Danmarks Tekniske Universitet

Størrelse: px
Starte visningen fra side:

Download "Danmarks Tekniske Universitet"


1 Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/ Kursus navn: Kursus nr Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle opgaver. Kursusansvarlig Thomas Nordahl Petersen

2 Side 2 of Eksamen Januar 2013 Dette sæt indeholder x opgaver (side 1-x) check at du har alle sider. Opgave 1 DNA og aminosyrer (10%) Opgave 2 Uniprot, Blast og UCSC blat (25%) Opgave 3 Parvis alignment (20%) Opgave 4 α-helix og informationsinhold (25%) Opgave 5 phylogenetisk træ og afstandsmatrice (20%) En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan - Monday_January_21_exam Svar til opgavesættet kan skrives enten i rå tekst (fx i JEdit) eller i et tekstbehandlingprogram såsom Microsoft Word. Gyldige formater er.txt,.doc,.docx og.rtf. Vi foretrækker dog at du benytter Microsoft Word. Svaret skal uploades på CampusNet under kursus (under "Opgaver -> bioinformatik-eksamen2013"). Husk at gemme seneste version af dokumentet inden du uploader svaret. Når du afleverer får du en kode som skal skrives i feltet "Afleveringskode" nedenfor. VIGTIGT: Dit studienummer skal fremgå af filnavnet (fx. s doc eller s txt) og skal også stå i starten af dokumentet (fx: "Studienummer: s022717") Udfyld denne forside og aflever den til eksamensvagten. Navn: Studienummer: Afleveringskode:

3 Side 3 of 17 Ang. brug af Internettet Trådløst internet: Du kan koble dig på det Wireless system du normalt bruger. Online materialer: Linksamlingen til bioinformatik serverne findes via kursets lektionsplan. BEMÆRK: I er ikke begrænset til kun de links der findes her det er tilladt at søge information andetsteds. Det er IKKE tilladt at kommunikere med andre over nettet under eksamen. Sluk telefonen. Der vil blive taget stikprøver af netværkstrafikken for at sikre dette. Hvad gør man hvis en web-server ikke virker: 1) Verificer at input-data er i korrekt format. Forkert inputdata er i næsten alle tilfælde årsagen til problemet. 2) Prøv evt. at finde en alternativ server med samme funktion (Google). 3) Rapporter fejlen til eksamensvagten - den kursusansvarlige vil så blive tilkaldt. HUSK altid: Don t panic Held og lykke med eksamenen. -Thomas

4 Side 4 of 17 Opgave 1 DNA og aminosyrer (10%) Herunder er vist et Enkelt-strenget DNA molekyle. Enkelt-strenget DNA molekyle: 5 CCGTGTGCAA 3 a) Hvilke af de 5 DNA strenge herunder (1-5), er den komplimentære DNA streng til: 5 CCGTGTGCAA 3? 1) 5 GGCACAGGTT 3 2) 3 GGCACAGGUU 5 3) 3 CCGTGTCCAA 5 4) 5 AACCTCTCCC 3 5) 5 TTGCACACGG 3 Answer: 5) 5 -TTGCACACGG-3 b) Oversæt sekvensen 5 CCGTGTCCAA 3 i læseramme +2 og skriv hvilken aminosyresekvensens der fås ved hjælp af 1-bogstavskoder? CGT-GTC-CAA => RVQ De aromatiske aminosyrer har alle en sidekæde hvor en del af denne er plan dvs flad på grund af et konjugeret system hvor elektroner befinder sig i en sky over og under denne flade gruppe af sidekæden. Disse aromatiske aminosyrer er: Phe, Tyr, Trp og His. c) Hvilke af disse aminosyrer er udelukkende hydrophobe dvs ingen polære grupper i sidekæden? Phe d) Hvilke af disse aminosyrer kan have en sidekæde som er positivt ladet? His Enzymer er en klasse af proteiner som katalyserer en kemisk proces således at dennne kan foregå meget hurtigt. Det sted på proteinet hvor den katalytiske process foregår kaldes det aktive site og det er normalt 1-3 aminosyrer som benyttes til at udføre den katalytiske funktion i et protein. Af de 20 naturligt forekommende aminosyrer er det kun et fåtal som man ser i det aktive site som del af den katalytiske mekanisme. e) Hvilke af disse aminosyrer nævnt herunder 1)-5) kan være blandt de katalytiske aminosyrer? 1) Asp, 3) Arg, 5) Ser 1) Asp 2) Ala 3) Arg 4) Phe

5 Side 5 of 17 5) Ser e) Når man taler om den naturlige læseretning for en proteinsekvens er der kun en af de udsagn herunder 1)-4) som er korrekt. Hvilken? 3) N-terminal -> C-terminal 1) C-terminal -> N-terminal 2) 5 -> 3 3) N-terminal -> C-terminal 4) 3 -> 5

6 Side 6 of 17 Opgave 2 UniProt, Blast og UCSC blat (25%) Benyt uniprot til at finde humane sekvenser (Taxonomy 9606) som har følgende: Et eksperimentelt signalpeptid med en længde på aminosyrer, samt et eksperimentelt bestemt propeptid. a) Hvor mange hits finder du (skriv gerne søgestrengen)? 53 hits taxonomy:9606 AND annotation:(type:signal length:[20 TO 30] confidence:experimental) AND annotation:(type:propep confidence:experimental) b) Vil du forvente af de proteiner du finder er aktive indeni cellen eller udenfor? (begrund dit svar) Udenfor cellen da det er secreted proteiner Proteinet Elafin (accession id: P19957) opfylder kriterierne fra spørgsmål a) og det benyttes herefter som vores søgesekvens. Brug Blast at finde homologe (lignende) sekvenser som findes ved at blaste mod databasen Protein data Bank proteins(pdb). c) Hvor mange signifikante hits finder du og forklar hvorfor du mener det er signifikante hits? Der er 2 hits med en e-værdi lavere end 1e- 05 d) Hvad er accession-id for det bedste hit du finder og hvad er e- værdien? Bedste hit 1FLE.I med en e-værdi på 3e-35 Alignment fra det bedste hit benyttes i de næste 2 spørgsmål du må gerne paste alignment ind herunder før du svarer på spørgsmål e) og f). Alignment: Score Expect Method Identities Positives Gaps 118 bits(296) 3e-35 Compositional matrix adjust. 57/57(100%) 57/57(100%) 0/57(0%) Query 61 AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ 117 AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ Sbjct 1 AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ 57 e) Hvor stor en del (i procent) af din søgesekvens er dækket af det alignment du fandt? Query sekvensen er 117aa lang, men alignment dækker kun = 57, 57*100/117=48.7%

