Størrelse: px
Starte visningen fra side:

Download ""

Transkript

1

2 8GE\JQLQJ DI 3DQXP NRPSOHNVHW 990 VFUHHQLQJ 2YHUVLJWVNRUW L PnOHVWRN PHWHU VLGH DI

3 8GE\JQLQJ DI 3DQXP NRPSOHNVHW 990 VFUHHQLQJ.RUWELODJ L PnOHVWRN VLGH DI

4

5

6

7

8

9

10

11

12

13

14

15

16

17

18

19

20

21

22

23 Indkaldelse af ideer og forslag Udbygning af Panum Komplekset April 2011

24 Hvad er VVM? ForkortelsenVVMstårforVurderingafVirkningerpåMiljøet.VVMreglerneforanlægpålandfremgåraf miljøministerietsbekendtgørelseomvurderingafvisseoffentligeogprivateanlægsvirkningpåmiljøet (VVM)imedføraflovomplanlægning,bekendtgørelsenr.1510af15.december2010.Reglernesikrer,at byggeoganlægsprojekter,dermåantagesatkunnepåvirkemiljøetvæsentligt,kunkanrealiseresmed baggrundiensåkaldtvvmredegørelse. FormåletmedVVMredegørelseneratgivedetbedstmuligegrundlagforbådeoffentligdebatogforden endeligebeslutningomprojektetsrealisering. IndenVVMredegørelsenbliverudarbejdet,indkaldesideerogforslagtildetviderearbejde.Detkanf.eks. væreideertilhvilkemiljøpåvirkninger,derskaltillæggessærligvægtogforslagomalternativer. VVMredegørelsenpåviser,beskriverogvurdereranlæggetsdirekteogindirektevirkningerpå: mennesker,faunaogflora jordbund,vand,luft,klimaoglandskab materiellegoderogkulturarv,og samspilletmellemdissefaktorer Redegørelsengiverensamletbeskrivelseafprojektetogdetsmiljøkonsekvenser,somkandannegrundlag forsåvelenoffentligdebatsomdenendeligebeslutningomprojektetsgennemførelse.vvm redegørelsenoffentliggøressammenmedettillægtilkommuneplanen. KommuneplantillæggetogVVMredegørelsenudarbejdesideflestetilfældeafkommunalbestyrelsen.I nogletilfældevaretagermiljøministerietsdecentraleenhednaturstyrelsenroskildeimidlertid opgaven.detgælderbl.a.foranlæg,hvorstatenerbygherreellergodkendendemyndighedefteranden lovgivningellersomkræverplanlægningimereendtokommuner. ForslagtilkommuneplantillægmedVVMredegørelse UdbygningafPanumKomplekset Redaktionoggrafisktilrettelæggelse:NaturstyrelsenRoskilde Udgivetapril2011af NaturstyrelsenRoskilde NyØstergade Roskilde Telefon Kuninternetudgave Copyright KortogMatrikelstyrelsen ISBN: ISBE:

25 Udbygning af Panum Komplekset Indkaldelseafideerogforslag ForslagtilKommuneplantillæg Ikketekniskresume VVMredegørelse Sammenfattenderedegørelse Kommuneplantillæg April2011

26 Baggrund Medbaggrundietønskeomatstyrkeforskningsoguddannelses miljøetpåpanumkomplekset,ønskeruniversitetsogbygningssty relsen,isamarbejdemedkøbenhavnsuniversitet,atudbyggedet eksisterendepanummedlaboratoriefaciliteter,undervisningsfacili teter,auditorierogkantinefaciliteter. PanumerbeliggendepåKøbenhavnsUniversitetsNørreCampus, somudoverdetsundhedsvidenskabeligefakultetrummerenrække andrevidenskabeligefakulteterogvidensinstitutioner.samletbe tegnesområdetvidensbydelnørrecampus.udbygningenskalmed virketilatfremmesynergienmellemvidensinstitutioner,erhvervog byliv. PanumliggerientrekantoggrænsermodvestoptilNørreAlléog DeGamlesBy,modNordøstoptilTagensvejogRigshospitalet,mod sydøstoptilblegdamsvejogboligområderpåindrenørrebroog modsydflankeresarealetafjohanneskirkeogsankthanstorv.

27 Nærværendeindkaldelseafideerogforslagomhandlerudbygnings projektet,somervalgtefterenarkitektkonkurrence.projektetbe skrivesnærmereiafsnit2. Projekteterderudovernærmereomtaltpåhhv.Universitetsog BygningsstyrelsensogKøbenhavnsUniversitetshjemmesider: byggeri/byggeprojekter/udbygningafpanum komplekset/view Påhjemmesidernefindesdesudenkonkurrencematerialet,doku menteromvalgafvinderforslaget,tidsplanerogenrækkeandredo kumenteromprojektet. UniversitetsogBygningsstyrelsenerBygherrepåprojektet,som gennemføresisamarbejdemedkøbenhavnsuniversitet. Dabygherrenerenstatsliginstitution,erdetenandenstatsliginsti tution,naturstyrelsenroskilde,dererdenansvarligevvmmyndig hed. NaturstyrelsenRoskildeharden afgjort,atprojekteter VVMpligtigtpågrundlagafenscreeningsafgørelse.Afgørelsenbe tyder,atdetikkekanudelukkes,atgennemførelsenafprojektetkan påvirkemiljøetvæsentligt. IkonsekvensherafskalNaturstyrelsenudarbejdeenVVM redegørelseogettilhørendekommuneplantillægforprojektet.

28 Projektet EnprojektkonkurrenceomudbygningenafPanumkompleksetblev lanceretijuni2010.konkurrencenblevvundetafetrådgiverteam medarkitektfirmaetc.f.møllerispidsen. Udbygningenkommeroverordnetsettilatomfattefølgende: Enmax75mhøjlaboratoriebygninginklusivekælderpåialt m 2 Indgangsparti,kantineogundervisningsfaciliteterpåca. 5000m 2 Auditorierpåca.1.500m 2 Cykelkælderpåca.1.400m 2 Udbygningenvilbeståafenstjerneformetunderbygning,hvorfra laboratoriebygningenrejsersig.byggerieterstatterdelvist9000m 2 afdeeksisterendebygninger,derrivesnedførbyggerietsættesi gangi2012.

