempler side 7 Side 1/7

Læs mere

MANUAL. Siteloom CMS

MANUAL. Siteloom CMS MANUAL Siteloom CMS www.hjerteforeningen.dk/cms Brugernavn: Password: 3. oktober, 2013 BASIS FUNKTIONER 1. Kalender... 4 1.a. Opret... 5 1.b. Rediger eller slet... 9 2. Sider...12 2.a. Opret side...13

Læs mere

Bioteknologi A. Studentereksamen. Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares.

Bioteknologi A. Studentereksamen. Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares. Bioteknologi A Studentereksamen Af opgaverne 1 og 2 skal begge opgaver besvares. Af opgaverne 3 og 4 skal en og kun en af opgaverne besvares. frs111-btk/a-31052011 Tirsdag den 31. maj 2011 kl. 9.00-14.00

Læs mere

Tlf. +45 7027 1699 Fax + 45 7027 1899

Tlf. +45 7027 1699 Fax + 45 7027 1899 Firmaordninger I firmaoversigten kan du holde styr på dit kundekartotek samt disses bookinger. Der kan desuden oprettes andre firmaer end dit eget. Herved kan der udbydes særlige ydelser på med egne arbejdstider.

Læs mere

Computerundervisning

Computerundervisning Frederiksberg Seminarium Computerundervisning Koordinatsystemer og Funktioner Lærervejledning 12-02-2009 Udarbejdet af: Pernille Suhr Poulsen Christina Klitlyng Julie Nielsen Indhold Introduktion... 3

Læs mere

Søgning i patentlitteraturen

Søgning i patentlitteraturen Søgning i patentlitteraturen Espacenet Espacenet er en international patentdatabase, der indeholder informationer om 50 mio. patentskrifter og litteraturreferencer helt tilbage til 1920. Vil du vide mere

Læs mere

Velkommen til REX onlinehjælp

Velkommen til REX onlinehjælp Velkommen til REX onlinehjælp I REX onlinehjælp kan du finde information om følgende emner: Indhold Enkel søgning...3 Hvordan kan du bruge søgefeltet?...3 Søg efter sætninger...3 Søg efter specifikke ord

Læs mere

MANUAL. Siteloom CMS

MANUAL. Siteloom CMS MANUAL Siteloom CMS www.hjerteforeningen.dk/cms Brugernavn: Password: 3. september, 2012 BASIS FUNKTIONER 1. Kalender... 4 1.a. Opret... 5 1.b. Rediger eller slet... 8 2. Sider... 10 2.a Opret side...

Læs mere

Intra- og intermolekylære bindinger.

Intra- og intermolekylære bindinger. Intra- og intermolekylære bindinger. Dipol-Dipol bindinger Londonbindinger ydrogen bindinger ydrofil ydrofob 1. Tilstandsformer... 1 2. Dipol-dipolbindinger... 2 3. Londonbindinger... 2 4. ydrogenbindinger....

Læs mere

Syv transmembrane receptorer

Syv transmembrane receptorer Syv transmembrane receptorer Receptoren som kommunikationscentral Cellemembranen definerer grænsen mellem en celles indre og ydre miljø, der er meget forskelligt. Det er essentielt for cellens funktion

Læs mere

Embase er en stor sundhedsfaglig database der niveau- og

Embase er en stor sundhedsfaglig database der niveau- og 1 Embase er en stor sundhedsfaglig database der niveau- og indholdsmæssigt supplerer PubMed. Søgning i Embase tager udgangspunkt i den emneordskontrollerede thesaurus, der kaldes EMTREE fra hvilke posterne

Læs mere

MANUAL. Siteloom CMS

MANUAL. Siteloom CMS MANUAL Siteloom CMS www.hjerteforeningen.dk/cms Brugernavn: Password: 13. marts, 2014 BASIS FUNKTIONER 1. Kalender... 4 1.a. Opret... 5 1.b. Rediger eller slet... 9 2. Sider...12 2.a. Opret side...13 2.b.