7 Side 7 of 17 f) Hvor stor en del (i procent) udgør alignment i forhold til den modne del (eng: mature) af din søgesekvens? Den mature sekvens går iffølge uniprot fra , dvs 100% af den mature sekvens er dækket af alignment. I det følgende skal du stadig benytte samme fasta sekvens med UniProt accession-id P Benyt UCSC Blat genom browseren g) På hvilken kromosom findes genet som koder for dette protein og hvad er de genomiske positioner Start og End for genet? Chr20, start , End h) Hvor mange kodende exons består genet af? 2 kodende exons 2 Kig på intron/exon overgangene dvs donor site og acceptor site og benyt Figur 1 og 2 som hjælp til at vurdere om Blat finder de korrekte intron/exon overgange. Skriv de donor og acceptor sites i spørgsmål j) og k) som du mener er korrekte og gør det ved at skrive de sidste 3 nukleotider i exon for donor site og de første 3 nukleotider i exon for acceptor site.. Figur 1. Exon slutter på position -1 og intron starter fra position 0.

8 Side 8 of 17 Figur 2. Intron slutter på position -1 og exon starter fra position 0. i) Donor site (sidste 3 nukleotider i exon delen)? j) Acceptor site (første 3 nukleotider i exon delen)?

9 Side 9 of 17 Opgave 3 Parvis alignment (20%) Herunder er to proteinsekvenser sekvensa og sekvensb. >sekvensa CEGS >sekvensb MDGCI Der findes overordnet 2 typer af alignment: lokal alignment og global alignment. I det følgende skal du benytte Blosum50 substitutionmatricen herunder og Figur 3 som er vist på næste side til at aligne de to sekvenser sekvensa og sekvensb. Alle gaps har en værdi på -2. BLOSUM50 substitution matrix: A 5 R -2 7 N D C Q E G H I L K M F P S T W Y V A R N D C Q E G H I L K M F P S T W Y V Hvis du har word: Hvis du har åbnet dette dokument i word er det nemmest bare at udfylde tabellen som er vist i Figur 3. Hvis du ikke har word: Skrive alignmentscorerne i en lang liste med angivelse af hvilken celle i Figur 3 du udregner, hvor celle er (række,kolonne) f.eks. på denne måde: M C celle (1,1) = Alignmentscore

10 Side 10 of 17 M E celle (1,2) = Alignmentscore M G celle (1,3) = Alignmentscore... I S celle (5,4) = Alignmentscore a) Lav en lokal alignment de to sekvenser ved at udfylde tabellen i Figur 3 og skriv hvilken alignment score du får? b) Skriv det lokale alignment du har fundet ved at udfylde tabellen i Figur 3

11 Side 11 of 17 Figur 3 C E G S M D G C I

12 Side 12 of 17 I en local alignment finder man højeste tal I matricen og backtracer indtil man støder på et 0 (nul). Alignmentscoren bliver altså 10. Alignment bliver: D G E G Man kan regne efter og får alignmentscore= 2+8=10

13 Side 13 of 17 Opgave 4 α-helix og informationsindhold (25%) Man har 3 typer af α-helix som hver især er karakteriser med deres hydrogenbindingsmønster. De 3 typer kaldes 310-helix, normal α-helix (oftest forekommende og den type man mener når man bare siger α- helix) og π-helix. Det som holder hver af de 3 typer af α-helix sammen er hydrogenbindingerne mellem backbone-atomerne N(i) og O(i+n), hvor i er en aminosyre på position i og i+n er den aminosyre hvortil der laves en hydrogenbinding og n er det heltal som beskriver hydrogenbindingsmønstret mellem positionerne i -> i+n a) Hvad er hydrogenbindingsmønstret for en normal α-helix, dvs hvad er værdien af n? 4 Der er nogle aminosyrer som man oftere finder i en α-helix end andre og der kan også være en præference for hvilke aminosyrer som sidder lige før starten af en α-helix. For at undersøge dette kan man aligne et stort antal α-helixer og beregne aminosyrer-frekvenserne for udvalgte positioner som det er gjort i Tabel 2. Aminosyrefrekvenserne er givet for hvor ofte en specifik aminosyre sidder lige før starten af en α-helix (position -1), mens kolonnen position 1 viser aminosyrefrekvenserne på den første position in en α-helix. Kun de 5 oftest forekommende aminosyretyper på hver position er angivet i Tabel 2, mens frekvensen for de andre er sat til 0 (af beregningsmessige årsager). Informationsinholdet på position i er givet ved følgende formel: Ι(i)= Σa fa * log2 (fa) + log2(n), hvor N=20, antallet af standard aminosyrer og fa er frekvensen af en given aminosyre. Log2(x) = log(x)/log(2) b) Benyt frekvenserne i Tabel 2 at beregne informationsindholdet på position -1 og på position 1 position -1: 0.260*log(0.260)/log(2)+0.262*log(0.262)/log(2) *log(0.164)/log(2) *log(0.113)/log(2) *log(0.201)/log(2) + log(20)/log(2)= log(20)/log(2) = = position 1:

14 Side 14 of *log(0.198)/log(2) *log(0.19)/log(2) *log(0.214)/log(2) *log(0.257)/log(2) *log(0.141)/log(2) +log(20)/log(2) = = Tabel 2 Aminosyre Frekvenser på position -1 Frekvenser på position 1 A C 0 0 D E F 0 0 G 0 0 H 0 0 I 0 0 K 0 0 L M 0 0 N P Q 0 0 R 0 0 S T V W 0 0 Y 0 0 Informationsindhold c) Hvad betyder det hvis man får et informationsindhold på 0 (nul)? At alle aminosyrer forekommer med samme frekvens og ingen aminosyre-præference d) Hvis der på en position kun observeres en bestemt type aminosyre dvs en frekvens er 1, mens de andre 19 frekvenser er 0 (nul). Hvilket informationsindhold får man så? Log(20)/log(2)=4.32 e) Skriv 3-bogstavskoderne for de 3 oftest forekommende aminosyrer på den position i Tabel 2 du bestemte med det højeste informationsindhold? Asp, Ser, Thr Det er kendt at den 3-dimensionells struktur er mere bevaret end funktionen og at funktionen er mere bevaret end sekvensen. Dette kan skrives som: Struktur > Funktion > Sekvens. Hvis man laver et multipelt

15 Side 15 of 17 alignment af en familie af enzymer, alle med samme funktion, er det muligt at bestemme hvilke aminosyrer der er vigtige for netop den familie af enzymer og for hver position i sekvensen kan man beregne informationsindholdet. f) Beskriv hvilke positioner i et protein hvor man vil forvente et forholdsvis højt informationsindhold? Positioner i det aktive site og positioner som er vigtige protein-foldet.

16 Side 16 of 17 Opgave 5 Phylogenetisk træ og afstandsmatrice (20%) For at bestemme hvor nært beslægtet forskellige organismer er, må man lave et multipelt alignment af deres arvemateriale. Herunder er vist fire korte stykker genomisk materiale fra organismerne vi kalder A, B, C og D og sekvenserne er alignet således: A: TAGGAATA B: TAAGCAAA C: CTAGCATG D: TTACCATG Udfyld afstandsmatricen herunder med alle parvise forskelle. A B C D A B 3 C 5 4 D Benyt herefter afstandsmatricen til at lave det phylogenetiske træ og skriv hvor i træet du vil placere organismerne A-D (organisme A er allerede placeret øverst til venstre i træet) og hvilket afstande d1-d5 som opfylder kriterierne fra afstandsmatricen.

17 Side 17 of 17 Organisme øverst til venstre = A Organisme nederst til venstre =B Organisme øverst til højre =C Organisme nederst til højre =D Afstand d1=2 Afstand d2=1 Afstand d3=2 Afstand d4=1 Afstand d5=1

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 16 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

27611 Eksamen Sommer 2008

27611 Eksamen Sommer 2008 27611 Eksamen Sommer 2008 Dette sæt indeholder 10 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan under selve eksamen ( juni 2008 klokken 15:00-19:00). DNA/Protein

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 af 1 Danmarks Tekniske Universitet Side 1 af 11 sider Skriftlig prøve, den 27/5-2010 Kursus navn: Kursus nr. 27611 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 13 Danmarks Tekniske Universitet Skriftlig prøve, den 22/2-2013 Kursus navn: Introduktion til SystemBiologi Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle opgaver. Kursusansvarlig

Læs mere

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik Danmarks Tekniske Universitet Løsningsforslag til Øvelse i Immonologisk Bioinformatik Indledning De følgende sider giver en gennemgang af de øverlser i har lavet under jeres besøg på DTU, som en del af

Læs mere

Immunologisk bioinformatik

Immunologisk bioinformatik Immunologisk bioinformatik Øvelsesvejledning Introduktion til øvelsen Når man i dagligdagen taler om influenza, bliver virussen ofte forbundet med forbigående og ufarlig sygdom. Som regel har mennesker

Læs mere

Immunologisk Bioinformatik

Immunologisk Bioinformatik Immunologisk Bioinformatik Et undervisningsmateriale til de danske gymnasier Af Isa Kristina Kirk Materialet er lavet af Isa Kristina Kirk for Biotech Academy ved Danmarks Tekniske Universitet, DTU, i

Læs mere

Databasesøgning med BLAST

Databasesøgning med BLAST Databasesøgning med BLAST Denne vejledning giver en introduktion til databasesøgning med forskellige programmer i BLAST-familien. Vejledningen indeholder først en grundig introduktion og gennemgang af

Læs mere

Struktur og funktion af gener

Struktur og funktion af gener Molekylærbiologi og genetik S4, F2008 f Malene Munk Jørgensen Emne: Struktur og funktion af gener Link: undervisningsplanen for S4-molekylærbiologi og genetik MMJ, VI niversity ollege Bioanalytikeruddannelsen

Læs mere

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013 Proteiner: en introduktion Modul 1; F13 Rolf Andersen, 18/2-2013 4 facts om proteiner Proteiner udgør én af de vigtigste stofgrupper i vores organisme; de varetager en lang række forskellige funktioner.