29 Laboratoriebygningenvilfå16etageroverjordenogénkældereta ge.medenhøjdepåmaksimalt75m,vildenfåsammehøjdesom helikopterlandingspladsenpårigshospitaletpådenandensideaf Tagensvej. Dentotalebygningsmassebliverca m 3. Densamledeudbygningforventesatdækkeetarealpå7.500m 2 af densamledepanumgrundpå69.349m 2.Arealerneudenomnybyg gerietvilbliveindrettetsomencampuspark,derforbinderdetnye Panummeddeeksisterendebygningerogdeøvrigeinstitutioneri området.parkenindrettesmedbeplantning,stier,terrasser,cykelsti oggangsti. Byggerietforventesumiddelbartatgenerere600nyearbejdspladser menpåsigtforventesdenendeligekapacitetatendemed900nye arbejdspladser. Derfjernesetantalparkeringspladserogderetablerescykelparke ringflerestederiområdetogiendelafkælderetagenunderlabora toriebygningen. Indretningenafarealerneerfortsatunderplanlægning.Etforeløbigt udkasttilindretningfremgårafnedenståendeoversigtstegning:

30 Udbygningenforventesatståfærdigindenudgangenaf2014. SemereomvinderforslagetpåC.F.Møllershjemmeside: heartofcopenhageni12911.html

31 Miljøpåvirkninger VVMscreeningenharvist,atrealiseringafprojektetkantænkesat medføreenrækkemiljøpåvirkninger,somkanværevæsentlige.dis sebeskriveskortnedenfor Anlægsfasen Byggerietforventesatkunnegennemførespå2,5årframedio2012 tiludgangenaf2014. Detforventesatsærligtnedrivningafeksisterendebygningersamt etableringaffundamentfordetnyebyggerikangiveanledningtil støjgener.støjgenernevilværemidlertidigeogsærligtknyttedetil denførstedelafanlægsfasen. Idenførstedelafanlægsfasenvilderligeledeskunneforekomme anlægsrelateredevibrationer,somkanværegenerendeformenne sker,derborogfærdesiområdet.vibrationervilsærligtforekomme iforbindelsemedetableringaffundamentoggenerneerderfor midlertidige. Bådestøjogvibrationsforårsagendeaktiviteterforventesbegræn settildagtimernepåhverdage. Vibrationerkan,udoveratkunnevirkegenerende,ogsågiveanled ningtil,atsårbarebygningerpåvirkesogslårrevner. Anlægsaktiviteternekanligeledesgiveanledningtilstøvgenerog eventuelttilforøgelseafluftforureningen(bl.a.no x )iområdet. Støvgenerkanforebyggesmedsprinkling.Områdeteralleredebela stetmedluftforureningfraisærtrafik.detekstrabidragframaski nerianlægsfasenkanværemedtilatforstærkeproblemet. Miljøpåvirkningerknyttettilanlægsfasenvilblivenærmereunder søgtogvurderetivvmredegørelsen. Bygningshøjde Laboratoriebygningenvil,medsinhøjdepåmax.75m,kommetilat virkesometmarkantelementiområdetsskyline.bygningenvilvæ

32 redenhøjesteiområdetogvilhavesammehøjdesomrigshospita letshelikopterplatform.byggerietsesiprofilherunder. Udformning,orientering,placering,farveogmaterialevalgvilhave betydningforbygningensbetydningforområdetskarakter.højden kanligeledeshavebetydningforsikkerhedenforhelikopterepå Rigshospitalet,hvisbygningenbliverhøjereendrigshospitalet.Disse forholdbehandlesnærmereivvmredegørelsen. Lys,skyggeogrefleksioner En75mhøjbygningvilkastelængereskyggerenddeeksisterende bygningeriområdet.materialevalg,facon,orienteringogplacering villigeledeshavebetydningforbygningenslysogskyggevirkninger ogeventuellerefleksioner. Bygningensgeometriogfacadens3dimionsionelleopbygningbe grænserrefleksionerogplaceringpågrundensikresdet,atskygge effekterkunrammerarealerudenforpanumsegneikortereperio der.derkanværeskyggegenervedbygningerpågrunden,somder formuligviskanoplevedårligerearbejdsmiljøforholdsomfølgeaf påvirkningen. DisseforholdbelysesnærmereiVVMredegørelsen.

33 Vindforhold Højebygninger,somdenforeslåedelaboratoriebygning,kangive anledningtil,atderdanneskraftigekastevindeogturbulensom kringbygningensbase.nedadgåendeluftstrømmelangsbygningen vilsugesomkringdenshjørnerogkunnegivekraftigevindeherog hvirvelvindemellemdenhøjeogdeomkringliggendelaverebygnin ger.etableringaflæværnogbeplantningerkanværemedtilatbry devindenpåarealerneomkringudbygningen.vindforholdeneun dersøgesnærmereivvmprocessen. Kulturmiljø Dererflerebevaringsværdigebygninger,pladserogkulturmiljøeri områdetidetheletaget,somvilkunnepåvirkesafudbygningenog afdenhøjelaboratoriebygning.johanneskirkenherunder,erénaf områdetsbevaringsværdigebygninger,somhervisualiseressam menmedlaboratoriebygningensetfrasankthanstorv.

34 Udbygningensbetydningforkulturmiljøetundersøgesnærmerei VVMredegørelsen. Arbejdspladser Denyebygningerforventesatrumme600arbejdspladser,hvorafde flesteernyemensenmindredelflyttesfradebygninger,derrives ned.bygningenerforberedttilatkunnerummeoptil900arbejds pladser.detfuldepotentialeforventesikkeatbliveudnyttetiden førsteårrække. Medflerearbejdspladsermedfølgerenøgettrafikmængdeogpres påvejeogkollektivetransportformeriområdet.flerearbejdsplad serkanogsåforventesatmedføreøgetaktivitetforbutikker,restau ranterogcaféeriområdet.konsekvenserneafflerearbejdspladser ogmerefærdseliområdetvilblivenærmerebelystivvmredegø relsen.

35 Miljøvurderingafkommuneplantillægget NaturstyrelsenRoskildeudarbejderetforslagtiletkommuneplantil lægforudbygningensamtidigmed,atarbejdetmedvvmredegørel senfindersted. Ifølgebekendtgørelsenr.936afden24.september2009aflovom miljøvurderingafplanerogprogrammerskalallelovbundneplaner ligeledesmiljøvurderes.kommuneplantillæggetskalsåledesmiljø vurderespåsammemådesomselveudbygningsprojektet. Indenmiljøvurderingenafplanensættesigangskalandreoffentlige myndigheder,somkantænkesatbliveberørtafprojektet,havelej lighedtilatudtalesigomeventuelleforholddekunnetænkesig nærmereundersøgt. Dadereretstortoverlapmellemdetomiljøvurderinger,erdetbe sluttetatdesamlesiénogsammerapport.miljøvurderingenaf plantillæggetvilderforindsættessometsærskiltafsnitidensamle demiljøredegørelseforudbygning. Denneindkaldelseafideerogforslagersåledesenhøringiforhold tilbekendtgørelsenr.936.høringsperiodeneroverensstemmende medindkaldelseafideerogforslagogafsluttesden11.maj2011. Bådeoffentlighedenogeventuellemyndigheder,dervilkunneberø resafudbygningen,fårlejlighedtilatudtalesigomdensamlede miljørapport.

36 Denvidereproces Ideer og forslag Tilbrugfordetviderearbejdemedatvurderevirkningernepåmil jøet,indkaldernaturstyrelsenroskildeforslagogideertil,hvilkemil jøforholdderskalfokuserespåivvmredegørelsen. Viskalhavedineideerogforslagskriftligtibreveller senest den11.maj2011. Forslagogideerskalmærkesmedjournalnummer:NST ogindsendestil: NaturstyrelsenRoskilde NyØstergade Roskilde FlereoplysningerkanfåsafNaturstyrelsenRoskildehos: Denvidereproces Nåridefasenerafsluttet,sammenfatterNaturstyrelsenRoskildede indkomneforslagogdeforhold,dereridentificeretidentidligere VVMscreening,ietscopingnotat,derfastlægger,hvilkemiljøfor holdderskallæggessærligvægtpåidetviderevvmforløb. NaturstyrelsenRoskildevilherefterudarbejdeVVMredegørelse, sombeskriverogvurderermiljøkonsekvenserneafudvidelsenafpa numinstituttet.redegørelsenvilblandtandetvurderestøjogvi brationsforholdianlægsfasen,vindforhold,lysogskyggeforhold samtpåvirkningenafdeeksisterendebyrum,områdetskarakterog samspilletmeddebevaringsværdigebygningeriområdet.dertil kommereventuelleforholdsombringespåbaneniløbetafidefa sen.