Læs mere

Vejledning for LOF s afdelingshjemmeside - redigeret i Umbraco

Vejledning for LOF s afdelingshjemmeside - redigeret i Umbraco Vejledning for LOF s afdelingshjemmeside - redigeret i Umbraco Adresse: http://dinafdeling.lof.dk/ Rediger hjemmeside i Umbraco: http://dinafdeling.lof.dk/umbraco/ HUSK ingen www i adressen, skriv blot

Læs mere

HUMANWARE BRAILLIANT INSTALLATIONSVEJLEDNING

HUMANWARE BRAILLIANT INSTALLATIONSVEJLEDNING HUMANWARE BRAILLIANT INSTALLATIONSVEJLEDNING KOMMANDOOVERSIGT TIL BRUG PÅ WINDOWS COMPUTERE MED JAWS INTRODUKTION: Brailliant displays har indbygget BlueTooth og USB. BlueTooth anvendes til at forbinde

Læs mere

How to do it on screen - 5

How to do it on screen - 5 TEGNINGER OG CLIPART Illustrationer kan bruges til at skabe grafisk brud i en tekst, men det er sjældent nødvendigt ved præsentationer, da tekstmængden på det enkelte dias børe være lille. Desuden kan

Læs mere

Manual til WordPress CMS

Manual til WordPress CMS Manual til WordPress CMS 1. Log ind på din Wordpress-side For at arbejde på din hjemmeside skal du først logge ind på administrationsdelen. Muligvis har du et direkte link på siden. Ellers er adressen

Læs mere

Guide til, hvordan du tilføjer en GIPPLER- fane til din Facebook side

Guide til, hvordan du tilføjer en GIPPLER- fane til din Facebook side Guide til, hvordan du tilføjer en GIPPLER- fane til din Facebook side Bemærk! Vi bruger i denne guide både Facebook og en applikation på Facebook for, at lave din GIPPLER- fane. Vi kan af naturlige årsager

Læs mere

Heldigvis har systemet indbygget en hjælp, som man kan benytte, hvis denne vejledning ikke berører det opståede problem.

Heldigvis har systemet indbygget en hjælp, som man kan benytte, hvis denne vejledning ikke berører det opståede problem. Indhold Introduktion...2 Hjælp...2 Office knappen...2 Menulinjen...3 Fast værktøjslinje Hurtig adgang...3 Menupunkter...4 Startside...4 Indsæt...5 Sidelayout...5 Referencer...6 Forsendelser...6 Gennemse...6

Læs mere

Sådan opretter du en elektronisk aflevering

Sådan opretter du en elektronisk aflevering Sådan arbejder du med opgaver i Gradebook/karakterbog Denne vejledning indeholder en detaljeret beskrivelse af hvordan du bruger gradebook/karakterbogen når du vil arbejde med opgaver og give karakterer

Læs mere

Google Søgninger side 1 af13

Google Søgninger side 1 af13 Google Søgninger side 1 af13 Indholdsfortegnelse Internetforkortelser og adresser m.m.... Side 2 Søgning i Google... Side 4 Nyhed erstatning for det sorte bånd... Side 7 Avanceret søgning... Side 10 Flere

Læs mere

Indhold. Brugermanual

Indhold. Brugermanual Indhold 1. Installering af pcon.planner ME... 3 1.1 Start pcon.planner... 3 2. Brugerfladen... 4 2.1 Programmenuen... 5 2.2 Værktøjslinje Hurtig adgang... 5 2.3 Menubaren (ribbon)... 5 2.4 Arbejdsområdet...

Læs mere

Vejledning til referencehåndteringssystemet. Forsvarets Bibliotekscenter Anita Elleby

Vejledning til referencehåndteringssystemet. Forsvarets Bibliotekscenter Anita Elleby Vejledning til referencehåndteringssystemet Forsvarets Bibliotekscenter Anita Elleby Jeg håber, at du vil få glæde af denne vejledning til referencehåndteringssystemet Zotero. Hvis du får problemer undervejs

Læs mere

TOLERANCE KUNDESTYRING

TOLERANCE KUNDESTYRING TOLERANCE KUNDESTYRING Dansk brugervejledning 1 Indholdsfortegnelse: Indledning... 3 1. Kunde... 4 2. Kunde-bil... 5 3. Arbejdssag... 6 4. Tilbud... 7 5. Faktura... 8 6. Historik / medarbejder... 9 7.