Læs mere

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle BIOINFORMATIK Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle indhold DNA 2 Hvilke databaser skal man vælge? 2 Søgning på en nukleotidsekvens 2 Proteiner 4 Søgning på

Læs mere

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Per Tøfting 23. september 2008 Speciale i softwarekonstruktion IT-Vest Aarhus Universitet Agenda Formål microrna Strategien

Læs mere

Bioinformatik Open Source Software i biologiens tjeneste

Bioinformatik Open Source Software i biologiens tjeneste Bioinformatik Open Source Software i biologiens tjeneste Kenneth Geisshirt kneth@silex.dk Silex Science ApS Bioinformatik p.1/19 Om Silex Science ApS Grundlagt maj 2002 Ejeren er Cortex Holding Fokusområderne

Læs mere


BIOTEKNOLOGI HØJT NIVEAU STUDENTEREKSAMEN 2007 2007-BT-1 BITEKNLGI HØJT NIVEAU Torsdag den 31. maj 2007 kl. 9.00 14.00 Sættet består af 1 stor og 2 små opgaver samt 1 bilag i 2 eksemplarer. Det ene eksemplar af bilaget afleveres

Læs mere


BIOTEKNOLOGI HØJT NIVEAU STUDETEREKSAME 2006 2006-BT-2 BIOTEKOLOGI HØJT IVEAU Onsdag den 16. august 2006 kl. 9.00 14.00 Sættet består af 1 stor og 2 små opgaver. Alle hjælpemidler tilladt. STOR OPGAVE 1. Myoglobin A. Den røde

Læs mere

Genetiske afstande og afstandsmatricer

Genetiske afstande og afstandsmatricer Genetiske afstande og afstandsmatricer Denne vejledning indeholder en række små øvelser og opgaver der illustrerer, hvordan man ud fra genetiske sekvenser kan udregne en gennemsnitlig evolutionær afstand

Læs mere

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Isa Kirk Biotech Academy Institut for Systembiologi, Danmarks Tekniske Universitet 2. november 2010 1 Indhold 1 Introduktion

Læs mere

I denne manual kan du finde en hurtig introduktion til hvordan du:

I denne manual kan du finde en hurtig introduktion til hvordan du: VORES NORDSJÆLLAND HURTIGT I GANG MANUAL 01: Bruger HVAD INDEHOLDER DENNE MANUAL? I denne manual kan du finde en hurtig introduktion til hvordan du: 1. Finder Vores Nordsjælland hjemmesiden 2. Opretter

Læs mere

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer)

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer) Elevvejledning til det Virtuelle Kræftlaboratorium Det Virtuelle Kræftlaboratorium stiller krav til en grundig forståelse af det centrale dogme inden for molekylærbiologien, hvordan DNA oversættes til

Læs mere

vejledning sådan ARBejdeR du i ebg s RAppoRTvæRKTøj

vejledning sådan ARBejdeR du i ebg s RAppoRTvæRKTøj vejledning sådan arbejder du i ebg s rapportværktøj Vejledning for 2013/2014 Sådan arbejder du i EBG's rapportværktøj www.business-games.dk Indholdsfortegnelse: Forord... 2 Login... 2 Rapportværktøjet...

Læs mere

Kom godt i gang med I-bogen

Kom godt i gang med I-bogen Kom godt i gang med I-bogen At åbne bogen Det allerførste, du skal gøre, for at kunne arbejde med i-bogen, er at aktivere den. Det gøres ved at oprette en konto på systime.dk og derefter aktivere bogen

Læs mere

Opgaver. Notater. Opgave 1: Find kursus hjemmeside og bladre lidt rundt på siderne.

Opgaver. Notater. Opgave 1: Find kursus hjemmeside og bladre lidt rundt på siderne. Opgaver Opgaverne er stillet i henhold til medleverede brugervejledning, og som er en facitliste for opgaverne. Brug den undervejs til at løse opgaverne med, og kom med de punkter som den måtte mangle,

Læs mere

Lav din egen forside i webtrees

Lav din egen forside i webtrees Lav din egen forside i webtrees Du behøver ikke at kunne kode eller gøre noget advanceret for at designe din helt egen forside i webtrees. Alt du skal gøre er bare at gøre brug af den indbygget editor.

Læs mere

På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men

På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men På grund af reglerne for copyright er det ikke muligt at lægge figurer fra lærebøger på nettet. Derfor har jeg fjernet figurerne fra slides ne, men skrevet hvorfra de er taget. De tre bøger, hvorfra illustrationerne

Læs mere

Sådan redigerer du en hjemmeside i Umbraco

Sådan redigerer du en hjemmeside i Umbraco Brugermanual til din boligafdelings hjemmeside Sådan redigerer du en hjemmeside i Umbraco Indhold Introduktion... 2 Log på Umbraco og redigér din hjemmeside... 3 Opret ny side... 7 Gem side uden at udgive/publicere

Læs mere

Manual Version 2. til oprettelse af hjemmesider for landsbyer i Rebild kommune

Manual Version 2. til oprettelse af hjemmesider for landsbyer i Rebild kommune Manual Version 2 til oprettelse af hjemmesider for landsbyer i Rebild kommune Oversigt: Login Hjemmeside...... side 3 Login Administrationsmodul... side 5 Kategorier.. side 6 Opret/rediger første side...

Læs mere

Vejledning til. LearnSpace

Vejledning til. LearnSpace Vejledning til LearnSpace Version 13. 08. 2015 Indholdsfortegnelse Om LearnSpace... 2 Oprette et nyt kursus i egen afdeling... 3 Aktivere selvtilmelding til et kursus... 5 Tilmelde undervisere der må redigere

Læs mere

Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync

Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync v 0.2 januar 2015 www.gs1.dk/gs1tradesync Indhold Log på... 3 Søg produkter... 4 Hierarkiopbygning... 7 Subskriptioner (Selektioner)

Læs mere

Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync

Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync v 0.1 maj 2014 www.gs1.dk/gs1tradesync Indhold Log på... 3 Søg produkter... 4 Hierarkiopbygning... 7 Subskriptioner (Selektioner)

Læs mere

BørneIntra hjemmesidekursus

BørneIntra hjemmesidekursus BørneIntra hjemmesidekursus hjemmesidekursus Januar 2012 Indhold 1 Introduktion... 5 1.1 Kursets formål... 5 1.2 Hjemmesiden opbygges i PersonaleIntra... 5 2 Hjemmesidens indhold... 6 2.1 Hjemmesidens

Læs mere

Fronter for elever - Første undervisning

Fronter for elever - Første undervisning Fronter for elever - Første undervisning Fronter for elever - Første undervisning 1 Kom godt i gang 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 1.10 1.11 0) Nulstille unilogin i UMS - (Elev) 4 1) Logge på Fronter

Læs mere

Elev-manual til Køreklar e-læring

Elev-manual til Køreklar e-læring Version 2.0 September 2016 Elev-manual til Køreklar e-læring Nyt Juridisk Forlag Gothersgade 137 1123 København K 39 13 55 00 koreklar@koreklar.dk 2 Indhold 1. Første gang du logger dig på Køreklar e-læring...