37 Tidsplan Denvidereprocesvilforløbeefterplanenbeskrevetiskemaetne denfor: 2011 AKTIVITET mar apr maj jun jul aug sep okt nov dec Oplægidéfase x Indkaldelseafideerogforslag 4uger Udarbejdelseafscopingnotat x x x VVMredegørelse Forslagtilkommuneplantillæg ogvvmtilladelse Miljøvurderingaf Kommuneplantillæg Offentlighøring8uger x x (x) x x x x x x Sammenfattenderedegørelse (udarbejdes) KommenteringiKøbenhavns Kommune x x EndeligVVMtilladelseog Kommuneplantillæg(udste x delse) RetningsgivendetidsplanforVVMprocesseniforbindelsemedudbygningenaf PanumKomplekse

38 Deltag i debatten Husk Anfør venligst navn og adresse på brevet samt j.nr. NST Der er flere oplysninger om projektet på Naturstyrelsens hjemmeside Miljøministeriet Naturstyrelsen Ny Østergade Roskilde Telefon

39

40 Udbygning af Panum-komplekset Rammetidsplan Id Opgavenavn Startdato Slut Varighed 1 Myndighedsforhold (plan- og byggemyndigheder) ma to dage 2 Kommuneplantillæg med VVM og SMV ma fr dage 3 Screening af projektet ma fr dage 4 Idéfase: offentlighøring, myndighedsinput og scooping ma fr dage 5 Udarbejdelse af VVM og SMV ma fr dage 6 Udarbejdelse af kommuneplantillæg ma fr dage 7 Offentlighøring af kommuneplantillæg med VVM og SMV ma fr dage 8 Sammenfattende redegørelse, høring af forslag i KK og udstedelse af KT. ma fr dage 9 Ny Lokalplan ma fr dage 10 Startredegørelse ma fr dage 11 Internhøring - lokaludvalgene, andre kommunale instanser, Bymuseet m.fl. ma fr dage 12 Udarbejdelse af lokalplanforslag ma fr dage 13 Lokalplanforslaget i offentlig høring ma fr dage 14 Eventuelle ændringsforslag på baggrund af høringssvar ma fr dage 15 Endelig vedtagelse af lokalplanen ma fr dage 16 Godkendt lokalplan fr fr dage 17 Myndighedsbehandling og byggetilladelser ma fr dage 18 Ibrugtagningstilladelse ma to dage Mobilisering af brugere og projektkonkurrencen to ma dage 21 Mobilisering af brugerorganisation ma ma dage 22 Projektkonkurrence fase 1 to ti dage 23 Eventuel projektkonkurrence fase 2 on ma dage 24 Stand-still periode ti ma dage Byggeprogram ti to dage 27 Afrunding af program til endeligt byggeprogram ti fr dage 28 TR-modtager mundtlig/skriftligt feedback fr fr dage 29 TR-opretter BP ma ma dage 30 TR-modtager detaljeret skriftlige kommentarer ma ma dage 31 Løbende fremsendelse af kapitler fra BP til BHG/brugerne ma fr dage 32 TR aflevering af byggeprogram og rumskemaer on on dage 33 Endelig bygherre godkendelse to to dage 34 Bygherregodkendelse ma fr dage 35 Styregruppemøde - Vibrationer/Svingninger ma ma dage 36 Styregruppemøde nr. 5 - helhedsplan VVM mv. ti ti dage 37 Styregruppemøde nr. 6 - godkendelse af byggeprogram fr fr dage Dispositionsforslag ti ma dage 40 Dispositionsforslag (arealer, kvalitet, materialer, funktionalitet) ti fr dage 41 Økonomisk overslag (baseret på bygningsdele) ti fr dage 42 Bygherregodkendelse fr ma dage Projektforslag ma fr dage 45 Projektforslag ma fr dage 46 Økonomisk overslag (baseret på bygningsdele) ma fr dage 47 Bygherregodkendelse to ma dage 48 Folketingets behandling af aktstykket fr fr dage Projektering, udbudsmateriale og udbud ma fr dage 51 Projekt/udbudsmat. - midlertidig kantine og andre interims faciliteter ma fr dage 52 Projekt/udbudsmat. - oprensing af grund, ledninger, nedrivn. af bygn. 1 og 9 ma fr dage 53 Projekt/udbudsmat. - byggegrube fr fr dage 54 Myndighedsprojekt ma fr dage 55 Bygherregodkendelse ma fr dage 56 Hovedprojekt (detail og udbudsmateriale) ma fr dage 57 Bygherregodkendelse ma fr dage 58 Entrepriseudbud - midlertidig kantine og øvrige interims faciliteter ma fr dage 59 Entrepriseudbud - oprensing af grund, ledninger, nedrivn. af pavillion, bygn. 1 og 9 fr to dage 60 Entrepriseudbud - byggegrube ma fr dage 61 Entrepriseudbud i fag-/storentrepriser - bygning ma fr dage Udførelse ti on dage 64 Myndigheder - Nye tilkørselsanlæg, forsyninger, ledninger mv. ma ti dage 65 Etablering af midlertidig kantine og øvrige interims faciliteter ma fr dage 66 Oprensning af grund, ledninger og nedrivning - pavillion, bygning 1 og 9 ma fr dage 67 Byggegrube ma to dage 68 Bygning - fag/storentrepriser fr ma dage 69 Aflevering / overdragelse til bygherre fr fr dag 70 Mangelafhjælpning ma ma dage 71 Commissioning ti ma dage 72 Indflytning ma ti dage 73 Ibrugtagning ma ma dag 74 Idriftssætning og entreprenør drift over 2 år ma on dage 75 Overdragelse af driften til lejer to on dage M J J A S O N D J F M A M J J A S O N D J F M A M J J A S O N D J F M A M J J A S O N D J F M A M J J A S O N D J F M A M J J A S O N D J F M A M J J A S O N D J Projektkonkurrence Projektkonkurrence - Fase 2 UBST Midlertidige faciliteter, nedrivnings-, grave- og hovedbyggetilladelse Aktstykke - VIGTIGT - lokalplan skal være godkendt inden behandling af aktstykke Licitation og kontrahering - midlertidig kantine og øvrige interims faciliteter Licitation og kontrahering - oprensing af grund, ledninger og nedrivning af pavillion, bygning 1 og 9 Licitation og kontrahering - byggegrube Licitation og kontrahering - bygning Myndighedsarbejder Midlertidig kantine og øvrige interims faciliteter Oprensning af grund, ledninger og nedrivning - bygning 1 og 9 Byggegrube Ibrugtagningstilladelse Aflevering - sidste entreprise Mangelafhjælpning Ibrugtagning NOTE; Varighed er angivet i arbejdsdage Forkortelser: MYN - Myndigheder, BHR - Bygherre, TR - Totalrådgiver, ENT - Fag- eller storentreprenør