Læs mere

kom i gang med apophysis 2.0.2 listemageren

kom i gang med apophysis 2.0.2 listemageren kom i gang med apophysis 2.0.2 listemageren LISTEMAGEREN 2006 0. indledende: apophysis er et open source program der kan benyttes til at generere såkaldte flamme-fraktaler på disse sider findes yderligere

Læs mere

Oftest stillede spørgsmål

Oftest stillede spørgsmål Oftest stillede spørgsmål Her finder du svaret på nogle væsentlige spørgsmål vedrørede brugen af Historiefaget.dk. Tekniske spørgsmål Elevernes navne stemmer ikke overens med deres eget Der kan være to

Læs mere

Microsoft. fra Word 2003

Microsoft. fra Word 2003 I denne vejledning Microsoft Word 2010 ser meget anderledes ud end Word 2003, og vi har derfor oprettet denne vejledning, så du hurtigere kan komme i gang med at bruge programmet. Læs videre for at få

Læs mere

RefWorks en vejledning fra UCL Biblioteket. Indholdsfortegnelse

RefWorks en vejledning fra UCL Biblioteket. Indholdsfortegnelse Indholdsfortegnelse Hvad er RefWorks?... 2 Opret dig som bruger... 2 Inden du går i gang... 3 Klargøring af computer til download af Write-N-Cite v. 4.2... 3 Installation af Write-N-Cite... 4 Installation

Læs mere

PubMed Vejledning. Fritekstsøgning (Basic search) Fremvisningsformater

PubMed Vejledning. Fritekstsøgning (Basic search) Fremvisningsformater PubMed Vejledning Vælg PubMed fra Fagbibliotekets hjemmeside. Så får du samtidig adgang til mange artikler i fuldtekst. Udenfor hospitalets netværk skal du gå ind via fjernadgang til DEFF. (www.tidsskrifter.deff.dk

Læs mere

Mini-vejledning til. PubMed

Mini-vejledning til. PubMed Mini-vejledning til PubMed Udarbejdet af bibliotekar Helen Grundtvig Kristensen. Revideret Januar 2010 1 Indholdsfortegnelse Pubmed: introduktionsside side 3 Enkel søgning side 4 Advanced Search side 4

Læs mere

Indstillinger. 1. Built-in viewer 2. Built-in viewer embedded 3. Ekstern viewer

Indstillinger. 1. Built-in viewer 2. Built-in viewer embedded 3. Ekstern viewer TeXMaker guide TeXMaker er den editor, som vi anbefaler til at skrive LaTeX i. Det er en såkaldt cross-platform editor og kan benyttes til både Windows, Mac og Linux. TeXMaker er en ret almindelig editor

Læs mere

Mad, motion og blodsukker

Mad, motion og blodsukker Mad, motion og blodsukker Opgaven I skal have idrætsdag på skolen, og der er forskellige formiddags-aktiviteter, I kan vælge mellem: 1. I skal løbe 8 km i moderat tempo. Efter en kort pause skal I sprinte

Læs mere

Tutorial 2: Indlæsning af nye rapporter

Tutorial 2: Indlæsning af nye rapporter Tutorial 2: Indlæsning af nye rapporter Indledning Myndigheder og rådgivere som arbejder med den nationale grundvandskortlægning kan blive oprettet som bruger (redaktør) af rapportdatabasen. Herved får

Læs mere

Introduktion til billeddatabasen

Introduktion til billeddatabasen Introduktion til billeddatabasen Colourbox.dk Colourbox.dk er den billeddatabase som Odense Kommune har købt licens til. Det er vigtigt at bemærke, at der ikke er ubegrænset download af billeder. I materialet

Læs mere

Velkommen til REX onlinehjælp

Velkommen til REX onlinehjælp Velkommen til REX onlinehjælp I REX onlinehjælp kan du finde information om følgende emner: Indhold Velkommen til REX onlinehjælp... 1 Søgning... 3 Hvordan kan du bruge søgefeltet i enkel søgning?... 3

Læs mere

Du skal have en Google konto for at kunne anvende Webalbum! Har du ikke det, så får du her en kort orientering om, hvorledes du kan få en konto.