Læs mere

SDU Assignment - undervisere

SDU Assignment - undervisere SDU Assignment - undervisere SDU Assignment giver mulighed for såvel anonym, som ikke anonym opgaveaflevering. Der kan afleveres flere filer på en gang. De studerende får en kvittering for afleveringen

Læs mere

Sådan opretter du en elektronisk aflevering

Sådan opretter du en elektronisk aflevering Sådan arbejder du med opgaver i Gradebook/karakterbog Denne vejledning indeholder en detaljeret beskrivelse af hvordan du bruger gradebook/karakterbogen når du vil arbejde med opgaver og give karakterer

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Danmarks Tekniske Universitet Side 1 af 9 sider Skriftlig prøve, lørdag den 13. december, 2014 Kursus navn Fysik 1 Kursus nr. 10916 Varighed: 4 timer Tilladte hjælpemidler: Alle tilladte hjælpemidler på

Læs mere

Brug af IT-udstyr ved skriftlig eksamen

Brug af IT-udstyr ved skriftlig eksamen Brug af IT-udstyr ved skriftlig eksamen Ved brug af skolens IT-udstyr til skriftlig eksamen skal du: Medbringe dit UNI-login Oprette sidehoved/-fod til dine dokumenter (skolen har en færdig skabelon, som

Læs mere

En blog med dansk brugerflade. Opret en Smartlog konto Gå til http://www.smartlog.dk/ Opret en konto ved at skrive din e-mailadresse

En blog med dansk brugerflade. Opret en Smartlog konto Gå til http://www.smartlog.dk/ Opret en konto ved at skrive din e-mailadresse Blogs Om blogs http://www.it-borger.dk/den-nye-it-verden/internet/blogs Om at oprette blogs http://www.it-borger.dk/laer-om-it/internet/nar-du-vil-pa-nettet/blogs/sadan-laver-du-en-blog Råd når du laver

Læs mere

Fase Forklaring Navigation. Mappen skal indeholde alle elementer til dit site.

Fase Forklaring Navigation. Mappen skal indeholde alle elementer til dit site. 1 Opstart af et site Opret hovedmappen Opret grafikmappen Opret dit site Mappen skal indeholde alle elementer til dit site. Opret en mappe indeni den første og kald den grafik. Heri lægges alle dine grafikfiler.

Læs mere

Qbrick s krav til video filtyper

Qbrick s krav til video filtyper Indhold Qbrick s krav til video filtyper... 1 Krav til ordningen/området... 1 Qbrick s krav til video leverandør... 1 Video og billede størrelser i WCM:... 1 Upload en video... 2 Trin 1: Mediefiler...

Læs mere

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste 1 Forside Tre sideopsætninger: 1 Forside 2 Standard 3 Liste 2 Underside 3 Liste Ret indhold på en side I systemet kan du let rette tekst, link og billeder på hjemmesiden Først skal du logge ind i systemet

Læs mere

Kursus i EkspresLøn. De syv menupunkter, vi skal bruge i dette kursus, er markeret med rød ring. Tryk..virksomheder i øverste højre hjørne.

Kursus i EkspresLøn. De syv menupunkter, vi skal bruge i dette kursus, er markeret med rød ring. Tryk..virksomheder i øverste højre hjørne. Kursus i EkspresLøn EkspresLøn startes ved at dobbelt-klikke på EkspresLøn-ikonet på skrivebordet:, eller vælge Start Programmer EkspresLøn. Når programmet startes første gang fremkommer dette vindue:

Læs mere

eportfolio på Studienet

eportfolio på Studienet En introduktion til de vigtigste værktøjer og funktioner i eportfolio OBS! Gælder for eportfolio oprettet inden d. 30/8-2013 Sådan anvender du denne vejledning Brug diasshow visning Herved kan du anvende

Læs mere


STADS DANS OPSLAG AF ANSØGNINGER TIL FAGLIG BEHANDLING STADS DANS OPSLAG AF ANSØGNINGER TIL FAGLIG BEHANDLING STADS-DANS Introduktion / Opslag af ansøgninger til faglig behandling Formålet med denne vejledning er at give en enkel anvisning til opslag af studerendes

Læs mere

Redaktørvejledning for www.bredstrup-pjedsted.dk Skriv en artikel

Redaktørvejledning for www.bredstrup-pjedsted.dk Skriv en artikel Arbejdsgang - Skriv artiklens tekst - Gør billeder klar - Log-in på hjemmesiden - Opret ny artikel - Vælg kategori - Skriv overskrift - Indsæt tekst - Tilføj billeder - Gennemgå artiklens indstillinger

Læs mere

FSFIs lynguide til DFRs elektronisk bevissystem

FSFIs lynguide til DFRs elektronisk bevissystem FSFIs lynguide til DFRs elektronisk bevissystem Dette er en kort guide i anvendelsen af Dansk Førstehjælpsråd elektroniske bevissystem. Guiden viser og forklarer hvordan du som instruktør og medlem af

Læs mere

Kom godt i gang med DLBR Webdyr

Kom godt i gang med DLBR Webdyr Kom godt i gang med DLBR Webdyr Kom godt i gang med DLBR Webdyr Udgivet Februar 2011 Redaktør Tryk Videncentret for Landbrug Videncentret for Landbrug Udgiver Videncentret for Landbrug, KvægIT, 8740 5000