41 Panum tårn max 83.5 Helikopterplatform Rigshospitalet Eksisterende Panum Terræn 8.7 Indgang 8.7 Grundvand 3.5 Kælder Sankt Johannes Kirke Kollegie Tagensvej Park Juliane Maries Vej Rigshospitalet Rigshospitalet

42 KONKURRENCEPROGRAM Projektkonkurrence om udbygning af Panum-komplekset Juni 2010 COMPETITION BRIEF Project competition for the extension of the Panum complex June 2010

43 0 Forord Invitation Vision Introduktion til Det Sundhedsvidenskabelige Fakultet Konkurrenceforudsætninger Området Det eksisterende Panum-kompleks Planforhold Trafikale forhold Kunstnerisk udsmykning Tilgængelighed Energi Bygningsarealnøgletal Økonomi Rammetidsplan Opgaven Byggeopgave Helhedsplan By-arkitektoniske intentioner Byggeriets udtryk og funktion Flow- og transportveje - mellem nyt og eksisterende Panum Særlige temaer i relation til opgaven Fremtidens forskningsmiljøer Fleksibilitet og foranderlighed Energi og bæredygtighed Byggeri i højden Summarisk vejledende rumprogram Laboratorieudvidelsen Kantine, undervisningslokale og auditorium Konkurrencetekniske betingelser Konkurrenceform og deltagere Konkurrencens sekretær Konkurrencematerialet Forespørgsler Konkurrenceforslagets indhold Forslagets udførelse og omfang Indlevering Jury Bedømmelseskriterier Bedømmelsens afvikling Vederlag Udstilling af forslagene Rettigheder Forsikring... 90

44 0 Preface Invitation Vision Introduction to the Faculty of Health Sciences Competition Prerequisites Area The Existing Panum Complex Planning Conditions Traffic Conditions Artistic Decoration Accessibility Energy Building Area Key Figures Finances Framework Time Schedule The Objective Construction Objective Master Plan Urban Architectural Intentions Building Expression and Function Flow and Transport Routes Between New and Existing Panum Special Themes in Relation to the Objective The Research Environments of the Future Flexibility and Changeability Energy and Sustainability High-rise Construction Summary of the Suggested Room Programme Laboratory Extension Canteen, Classroom and Lecture Hall Technical Competition Terms and Conditions Competition Form and Competitors Competition Secretary Competition Material Enquiries Contents of the Competition Proposal Contents and Execution of the Competition Proposal Delivery Jury Assessment Criteria Assessment Process Fee Exhibition of Proposals Rights Insurance... 90

45 Forord Preface Etableringen af nye forskningsfaciliteter på Panum skal danne rammen om et unikt centrum for international og sundhedsvidenskabelig vidensproduktion i verdensklasse midt i København. Det er en drøm, der kan realiseres. Det Sundhedsvidenskabelige Fakultets forskning er nemlig inde i en positiv udvikling. Fakultetet har de seneste år haft stor succes med at tiltrække offentlige og private midler. Det betyder, at fakultetet kan tiltrække topforskere fra hele verden, hvilket vil bidrage til at fastholde og tiltrække yderligere talentmasse og bevillinger til København. Ved at samle spydspidser fra det eksisterende Panum med stærke internationale kræfter skal forskerne i fællesskab skabe vigtige resultater til gavn for sundhedsvidenskaben. Men der er behov for flere og bedre laboratoriefaciliteter. Derfor skal Panum udbygges. I de nye laboratoriefaciliteter skal der være fokus på grundforskning, hvilket giver mulighed for at etablere nye platforme for translationel, tværdisciplinær og international forskning. Udbygningen af Panum-komplekset er af stor betydning: > Nye laboratoriefaciliteter giver mulighed for at modtage flere bevillinger og etablere nye centre, som bidrager til at tiltrække flere dygtige forskere. Møder mellem forskere i verdensklasse skaber nye resultater i verdensklasse. Samtidig vil nye bevillinger resultere i ny og bedre forskning, udvikling og innovation i Danmark. > Udvidelsen af de fysiske rammer giver i højere grad Københavns Universitet mulighed for at indbyde partnere udefra til nye samarbejder. The establishment of new research facilities at Panum shall create the setting for a unique centre for world-class international health science knowledge production in the heart of Copenhagen. It is a dream that can be realised. The Faculty of Health Sciences research is experiencing very positive development. In recent years, the Faculty has succeeded in obtaining both public and private funding. This means that the Faculty is able to attract top researchers from across the world, to retaining and attracting further talents and grants to Copenhagen. By uniting spearheads from the existing Panum with strong international capacities, researchers will create important results for the benefit of health sciences and the society. However, more and better laboratory facilities are needed. This is why Panum is to be extended. In the new laboratory facilities, focus will be on basic research, which will make it possible to establish new platforms for translational and interdisciplinary research. The extension of the Panum complex is of great significance: > New laboratory facilities open provide the possibility of receiving more grants and establishing new centres, which will help attract more qualified researchers. Encounters between world-class researchers will create world-class results. New grants will also result in new and better research, development and innovation in Denmark. > The extension of the physical framework will radically improve the University of Copenhagen s options for inviting partners 3

46 UDBYGNING AF PANUM-KOMPLEKSET EXTENSION OF THE PANUM COMPLEX De kan få plads midt i det akademiske miljø og nye møder og interaktion skaber innovation. Når Københavns Universitet åbner sig for eksterne partnere, kan grundforskningens resultater formidles til den anvendte forskning og kan dermed bedre omsættes til klinisk brug, nye produkter og virksomheder. > Øget internationalisering i form af tiltrækning af frontforskere fra hele verden vil løfte niveauet for dansk biomedicinsk forskning og uddannelse. Forskningen vil blive tilført global forskningskultur, videndeling og nye globale netværk, og forskerstuderende og kandidater fra SUND vil blive dygtigere og bredere fagligt funderet. Det primære sigte med udbygningen af Panum er at få nye effektive og tidssvarende laboratoriefaciliteter. Den nye udbygning vil ikke blot løfte eksisterende forskningsmiljøer, men også sikre, at universitetet fremover kan tiltrække og huse den globale elite, som skaber fremtidens vækst og fornyelse. Derudover skal udbygningen fremme samspillet med omverdenen og den omkringliggende by. Universitetet er en central vidensbærer, som skal dele ud af sin viden. Synliggørelse af universitetets aktiviteter bidrager til at vække interesse for viden, forskning og uddannelse og til at tiltrække dygtige studerende samt forskningsmidler, samtidig med at byen og bylivet omkring Panum vil blive tilført værdi. from outside to join in collaboration. They can be given space in the midst of an academic environment and new meetings and interaction will create innovation. When the University of Copenhagen opens up to external partners, the results of basic research can be developed into applied research and thus better be converted into clinical use, new products and enterprises. > Increased internationalisation through the engagement of frontline researchers from across the world will raise the level of Danish biomedical research and education. Research will be enriched by a global research culture, knowledge sharing and new global networks, and research students and graduates from SUND (the Faculty of Health Sciences) will become more proficient and gain a wider academic foundation. The primary objective of the Panum extension is to achieve new, efficient and modern laboratory facilities. The new extension will not only lift existing research environments, but also ensure that in the future, the University will be able to attract and house the global elite that creates growth and renewal. Furthermore, the extension is to further the interplay with the immediate surroundings and the city. The University is a pivotal carrier of knowledge, which must share its expertise. By rendering its activities visible, the University contributes to arousing interest in knowledge, research and education and to attracting competent students and research funds, while at the same time, the city and urban life around Panum gain new value. Jens Peter Jacobsen Direktør Universitets- og Bygningsstyrelsen Jens Peter Jacobsen University Director Danish U niversity and Property Agency Ralf Hemmingsen Rektor Københavns Universitet Ralf Hemmingsen Rector University of Copenhagen 4