Du skal have en Google konto for at kunne anvende Webalbum! Har du ikke det, så får du her en kort orientering om, hvorledes du kan få en konto. Indhold Webalbum...2 Google-konto...2 Brug af webalbum...5 Overføre billeder til album...5 Se og bruge sine billeder i webalbummet...6 E-mail...9 Udskriv...12 Bestil udskrifter...13 Blog This...13 Collage...14

Læs mere

SÅDAN BRUGER DU REGNEARK INTRODUKTION

SÅDAN BRUGER DU REGNEARK INTRODUKTION SÅDAN BRUGER DU REGNEARK INTRODUKTION I vejledningen bruger vi det gratis program Calc fra OpenOffice som eksempel til at vise, hvordan man bruger nogle helt grundlæggende funktioner i regneark. De øvrige

Læs mere

Det lyder enkelt, men for at forstå hvilket ærinde forskerne er ude i, er det nødvendigt med et indblik i, hvordan celler udvikles og specialiseres.

Det lyder enkelt, men for at forstå hvilket ærinde forskerne er ude i, er det nødvendigt med et indblik i, hvordan celler udvikles og specialiseres. Epigenetik Men hvad er så epigenetik? Ordet epi er af græsk oprindelse og betyder egentlig ved siden af. Genetik handler om arvelighed, og hvordan vores gener videreføres fra generation til generation.

Læs mere

1. Opbygning af et regneark

1. Opbygning af et regneark 1. Opbygning af et regneark Et regneark er et skema. Vandrette rækker og lodrette kolonner danner celler, hvori man kan indtaste tal, tekst, datoer og formler. De indtastede tal og data kan bearbejdes

Læs mere

Opsætning før undervisning

Opsætning før undervisning Vejledning til Opsætning før undervisning Version pr 2011-11-10 Opdateret og seneste version kan altid hentes på http://webtour.dk/manual Der arbejdes til stadighed på at forbedre vores brugervejledning

Læs mere

Installation af Oracle 10g Release 2 database

Installation af Oracle 10g Release 2 database Installation af Oracle 10g Release 2 database Oracle 10g database indeholder databasesoftware, enterprise manager, SQL*Plus m.m., HTML DB (i dag kendt som Application Express) og tilhørende HTTP Server

Læs mere

SIDEN PÅ WORDPRESS.COM

SIDEN PÅ WORDPRESS.COM WordPress WordPress er et fantastisk program til blog og til hjemmesider, hvor du gerne vil kunne rette via din browser. WordPress er meget udbredt og det er derfor nemt at finde fora, templates og hjælp

Læs mere

Hvis du ikke kan huske adgangskoden, har andre problemer med at logge på eller ikke er oprettet, skal du kontakte:

Hvis du ikke kan huske adgangskoden, har andre problemer med at logge på eller ikke er oprettet, skal du kontakte: Mini-guide til Retox Databasen er tilgængelig fra www.retox.dk, klik på linket Som udgangspunkt er der se-adgang til arbejdspladsbrugsanvisningerne. Hvis der skal tilføjes eller fjernes produkter, og hvis

Læs mere

5. OPSÆTNING DOKUMENTSKABELONER 5.1 TRIN

5. OPSÆTNING DOKUMENTSKABELONER 5.1 TRIN 5. OPSÆTNING DOKUMENTSKABELONER Under fanen Dok. skabeloner kan du arbejde med de skabeloner som du har i systemet, eller du kan oprette nye. I denne vejledning kigger vi på hvordan du kan tilrette selve

Læs mere

Introduktion til de praktiske øvelser

Introduktion til de praktiske øvelser Introduktion til de praktiske øvelser Vi vil i dag fokusere på tre forskellige online software til SNP analyser snptree NDtree CSIphylogony Introduktion til SNP analyser http://cge.cbs.dtu.dk/services/all.php

Læs mere

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature.

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature. 0 Indhold 1) Basens indhold... 1 2) Adgang til basen... 1 3) Sign In / My EBSCOhost... 2 4) Søgemetoder... 3 4.a Fritekstsøgning... 3 4. b Begrænsning / afgrænsning... 4 4.c Er der adgang til artiklens

Læs mere

Vejledning til ereolens app til Android enheder

Vejledning til ereolens app til Android enheder Vejledning til ereolens app til Android enheder 26-01-2015 Indhold 1. Hvordan henter jeg ereolens App til smartphones og tablets?... 3 2. Opdatering af styresystem på din Android enhed... 4 3. Hvordan

Læs mere

Orddeling. Automatisk orddeling. Manuel orddeling. Word 2010 18 thoremil.dk. Vælg fanebladet [Sidelayout] Vælg [Orddeling] Markér Automatisk orddeling

Orddeling. Automatisk orddeling. Manuel orddeling. Word 2010 18 thoremil.dk. Vælg fanebladet [Sidelayout] Vælg [Orddeling] Markér Automatisk orddeling Orddeling Automatisk orddeling Vælg [Orddeling] Markér Automatisk orddeling Manuel orddeling Vælg [Orddeling] Klik [Manuelt] For hvert ord, som vises, kan der gøres følgende: Accepter det foreslåede orddelingssted

Læs mere

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler.