Læs mere

Vejledning til effektmåling af Arbejdsmarkedsuddannelser under De systemfælles redskaber www.viskvalitet.dk. - til efteruddannelsesudvalg

Vejledning til effektmåling af Arbejdsmarkedsuddannelser under De systemfælles redskaber www.viskvalitet.dk. - til efteruddannelsesudvalg Vejledning til effektmåling af Arbejdsmarkedsuddannelser under De systemfælles redskaber www.viskvalitet.dk - til efteruddannelsesudvalg November 2005 2 1 Introduktion...5 2 Her finder du adressen på Internettet,

Læs mere

Brugermanual til Assignment Hand In

Brugermanual til Assignment Hand In Brugermanual til Assignment Hand In Indhold: Undervisere:... 2 Hvor finder jeg Assignment hand in?... 2 Opret en opgave... 3 Slet en opgave... 4 Rediger en opgave... 4 Hvor finder jeg de afleverede filer?...

Læs mere

Byg web sider. Introduktion:

Byg web sider. Introduktion: Introduktion: Du kender nu nogle enkle HTML tags, så nu er det på tide, at du kommer i gang med at lave din første side! Når du har nogle HTML-sider klar skal du have dem lagt op, så dine venner kan se

Læs mere

VELKOMMEN 3. KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9

VELKOMMEN 3. KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9 VEJLEDNING 1.0 Indhold VELKOMMEN 3 KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9 SÅDAN OPRETTER DU EN QUIZ 10 Quiz info 11 Tilføj spørgsmål 12 Tilføj formel til

Læs mere

Pralemappen.dk Din online portfolio Brugerhåndbog til elever Brugerhåndbog til elever

Pralemappen.dk Din online portfolio Brugerhåndbog til elever Brugerhåndbog til elever www.pralemappen.dk v5 side 1 af 10 Indholdsfortegnelse Velkommen til din pralemappe 1.1 Introduktion...side 3 1.2 Grundlæggende funktioner...side 3 1.3 Dine data...side 3 1.4 Sidens opbygning...side 4

Læs mere

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et:

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: F2011-Opgave 1. En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: Forward primer: 5 CC ATG GGT ATG AAG CTT TGC AGC CTT

Læs mere

Version august 2012 Side 1 af 7

Version august 2012 Side 1 af 7 Side 1 af 7 Indholdsfortegnelse Indholdsfortegnelse... 2 7. Valgmuligheder ved skriftlige prøver... 3 8.Generelle regler vedrørende skriftlige prøver... 3 9. Specifikke regler vedrørende elektronisk aflevering

Læs mere

Konvertering af DADAS data til Dansk Supermarked VI-skema

Konvertering af DADAS data til Dansk Supermarked VI-skema Konvertering af DADAS data til Dansk Supermarked VI-skema GS1 Denmark Version 5 November 2012 1 Konvertering af DADAS data til alternativt vareindmeldelsesskema Skal man konvertere data fra SINFOS/DADAS

Læs mere

IT-Brugerkursus. Modul 1 - Introduktion til skolens netværk og FC. Modul 1 - Introduktion til FC og Lectio. Printvenligt format. Indholdsfortegnelse

IT-Brugerkursus. Modul 1 - Introduktion til skolens netværk og FC. Modul 1 - Introduktion til FC og Lectio. Printvenligt format. Indholdsfortegnelse Modul 1 - Introduktion til FC og Lectio IT-Brugerkursus Modul 1 - Introduktion til skolens netværk og FC Printvenligt format Indholdsfortegnelse Formål og opbygning Opgave Vejledning til intranettet Åbne

Læs mere

Studienummer: MeDIS Exam 2015. Husk at opgive studienummer ikke navn og cpr.nr. på alle ark, der skal medtages i bedømmelsen

Studienummer: MeDIS Exam 2015. Husk at opgive studienummer ikke navn og cpr.nr. på alle ark, der skal medtages i bedømmelsen MeDIS Exam 2015 Titel på kursus: Uddannelse: Semester: Videregående biokemi og medicinudvikling Bachelor i Medis 5. semester Eksamensdato: 26-01-2015 Tid: kl. 09.00-11.00 Bedømmelsesform 7-trin Vigtige

Læs mere

Protein syntese. return

Protein syntese. return Protein syntese. I artiklen redegøres for principperne i, hvordan octapeptidet SCHTFGDI kan syntetiseres. Som yderligere illustration heraf kan peptidet opbygges og visualiseres i Chem3D-Pro. Herved kan

Læs mere

Patient Database - Manual

Patient Database - Manual Patient Database - Manual Side 1 af 36 Adgang til systemet... 4 Glemt brugernavn og kode... 4 Opret projekt (kun System Administrator)... 6 Klik på NYT PROJEKT -knappen øverst til venstre.... 6 Udfyld

Læs mere

BM121 Resume af tirsdags forlæsningen, Uge 47

BM121 Resume af tirsdags forlæsningen, Uge 47 BM121 Resume af tirsdags forlæsningen, Uge 47 Morten Källberg (kallberg@imada.sdu.dk) 22/11-2005 1 Probabilistiske modeller Vi vil i det følgende betragte to forskellige måder at evaluerer en given model

Læs mere

Installér din Officepakke 2013

Installér din Officepakke 2013 Vær opmærksom på der godt kan forekomme andre billeder end dem som er illustreret. Dette er grundet ændringer fra microsoft. Blandt andet bliver SkyDrive ændret til OneDrive. Er du i tvivl om noget kan

Læs mere

VEJLEDNING ITS365. Gratis tilbud til alle kursister på Randers HF & VUC

VEJLEDNING ITS365. Gratis tilbud til alle kursister på Randers HF & VUC VEJLEDNING ITS365 Gratis tilbud til alle kursister på Randers HF & VUC Randers HF & VUC 2014 INDLEDNING Randers HF & VUC tilbyder alle kursister tilknyttet skolen en Office 365 løsning kaldet ITS365. Her