47 Invitation Invitation KU s bygninger i Nørre Campus The University of Copenhagen s buildings at North Campus Universitets- og Bygningsstyrelsen indbyder i samarbejde med Københavns Universitet de prækvalificerede rådgivergrupper til at deltage i projektkonkurrencen om udbygning af Panum-komplekset på Indre Nørrebro i København. Konkurrencen omfatter forslag til: > m 2 biomedicinske laboratoriefaciliteter og fællesfunktioner > m 2 kantine og undervisningsfaciliteter > m 2 auditorier. The Danish University and Property Agency in collaboration with the University of Copenhagen invites the prequalified consultants to participate in the project competition for the extension of the Panum complex at the Inner Nørrebro district of Copenhagen. The competition comprises proposals for: > 30,000 m 2 biomedical laboratory facilities and common functions > 3,500 m 2 canteen and classroom facilities > 1,500 m 2 lecture halls. 5

48 LERSØPARKEN TA G EN SV EJ PLADS E BYV J L PARKA VE GA DE DS GA RK AN R SI DE TETSPARKEN KJELDS SK SKT. KT T.. K SKT KJE KJ ELDS LDS PLADS PL ADS EFELL E ER OCK CKEF KEF ELLL LLER ROCKEFELLER SET OMPLEKSET MPLEKS KOMPLEKSET FREDRIK BAJERS PLADS NS NUM PANUM GE TA LD NØRRE ALLÉ VE J DE SKT. HANS TORV SRS UNIV UNI IV VERSITETS UNIVERSITETSP PAR ARKEN PARKEN LÉ CO BIS MA TA G EN S VE J E GAD ESØ ARR NS LL GU GA NØ R RE BR OG AD E BE RG S DE GAMLES BY SJÆ FE UN I VIBENSHUS GADE TEG ALDERSRO LV RUNDDEL Æ RK SG VIBEKEVANG AD GSV P KRA ÆNG E BISKO E VE RM U N DS GA DE FO G E DM AR KE N 1: km BIO CE NT ER ON PROFES ON PROFESSIONSSKO KOLEN HØJSKOLEN METROP OP METROPOL SIGURDSGADE DE HARALDSGADE KVARTERET M I ME RS GA DE NØRREBROS NØRREB NØRRE RE EBR EBROS RUNDDEL RU RUND ND DDE D DDEL L G LYN 500m AL LÉ VEJ JAGT ØS TE R V S VE J FÆLLEDPARKEN FR ED ER IK PT RIGSHOSP IGSHOSPITALET RIGSHOSPITALET BR O FR E D EN SB RO CAM CIT TY CAMPUS CAM AMPUS P CITY ALLEN LLEN LEN EN ØBRO-HALLEN HALLE NU RN GUNNAR GU UNNAR SENS PLADS HANSENS PARKEN STADION BRUMLEBY SØ TRIANGLEN EN N S AM ED RT SO The master plan should include a plan for the layout of the entire competition area with the new facilities, creation of an open space and landscape > A master plan for the competition area. In addition, the competition comprises proposals for: The laboratory extension is the primary construction object. The canteen and classroom facilities as well as the lecture halls should be designed in a way that makes it possible to establish them in independent stages. DR ON N I N GL OU ISE S ØSTERBROGADE LERSØ 100m STATIO NØRREBRO STAT S O STATION TATI NØRREB N EBRO 0 CAMPUS FREDER DERIKSBERG IKS IKSB ERG US FREDERIKSBERG DERIKSBE IKSBERG BE ERG CAMPUS Konkurrencen omfatter derudover forslag til: > Helhedsplan for konkurrenceområdet. Helhedsplanen skal anvise en samlet disponering af konkurrenceområdet med de nye faciliteter, pladsdannelse og landskabelig bearbejdning af udearealer. Helhedsplanen skal dels understøtte E AD TV JAG Laboratorie-udvidelsen er den primære byggeopgave. Kantine- og undervisningsfaciliteter samt auditorierne skal udformes på en måde, som gør det muligt at opføre dem i uafhængige etaper. Kort over Vidensinstitutionerne Map of the knowledge institutions 6 DO SS ER IN G SO RT ED AM ØG RS TE ØS BL EG DA M SV EJ BL EG DA M SV EJ SO RT ED AM SS Ø HE NR IK NØRRE ALLÉ BO RG M ES TE R JE HA NS RP EN ES S AL TR LÉ EN GS VE J NØRRE ALLÉ GA DE JAG TV EJ E DE AD REFSNÆSG E AD SG AD E SG EJ FÆLL EDVE J RÅ TITANGADE E DM AN DS GA DE RG S BE LD GU OR TH HA RA LD EJ TV JAG

KONKURRENCEPROGRAM. Projektkonkurrence om udbygning af Panum-komplekset Juni 2010 COMPETITION BRIEF

KONKURRENCEPROGRAM. Projektkonkurrence om udbygning af Panum-komplekset Juni 2010 COMPETITION BRIEF KONKURRENCEPROGRAM Projektkonkurrence om udbygning af Panum-komplekset Juni 2010 COMPETITION BRIEF Project competition for the extension of the Panum complex June 2010 0 Forord 3 1 Invitation 5 11 Vision

Læs mere

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov.

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. På dansk/in Danish: Aarhus d. 10. januar 2013/ the 10 th of January 2013 Kære alle Chefer i MUS-regi! Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. Og

Læs mere

With AARHUS. Hvilken rolle spiller TRÆ i fremtidens Aarhus? Dansk Træforening

With AARHUS. Hvilken rolle spiller TRÆ i fremtidens Aarhus? Dansk Træforening With AARHUS Hvilken rolle spiller TRÆ i fremtidens Aarhus? Dansk Træforening Stadsarkitekt Stephen Willacy 28. maj 2015 Bæredygtighed 360 Miljø Social/samfund - Økonomi Business Region AARHUS GOVERNANCE

Læs mere

Experience. Knowledge. Business. Across media and regions.