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler. 0 Indholdsfortegnelse 1) Basens indhold... 1 2) Adgang til basen... 1 3) Søgemetoder... 2 a. Fritekstsøgning... 2 a. i. Muligheder for afgrænsning... 5 a. ii. Adgang til den fulde tekst eller ej / Ændring

Læs mere

En lille vejledning til lærere og elever i at bruge matematikprogrammet WordMat (begynderniveau)

En lille vejledning til lærere og elever i at bruge matematikprogrammet WordMat (begynderniveau) Matematik i WordMat En lille vejledning til lærere og elever i at bruge matematikprogrammet WordMat (begynderniveau) Indholdsfortegnelse 1. Introduktion... 3 2. Beregning... 4 3. Beregning med brøker...

Læs mere

Karens vejledning til WordPress, september 2014 1

Karens vejledning til WordPress, september 2014 1 Karens vejledning til WordPress, september 2014 1 Karens WordPress vejledning september 2014 INDHOLD Hvad er WordPress 1 Generelt om WordPress 2 Frontend og backend 2 Skrive en blog-tekst (indlæg/post)

Læs mere

Biblus Bibliotekssystem

Biblus Bibliotekssystem Brugervejledning Biblus Bibliotekssystem udarbejdet af Sensus ApS Dato: 14. juni 2009 Version: 1.2 Status: Endelig Ophavsret Sensus ApS. Alle rettigheder forbeholdes Ophavsret Sensus ApS. Alle rettigheder

Læs mere

Start af nyt schematic projekt i Quartus II

Start af nyt schematic projekt i Quartus II Start af nyt schematic projekt i Quartus II Det følgende er ikke fremstillet som en brugsanvisning der gennemgår alle de muligheder der er omkring oprettelse af et Schematic projekt i Quartus II men kun

Læs mere

Vejledning til brug af digitale kort på Ringsted Kommunes hjemmeside

Vejledning til brug af digitale kort på Ringsted Kommunes hjemmeside Vejledning til brug af digitale kort på Ringsted Kommunes hjemmeside Indledning Digitale kort er en mulighed til alle borgere om at se en række af de oplysninger, som Ringsted Kommune har registreret på

Læs mere

Sådan opdaterer og vedligeholder du din hjemmeside i Wordpress.

Sådan opdaterer og vedligeholder du din hjemmeside i Wordpress. Wordpress manual Sådan opdaterer og vedligeholder du din hjemmeside i Wordpress. Dette er en manual til de mest grundlæggende ting og funktioner i Wordpress, så du selv kan redigere indholdet eller tilføje

Læs mere

BAAN IVc. Brugervejledning til BAAN Data Navigator

BAAN IVc. Brugervejledning til BAAN Data Navigator BAAN IVc Brugervejledning til BAAN Data Navigator En udgivelse af: Baan Development B.V. P.O.Box 143 3770 AC Barneveld Holland Trykt i Holland Baan Development B.V. 1997. Alle rettigheder forbeholdes.

Læs mere

Pædagogisk IT. Vejledning i Office 365 til elever og deres familier. Version 4 Side 1. Kan udfyldes for at hjælpe med at huske

Pædagogisk IT. Vejledning i Office 365 til elever og deres familier. Version 4 Side 1. Kan udfyldes for at hjælpe med at huske Navn: Uni-login: Uni-login kode: Office365 email: Kan udfyldes for at hjælpe med at huske UNI-LOGIN @undervisning.kk.dk Version 4 Side 1 Indledning Velkommen til denne vejledning i Office 365, som introducerer

Læs mere

Søgning på Internettet

Søgning på Internettet Side 1 af 6 Indhold: Søgning på Internettet Tips til søgning på Internettet... 1 Præcis adresse:... 1 Indeks- søgning... 2 Søgerobotterne/søgemaskiner:... 3 Lidt om hvordan man søger på nettet... 4 Links...