Læs mere

Mini-guide for opdatering af hjemmesiden for. SOIF www.soif.dk

Mini-guide for opdatering af hjemmesiden for. SOIF www.soif.dk Mini-guide for opdatering af hjemmesiden for SOIF www.soif.dk Senest opdateret: 03-07-2009 Indholdsfortegnelse 2 Indholdsfortegnelse 2 Lidt generelt om KlubCMS 3 Brugere/Brugergrupper 3 Sideopbygning:

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Eksamen 0205, Forår 205 side af 5 Danmarks Tekniske Universitet Skriftlig prøve, den 22. maj 205. Kursusnavn: Algoritmer og datastrukturer Kursusnummer: 0205 Hjælpemidler: Skriftlige hjælpemidler. Det

Læs mere

xgalleri Mulige filtyper Installation web-version

xgalleri Mulige filtyper Installation web-version xgalleri xgalleri opstod ud fra ønsket om at lægge en større samling billeder på nettet. Der findes mange programmer, som kan bruges til at lægge datafiler på nettet; men de fungerer typisk på den måde,

Læs mere

Kom godt i gang med OneDrive

Kom godt i gang med OneDrive Kom godt i gang med OneDrive Office365 er en mulighed for lærere og elever at bruge en office-pakke på egne enheder - man kan downloade det til brug på pc - mac - tablets og smartphones, i alt op til 5

Læs mere

Brugervejledning til InfoLand.dk skabelonen

Brugervejledning til InfoLand.dk skabelonen Indhold Indledning... 4 Første gang... 4 Log ind som Administrator og ændre kodeord... 4 Opret Redaktør (dig selv)... 4 Log ind... 4 Log ind med dit eget brugernavn ( Redaktør )... 4 Log ind som Administrator...

Læs mere

Digital eksamen for studerende

Digital eksamen for studerende Digital eksamen for studerende Indhold Digital eksamen for studerende... 1 Information om eksamen... 1 Eksamenen er i gang... 3 Udfyldelse af besvarelsesinformationer... 4 Upload besvarelse... 5 Sådan

Læs mere

Indhold. Produkter oprettelse og vedligehold v 2.0 23.5.2010 Side 2 af 20

Indhold. Produkter oprettelse og vedligehold v 2.0 23.5.2010 Side 2 af 20 Indhold Introduktion...3 Formål...3 Support...3 0. Systemkrav...4 0.1 Internet browser...4 0.2 PDF Reader...4 0.3 Hvordan tillades pop-up vinduer...4 0.4 Kompatibilitetsvisning i Internet Explorer 8...6

Læs mere

Bioteknologi A. Gymnasiale uddannelser. Vejledende opgavesæt 1. Mandag den 31. maj 2010 kl. 9.40-14.40. 5 timers skriftlig prøve

Bioteknologi A. Gymnasiale uddannelser. Vejledende opgavesæt 1. Mandag den 31. maj 2010 kl. 9.40-14.40. 5 timers skriftlig prøve Vejledende opgavesæt 1 Bioteknologi A Gymnasiale uddannelser 5 timers skriftlig prøve Vejledende opgavesæt 1 Mandag den 31. maj 2010 kl. 9.40-14.40 Side 1 af 8 sider pgave 1. Genmodificeret ris Vitamin

Læs mere

Oversættelse af LibreOffice. Adressen er https://translations.documentfoundation.org/da/

Oversættelse af LibreOffice. Adressen er https://translations.documentfoundation.org/da/ Oversættelse af LibreOffice Adressen er https://translations.documentfoundation.org/da/ Wiki Vi har en wikiside, hvor du kan finde flere oplysninger om Pootle: http://wiki.documentfoundation.org/da/pootle

Læs mere

Karens vejledning til WordPress, september 2014 1

Karens vejledning til WordPress, september 2014 1 Karens vejledning til WordPress, september 2014 1 Karens WordPress vejledning september 2014 INDHOLD Hvad er WordPress 1 Generelt om WordPress 2 Frontend og backend 2 Skrive en blog-tekst (indlæg/post)

Læs mere

WEB kursus I. Grundkursus i CMS

WEB kursus I. Grundkursus i CMS WEB kursus I Grundkursus i CMS 1 Link til manual på intranet: http://intranet.regionsyddanmark.dk/cmsmanual Nyttig information Support telefonnummer: 65 41 32 25 Support e-mail: websupport@regionsyddanmark.dk

Læs mere


BRUGERMANUAL FOR KLUBKOORDINATORER. Version 2.0 BRUGERMANUAL FOR KLUBKOORDINATORER Version 2.0 Login Du skal vælge den klub som du tilhøre og dernæst indtaste din kode i feltet: Password. Regionsgolf-Danmark Administration Når du er logget ind i system

Læs mere

Vejledning til redigering via iserasuaat.gl/typo3 - både frontend og backend

Vejledning til redigering via iserasuaat.gl/typo3 - både frontend og backend Iserasuaat.gl Vejledning til redigering via iserasuaat.gl/typo3 - både frontend og backend Indhold Om kategorier en central del af Iserasuaat... 2 Frontend redigering... 3 Fanen Generelt... 4 Linke til

Læs mere

Den digitale Underviser. DOF deltagernet

Den digitale Underviser. DOF deltagernet Den digitale Underviser DOF deltagernet Sabine Kramer juli 2014 Indhold Kursusindhold... 2 Log ind på Deltagernet, se og rediger dine aktuelle kurser... 3 Skift fra uge- til emneformat... 5 Redigér første

Læs mere

Sådan oprettes. en CRM Online Prøveversion. Kom godt igang 1/15/2013. Jesper Osgaard MICROSOFT DENMARK

Sådan oprettes. en CRM Online Prøveversion. Kom godt igang 1/15/2013. Jesper Osgaard MICROSOFT DENMARK Sådan oprettes 1/15/2013 en CRM Online Prøveversion Kom godt igang Jesper Osgaard MICROSOFT DENMARK Inden du starter Inden du starter skal du have følgende ved hånden En maskine med Internet Explorer Et

Læs mere

Fra Blåt Medlem til Open Office regneark.