Experience. Knowledge. Business. Across media and regions. Experience. Knowledge. Business. Across media and regions. 1 SPOT Music. Film. Interactive. Velkommen. Program. - Introduktion - Formål og muligheder - Målgruppen - Udfordringerne vi har identificeret

Læs mere

From innovation to market

From innovation to market Nupark Accelerace From innovation to market Public money Accelerace VC Private Equity Stock market Available capital BA 2 What is Nupark Accelerace Hands-on investment and business developmentprograms

Læs mere

New Hospital & New Psychiatry Bispebjerg

New Hospital & New Psychiatry Bispebjerg The Bispebjerg Construction Project EUHPN, October 2012 Hospital plan for the Capital Region A major restructuring project of the Danish hospital structure is now taking place. Each of the 5 regions develops

Læs mere

Tal og tabeller Facts and Figures

Tal og tabeller Facts and Figures SYDDANSK UNIVERSITET UNIVERSITY OF SOUTHERN DENMARK Telefon phone: +45 6550 1000 sdu@sdu.dk www.sdu.dk Tal og tabeller Facts and Figures 2015 S Y D D A N S K U N I V E R S I T E T UNIVERSITY OF SOUTHERN

Læs mere

Sport for the elderly

Sport for the elderly Sport for the elderly - Teenagers of the future Play the Game 2013 Aarhus, 29 October 2013 Ditte Toft Danish Institute for Sports Studies +45 3266 1037 ditte.toft@idan.dk A growing group in the population

Læs mere

Procuring sustainable refurbishment

Procuring sustainable refurbishment SURE den 21. marts 2012 Procuring sustainable refurbishment Niels-Arne Jensen, Copenhagen City Properties (KEjd) Copenhagen Municipality KOMMUNE 1 Agenda About Copenhagen City Properties Background and

Læs mere

TA BUSSEN - LINIE 888 - HURTIGT BILLIGT BEHAGELIGT NEMT KØBENHAVN SILKEBORG ÅRHUS THISTED AALBORG KUN 120 KR. til Århus og Silkeborg. Aalborg og Thisted kun 140 kr. Ovenstående priser er for studerende

Læs mere

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen. og

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen.  og 052431_EngelskD 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau D www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com.

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com. 052430_EngelskC 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau C www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Small Autonomous Devices in civil Engineering. Uses and requirements. By Peter H. Møller Rambøll

Small Autonomous Devices in civil Engineering. Uses and requirements. By Peter H. Møller Rambøll Small Autonomous Devices in civil Engineering Uses and requirements By Peter H. Møller Rambøll BACKGROUND My Background 20+ years within evaluation of condition and renovation of concrete structures Last

Læs mere

VIDENSBYDEL NØRRE CAMPUS KØBENHAVN UDVIKLINGSPLAN 2011 2020. VIDEN ER I BYEN for At SKABE VæKSt

VIDENSBYDEL NØRRE CAMPUS KØBENHAVN UDVIKLINGSPLAN 2011 2020. VIDEN ER I BYEN for At SKABE VæKSt VIDENSBYDEL NØRRE CAMPUS KØBENHAVN UDVIKLINGSPLAN 2011 2020 VIDEN ER I BYEN for At SKABE VæKSt HARALDSGADEKVARTERET Jagtvej UNIVERSITETS- PARKEN Nørre Allé FÆLLEDPARKEN Det Farmaceutiske Fakultet Det Naturvidenskabelige

Læs mere

YDERST PRÆSENTABELT KONTOR MED BYGGERET TIL LOGISTIK/LAGER Bredebjergvej 1, 2630 Taastrup Sag 132443 (NIT)

YDERST PRÆSENTABELT KONTOR MED BYGGERET TIL LOGISTIK/LAGER Bredebjergvej 1, 2630 Taastrup Sag 132443 (NIT) YDERST PRÆSENTABELT KONTOR MED BYGGERET TIL LOGISTIK/LAGER Bredebjergvej 1, 2630 Taastrup Sag 132443 (NIT) BELIGGENHED Byggeret til ca. 12.000 m² logistik/lager Rigtig god infrastruktur med 15-20 minutter

Læs mere

Bilag. Resume. Side 1 af 12

Bilag. Resume. Side 1 af 12 Bilag Resume I denne opgave, lægges der fokus på unge og ensomhed gennem sociale medier. Vi har i denne opgave valgt at benytte Facebook som det sociale medie vi ligger fokus på, da det er det største

Læs mere

SiteCover Supplying fair weather for the construct ionindust ry

SiteCover Supplying fair weather for the construct ionindust ry SiteCover Supplying fair weather for the construct ionindust ry SiteCover Præsentation Erfaring med at rejse kapital Lessons learned SiteCover Supplying fair weather for the construct ionindust ry When

Læs mere

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet. ATEX direktivet Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.dk tlf: 7220 2693 Vedligeholdelse af Certifikater / tekniske dossier / overensstemmelseserklæringen.

Læs mere

ARKITEKTUR KUNST. - En udvidelse af KUNSTEN - Museum of Modern Art Aalborg

ARKITEKTUR KUNST. - En udvidelse af KUNSTEN - Museum of Modern Art Aalborg ARKITEKTUR KUNST - En udvidelse af KUNSTEN - Museum of Modern Art Aalborg Præsentation. Arkitektur og Design. 2009 Aalborg Universitet. Arkitektur Ba5-9 Camilla Ulfkjær Ammitzbøll Dorte Skou Lauge Andersen

Læs mere

DONG Energy. Photobook

DONG Energy. Photobook DONG Energy Photobook DA Om Duba-B8 Duba-B8 A/S er blandt de førende i norden indenfor totalindretning af kontormiljøer. Vores indretningskoncepter er skræddersyede og bygger på rådgivning og analyse af

Læs mere

Managing stakeholders on major projects. - Learnings from Odense Letbane. Benthe Vestergård Communication director Odense Letbane P/S

Managing stakeholders on major projects. - Learnings from Odense Letbane. Benthe Vestergård Communication director Odense Letbane P/S Managing stakeholders on major projects - Learnings from Odense Letbane Benthe Vestergård Communication director Odense Letbane P/S Light Rail Day, Bergen 15 November 2016 Slide om Odense Nedenstående

Læs mere

YDERST PRÆSENTABEL EJENDOM MED BYGGERET TIL YDERLIGERE OP TIL M² KONTOR/PRODUKTION/LAGER Bredebjergvej 1, 2630 Taastrup Sag (NIT)

YDERST PRÆSENTABEL EJENDOM MED BYGGERET TIL YDERLIGERE OP TIL M² KONTOR/PRODUKTION/LAGER Bredebjergvej 1, 2630 Taastrup Sag (NIT) YDERST PRÆSENTABEL EJENDOM MED BYGGERET TIL YDERLIGERE OP TIL 12.000 M² KONTOR/PRODUKTION/LAGER Bredebjergvej 1, 2630 Taastrup Sag 132443 (NIT) BELIGGENHED Rigtig god infrastruktur med 15-20 minutter

Læs mere

Rødsand laboratoriet et samarbejde mellem KU, Femern & DHI

Rødsand laboratoriet et samarbejde mellem KU, Femern & DHI Rødsand laboratoriet et samarbejde mellem KU, Femern & DHI Ulrik Lumborg DHI Rødsand laboratoriet I 2012 var det erkendt at Rødsand lagune ville være et fokusområde i forbindelse med etableringen af Femernforbindelsen

Læs mere

Den uddannede har viden om: Den uddannede kan:

Den uddannede har viden om: Den uddannede kan: Den uddannede har viden om: Den uddannede kan: Den uddannede kan: Den studerende har udviklingsbaseret viden om og forståelse for Den studerende kan Den studerende kan Den studerende har udviklingsbaseret

Læs mere

New Nordic Food 2010-2014

New Nordic Food 2010-2014 New Nordic Food 2010-2014 Mads Randbøll Wolff Senior adviser Nordic Council of Ministers New Nordic Food The questions for today concerning New Nordic Food: - What is the goal for New Nordic Food? - How

Læs mere

Elite sports stadium requirements - views from Danish municipalities

Elite sports stadium requirements - views from Danish municipalities Elite sports stadium requirements - views from Danish municipalities JENS ALM Ph.d. student Malmö University jens.alm@mah.se Analyst Danish Institute for Sports Studies jens.alm@idan.dk Background Definitions

Læs mere

Develop, showcase and export Nordic innovative solutions for liveable, smart and sustainable cities.