Læs mere

Bliv opdaget på Internettet! - 10 gode råd til at optimere din hjemmeside til søgemaskiner

Bliv opdaget på Internettet! - 10 gode råd til at optimere din hjemmeside til søgemaskiner Bliv opdaget på Internettet! - 10 gode råd til at optimere din hjemmeside til søgemaskiner Af Henrik Bro og Martin T. Hansen I har måske allerede en flot, og informativ hjemmeside. Og alle jeres kursister

Læs mere

Kursusbeskrivelse. Forarbejde. Oprettelse af en Access-database

Kursusbeskrivelse. Forarbejde. Oprettelse af en Access-database Kursusbeskrivelse Oprettelse af en Access-database Som eksempel på en Access-database oprettes en simpelt system til administration af kurser. Access-databasen skal indeholde: et instruktørkartotek et

Læs mere

INTRODUKTION TIL FACTORING... 3 DEBITORER...

INTRODUKTION TIL FACTORING... 3 DEBITORER... Side 1 Indholdsfortegnelse INTRODUKTION TIL FACTORING... 3 DEBITORER... 4 OPRETTELSE AF DEBITORER... 4 ÆNDRING AF DEBITORER... 5 OPRETTELSE AF FAKTURAPOSTER TIL MIDT FACTORING... 6 GENVEJSTASTER... 13

Læs mere

Nye funktioner i Professionel Hjernetræning.

Nye funktioner i Professionel Hjernetræning. Nye funktioner i Professionel Hjernetræning. 1) Ny log in side 2) Tildel øvelserne enkeltvis 3) Reguler sværhedsgraden af øvelserne (kun i Psykiatriprogrammet) Der er i løbet af foråret 2013 lavet nogle

Læs mere

Vejledning til Photofiltre nr.128 Side 1

Vejledning til Photofiltre nr.128 Side 1 Side 1 Denne vejledning er blot et lille eksempel på hvordan man også kan bruge Photofiltre 7 som en slags grafikprogram. Det er med udgangspunkt i f.eks. min hjemmeside hvor vi vil bruge den blå farve

Læs mere

Kom godt i gang med NIS

Kom godt i gang med NIS Kom godt i gang med NIS Viden med videre Kom godt i gang Velkommen til NIS Kommuneinformations internetbaserede lovsystem. Denne lille folder giver dig en kort introduktion til arbejdet med NIS, så du

Læs mere

Skifte til Excel 2010

Skifte til Excel 2010 I denne vejledning Microsoft Excel 2010 ser meget anderledes ud end Excel 2003, og vi har derfor oprettet denne vejledning, så du hurtigere kan komme i gang med at bruge programmet. Læs videre for at få

Læs mere

I denne vejledning lærer du de mest grundlæggede funktioner i PowerPoint 2003: Hvad er en præsentation?... 3. Eksempel på en præsentation...

I denne vejledning lærer du de mest grundlæggede funktioner i PowerPoint 2003: Hvad er en præsentation?... 3. Eksempel på en præsentation... Præsentationer: Vejledning PowerPoint 2003 I denne vejledning lærer du de mest grundlæggede funktioner i PowerPoint 2003: Hvad er en præsentation?... 3 Eksempel på en præsentation... 3 Visninger... 3 Normal...

Læs mere

Web sider. Introduktion: Har du nogensinde spekuleret over, hvordan det verdesomspændende internet virker og hvordan man snakker med det?

Web sider. Introduktion: Har du nogensinde spekuleret over, hvordan det verdesomspændende internet virker og hvordan man snakker med det? Introduktion: Har du nogensinde spekuleret over, hvordan det verdesomspændende internet virker og hvordan man snakker med det? I dag skal du lære at lave hjemmesider, så du også kan bidrage til at opbygge

Læs mere

ectrl-scannerløsning Vejledning

ectrl-scannerløsning Vejledning ectrl-scannerløsning Vejledning Version 3.2 Side 1 af 11 Indholdsfortegnelse 1. Forberedelse og installation... 3 1.1. Forberedelse... 3 1.2. Software til stregkodegenkendelse... 3 1.3. Klistermærker med

Læs mere