Fra Blåt Medlem til Open Office regneark. Fra Blåt Medlem til Open Office regneark. Kopi fra Blåt Medlem til Open Office regneark 1 Eksport fra Blåt Medlem til Open Office regneark 2 Hvad kan du bruge det til 4 Eksempler: Medlemsdelen: Afdelingsopdelt

Læs mere

Brugervejledning. Hjemmesider med Cmsimple.

Brugervejledning. Hjemmesider med Cmsimple. 1af23 Brugervejledning. Hjemmesider med Cmsimple. 1. Forord. Denne brugervejledning er fremstillet for at hjælpe personer ved Lokalhistorisk Arkiver i ny Sønderborg kommune, som kun har ringe kendskab

Læs mere

Installation af DATABOKS online backup manager

Installation af DATABOKS online backup manager Installation af DATABOKS online backup manager For at kunne tage fjern-backup skal du installere en online backup manager på din maskine. Den skal bl.a. bruges til at bestemme hvilke filer, databaser og

Læs mere



Læs mere


Deoxyribonukleinsyre DNAs Forunderlige struktur Ved Rebecca E.-Sørensen stud.scient i medicinalkemi ved Aarhus Universitet Deoxyribonukleinsyre Strukturen af DNA findes af James D. Watson og Francis H. Crick i 1953 1 Nuklein

Læs mere

Vejledning til Næringsbasens prøvesystem for prøvesteder

Vejledning til Næringsbasens prøvesystem for prøvesteder Vejledning til Næringsbasens prøvesystem for prøvesteder Indhold Vejledningen indeholder: Hvor finder du prøvesystemet? Login og andre funktioner for prøvestedet i prøvesystemet Gennemgang af prøveforløb

Læs mere

Brugermanual til MOBI:DO Make på Android

Brugermanual til MOBI:DO Make på Android Brugermanual til MOBI:DO Make på Android Introduktion Med MOBI:DO Make kan du oprette guides, som kan ses i MOBI:DO. En guide virker som en guide der fører brugeren hele vejen igennem en arbejdsopgave.

Læs mere

Gem dine dokumenter i BON s Content Management System (CMS)

Gem dine dokumenter i BON s Content Management System (CMS) 24. august 2007 Gem dine dokumenter i BON s Content Management System (CMS) INDHOLDSFORTEGNELSE 1. Indledning... 2 2. Se indholdet i dit Content Management System... 3 3. Tilgå dokumenterne i My Content

Læs mere

ipad for let øvede, modul 8 Underholdning på ipad Læsning

ipad for let øvede, modul 8 Underholdning på ipad Læsning 23012015AS ipad for let øvede modul 8 Underholdning på ipad Indledning I dette modul vil vi beskæftige os med nogle af de muligheder, der er for at læse på ipad'en. Aviser/dagblade Vi har i modul 2 vist,

Læs mere

Manual til Dynamicweb Februar 2010

Manual til Dynamicweb Februar 2010 Manual til Dynamicweb Februar 2010 Login... 2 Skabeloner og formater... 3 Filarkivet... 4 Lav en PDF... 5 Opret en ny side... 7 Navngiv siden... 9 Aktiver siden... 9 Sorter sider... 9 Flyt siden... 11

Læs mere

Den digitale Underviser. Clouds. Dropbox

Den digitale Underviser. Clouds. Dropbox Den digitale Underviser Clouds Dropbox Indhold Indhold... 1 Dropbox... 1 Installer Dropbox... 2 Åbn Dropbox fra egen computer... 2 Åbn Dropbox fra en anden computer... 3 Lagre filer i Dropbox (offline

Læs mere

Hjemmesiden er opdelt i et sidehoved, en sidefod og mellem disse 3 kolonner: venstre, midterste og højre. Højre kolonne vises dog kun på forsiden.

Hjemmesiden er opdelt i et sidehoved, en sidefod og mellem disse 3 kolonner: venstre, midterste og højre. Højre kolonne vises dog kun på forsiden. Hjemmesiden er opdelt i et sidehoved, en sidefod og mellem disse 3 kolonner: venstre, midterste og højre. Højre kolonne vises dog kun på forsiden. VENSTRE kolonne indeholder flere elementer (se illustration

Læs mere

Brug af IT-udstyr ved skriftlig eksamen

Brug af IT-udstyr ved skriftlig eksamen Brug af IT-udstyr ved skriftlig eksamen Ved brug af skolens IT-udstyr til skriftlig eksamen skal du: Medbringe dit UNI-login Oprette sidehoved/-fod til dine dokumenter (skolen har en færdig skabelon, som

Læs mere



Læs mere

Lav din egen hjemmeside/blog. Dag 1 22-10-2015. Agenda d. 25. oktober 2015. Pc ere på nettet. Præsentation. Hvad er WordPress? Hvad er WordPress?

Lav din egen hjemmeside/blog. Dag 1 22-10-2015. Agenda d. 25. oktober 2015. Pc ere på nettet. Præsentation. Hvad er WordPress? Hvad er WordPress? Agenda d. 25. oktober 2015 Lav din egen hjemmeside/blog Dag 1 Præsentation af underviser og deltagere Pc erepå nettet Hvad er WordPress? Og hvad er forskellen på en blog og en hjemmeside Hej verden Kvik

Læs mere

Vejledning start Test Indberetning i ENAO

Vejledning start Test Indberetning i ENAO Vejledning start Test Indberetning i ENAO Formål Formålet med denne vejledning er at vise hvordan man foretager indberetning af Test indberetning i Energitilsynets nye indberetningssystem, ENergiAnmeldelse

Læs mere