Develop, showcase and export Nordic innovative solutions for liveable, smart and sustainable cities. Develop, showcase and export Nordic innovative solutions for liveable, smart and sustainable cities. Rapid Urbanization! Between 2014 and 2050 India is projected to add 404 million urban dwellers and China

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Tilmeldingerne til 2013 I dag nåede vi op på 77 tilmeldte både. Det er lidt lavere end samme tidspunkt sidste år. Til gengæld er det glædeligt,

Læs mere

Vor mission er at udvikle og forbedre vore kunders produkter ved at levere smags- og funktionelle ingredienser.

Vor mission er at udvikle og forbedre vore kunders produkter ved at levere smags- og funktionelle ingredienser. dk uk grundlagt i 1988 Kiranto Foods A/S blev grundlagt i 1988 af nuværende ejer og administrerende direktør Anders Toft. Ét enkelt agentur samt mange års viden og erfaring fra levnedsmiddelsektoren var

Læs mere

COMPACT CITY OG BÆREKRAFT

COMPACT CITY OG BÆREKRAFT NORSK PLANMØTE 2010 COMPACT CITY OG BÆREKRAFT HVOR TETT VIL VI BO? JENS KVORNING PROFESSOR CENTER FOR BYPLANLÆGNING KUNSTAKADEMIETS ARKITEKTSKOLE KØBENHAVN TÆTHED FYSISK TÆTHED EN FORUDSÆTNING FOR BÆREDYGTIGHED

Læs mere

Statistical information form the Danish EPC database - use for the building stock model in Denmark

Statistical information form the Danish EPC database - use for the building stock model in Denmark Statistical information form the Danish EPC database - use for the building stock model in Denmark Kim B. Wittchen Danish Building Research Institute, SBi AALBORG UNIVERSITY Certification of buildings

Læs mere

Vejledning til brugen af bybrandet

Vejledning til brugen af bybrandet Vejledning til brugen af bybrandet Indhold Hvorfor bruge bybrandet? s. 3-4 Inspiration/ big idea s. 5-10 Syv former for bybranding s. 11-18 Brug af logoet s. 19-21 Find desuden flere cases, designelementer

Læs mere

Sikkerhed & Revision 2013

Sikkerhed & Revision 2013 Sikkerhed & Revision 2013 Samarbejde mellem intern revisor og ekstern revisor - og ISA 610 v/ Dorthe Tolborg Regional Chief Auditor, Codan Group og formand for IIA DK RSA REPRESENTATION WORLD WIDE 300

Læs mere

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen Øjnene, der ser - sanseintegration eller ADHD Professionshøjskolen UCC, Psykomotorikuddannelsen Professionsbachelorprojekt i afspændingspædagogik og psykomotorik af: Anne Marie Thureby Horn Sfp o623 Vejleder:

Læs mere

SOLENERGIDAGEN 2005 Integration of Architectural Values in the Solar Cells of Tomorrow

SOLENERGIDAGEN 2005 Integration of Architectural Values in the Solar Cells of Tomorrow SOLENERGIDAGEN 2005 Integration of Architectural Values in the Solar Cells of Tomorrow Ellen Kathrine Hansen Assiciate Professor, Architect The Aarhus School of Architecture Research project, solar cells

Læs mere

Baltic Development Forum

Baltic Development Forum Baltic Development Forum 1 Intelligent Water Management in Cities and Companies developing and implementing innovative solutions to help achieve this objective. Hans-Martin Friis Møller Market and Development

Læs mere

Semco Maritime - Vækst under vanskelige vilkår. Offshoredag 2009 Vice President Hans-Peter Jørgensen

Semco Maritime - Vækst under vanskelige vilkår. Offshoredag 2009 Vice President Hans-Peter Jørgensen Semco Maritime - Vækst under vanskelige vilkår Offshoredag 2009 Vice President Hans-Peter Jørgensen Agenda Semco Maritime forretningen Vækst via internationalisering Fremtidig vækststrategi Konsekvenser

Læs mere

Agenda. Hvad er Smart City og hvem er aktørerne? Udfordringer. Muligheder

Agenda. Hvad er Smart City og hvem er aktørerne? Udfordringer. Muligheder Smart City i et energimæssigt perspektiv Frank Elefsen, Teknologichef Teknologisk Institut Agenda Hvad er Smart City og hvem er aktørerne? Udfordringer Muligheder Hvad er Smart City? Definition fra European

Læs mere

Trolling Master Bornholm 2015

Trolling Master Bornholm 2015 Trolling Master Bornholm 2015 (English version further down) Sæsonen er ved at komme i omdrejninger. Her er det John Eriksen fra Nexø med 95 cm og en kontrolleret vægt på 11,8 kg fanget på østkysten af

Læs mere

Der var engang 70érne avn i 80érne industrien flytter København i 00 erne opsving København i 00érne København i 2009 Cop 15 København 2010 København 2010 Klimatilpasningsplanen København The Copenhagen

Læs mere

FLOTTE LYSE STORRUMSKONTORER I KREATIVT MILJØ Slotsgade 2, 1., 2200 København N Sag 13701A (TG)

FLOTTE LYSE STORRUMSKONTORER I KREATIVT MILJØ Slotsgade 2, 1., 2200 København N Sag 13701A (TG) FLOTTE LYSE STORRUMSKONTORER I KREATIVT MILJØ Slotsgade 2, 1., 2200 København N Sag 13701A (TG) BELIGGENHED DK Kreativt miljø på Nørrebro med gåafstand til indre by. Området udmærker sig ved de mange

Læs mere

VPN VEJLEDNING TIL MAC

VPN VEJLEDNING TIL MAC VPN VEJLEDNING TIL MAC MAC OS X 1 VPN VEJLEDNING TIL MAC Formålet med en VPN forbindelse er, at du kan tilgå nogle af Aarhus Universitets services hjemmefra, som ellers kun er tilgængelige, når du er på

Læs mere

KONTOR MED MULIGHED FOR LAGER/LOGISTIK Litauen Alle 4, 2630 Taastrup Sag 73159 (NIT)

KONTOR MED MULIGHED FOR LAGER/LOGISTIK Litauen Alle 4, 2630 Taastrup Sag 73159 (NIT) KONTOR MED MULIGHED FOR LAGER/LOGISTIK Litauen Alle 4, 2630 Taastrup Sag 73159 (NIT) BELIGGENHED DK Optimal placering i Taastrup, med kort afstand til Høje Taastrup Station samt City2. Der kører busser

Læs mere

EFFEKTIVT OG MODERNE KONTORHUS Thurahs Alle 2, 2630 Taastrup Sag 162131 (AW)

EFFEKTIVT OG MODERNE KONTORHUS Thurahs Alle 2, 2630 Taastrup Sag 162131 (AW) EFFEKTIVT OG MODERNE KONTORHUS Thurahs Alle 2, 2630 Taastrup Sag 162131 (AW) BELIGGENHED Ejendommen får en central placering i Høje Taastrup med blot 450 meter til Høje Taastrup Station DK Høje Taastrup

Læs mere

KONTORLEJEMÅL MED UDSIGT OVER H.C. ØRSTEDSPARKEN Nørre Farimagsgade 11, 3. th. & 3. tv., 1364 København K Sag 99773 (NRL)

KONTORLEJEMÅL MED UDSIGT OVER H.C. ØRSTEDSPARKEN Nørre Farimagsgade 11, 3. th. & 3. tv., 1364 København K Sag 99773 (NRL) KONTORLEJEMÅL MED UDSIGT OVER H.C. ØRSTEDSPARKEN Nørre Farimagsgade 11, 3. th. & 3. tv., 1364 København K Sag 99773 (NRL) BELIGGENHED DK Herskabelig ejendom på hjørnet af Nørre Farimagsgade og Turesensgade.

Læs mere

Appendix 1: Interview guide Maria og Kristian Lundgaard-Karlshøj, Ausumgaard

Appendix 1: Interview guide Maria og Kristian Lundgaard-Karlshøj, Ausumgaard Appendix 1: Interview guide Maria og Kristian Lundgaard-Karlshøj, Ausumgaard Fortæl om Ausumgaard s historie Der er hele tiden snak om værdier, men hvad er det for nogle værdier? uddyb forklar definer

Læs mere

LANDSCAPE SPRAWL. Marie Markman, billedkunstner, cand.hort.arch., ph.d.

LANDSCAPE SPRAWL. Marie Markman, billedkunstner, cand.hort.arch., ph.d. LANDSCAPE SPRAWL Marie Markman, billedkunstner, cand.hort.arch., ph.d. LANDSKABSSPREDNING Marie Markman, billedkunstner, cand.hort.arch., ph.d. I Center for Strategisk Byforskning har vi de sidste 10 år

Læs mere

Trolling Master Bornholm 2015

Trolling Master Bornholm 2015 Trolling Master Bornholm 2015 (English version further down) Panorama billede fra starten den første dag i 2014 Michael Koldtoft fra Trolling Centrum har brugt lidt tid på at arbejde med billederne fra

Læs mere

US AARH. Generelle oplysninger. Studie på Aarhus Universitet: MA Cognitive Semiotics. Navn på universitet i udlandet: Tartu University.

US AARH. Generelle oplysninger. Studie på Aarhus Universitet: MA Cognitive Semiotics. Navn på universitet i udlandet: Tartu University. US AARH Generelle oplysninger Studie på Aarhus Universitet: MA Cognitive Semiotics Navn på universitet i udlandet: Tartu University Land: Estonia Periode: Fra: 02.2012 Til: 06.2012 Udvekslingsprogram:

Læs mere

Shared space - mellem vision og realitet. - Lyngby Idrætsby som case

Shared space - mellem vision og realitet. - Lyngby Idrætsby som case Downloaded from orbit.dtu.dk on: Jan 27, 2017 Shared space - mellem vision og realitet. - Lyngby Idrætsby som case Brinkø, Rikke Publication date: 2015 Document Version Peer-review version Link to publication

Læs mere

Prioritering eller ej? Hvad er Konsekvensen? Jens Winther Jensen. Lægeforeningen

Prioritering eller ej? Hvad er Konsekvensen? Jens Winther Jensen. Lægeforeningen Prioritering eller ej? Hvad er Konsekvensen? Jens Winther Jensen Søren Kierkegaard Ikke at prioritere er også en prioritering! Offentligt sundhedsvæsen Politisk ledelse Demokratisk prioritering (ideal

Læs mere

Strategic Capital ApS has requested Danionics A/S to make the following announcement prior to the annual general meeting on 23 April 2013:

Strategic Capital ApS has requested Danionics A/S to make the following announcement prior to the annual general meeting on 23 April 2013: Copenhagen, 23 April 2013 Announcement No. 9/2013 Danionics A/S Dr. Tværgade 9, 1. DK 1302 Copenhagen K, Denmark Tel: +45 88 91 98 70 Fax: +45 88 91 98 01 E-mail: investor@danionics.dk Website: www.danionics.dk

Læs mere

KONTORHUSET KASTRUP ATRIUM Skøjtevej 27, 2770 Kastrup Sag (HT)

KONTORHUSET KASTRUP ATRIUM Skøjtevej 27, 2770 Kastrup Sag (HT) KONTORHUSET KASTRUP ATRIUM Skøjtevej 27, 2770 Kastrup Sag 169633 (HT) BELIGGENHED DK Domicilmulighed tæt på motorvej, Metro, og lufthavnen Området byder på hyggelig fiskehavn, frokostrestauranter, Den

Læs mere

BUTIK, KAFFEBAR ELLER CAFE. Nørrebrogade 45A, 2200 København N Sag 163791R (HT)

BUTIK, KAFFEBAR ELLER CAFE. Nørrebrogade 45A, 2200 København N Sag 163791R (HT) BUTIK, KAFFEBAR ELLER CAFE Nørrebrogade 45A, 2200 København N Sag 163791R (HT) BELIGGENHED Ejendommen er beliggende på hjørnet af Nørrebrogade/Stengade i et af Københavns mest trendy områder med kaffebarer,

Læs mere

LIEBHAVERI I SMUKT PAKHUS Strandgade 4, 1401 København K Sag 138281 (NIT)

LIEBHAVERI I SMUKT PAKHUS Strandgade 4, 1401 København K Sag 138281 (NIT) LIEBHAVERI I SMUKT PAKHUS Strandgade 4, 1401 København K Sag 138281 (NIT) BELIGGENHED Ejendommen har en yderst central beliggenhed med ca. 300 meter til Metrostationen Kort og nem afstand til måde City

Læs mere

"HUSET VED SØEN" - KONTOR- HUS MED LÆKRE FÆLLESFACI- LITETER Bregnerødvej 144, 3460 Birkerød Sag 13564 (NIT)

HUSET VED SØEN - KONTOR- HUS MED LÆKRE FÆLLESFACI- LITETER Bregnerødvej 144, 3460 Birkerød Sag 13564 (NIT) "HUSET VED SØEN" - KONTOR- HUS MED LÆKRE FÆLLESFACI- LITETER Bregnerødvej 144, 3460 Birkerød Sag 13564 (NIT) BELIGGENHED DK Beliggende i attraktivt erhvervsområde i Birkerød tæt ved motorvej. Ejendommen

Læs mere

Decommissioning Development Project in Esbjerg. Foredrag hos Skibsteknisk Selskab By Peter Blach, Offshore Center Danmark

Decommissioning Development Project in Esbjerg. Foredrag hos Skibsteknisk Selskab By Peter Blach, Offshore Center Danmark Decommissioning Development Project in Esbjerg Foredrag hos Skibsteknisk Selskab By Peter Blach, Offshore Center Danmark 1 Background More than 7000 off-shore constructions world wide More than 600 off-shore

Læs mere

Institut for Datalogi

Institut for Datalogi Institut for Datalogi Instituttet underviser og forsker frem til højeste internationale niveau og har et omfattende samarbejde med erhvervslivet. Et uafhængigt internationalt evalueringspanel har placeret

Læs mere

Flag s on the move Gijon Spain - March 2010. Money makes the world go round How to encourage viable private investment

Flag s on the move Gijon Spain - March 2010. Money makes the world go round How to encourage viable private investment Flag s on the move Gijon Spain - March 2010 Money makes the world go round How to encourage viable private investment Local action groups in fisheries areas of Denmark Nordfyn The organization of FLAG

Læs mere

Trolling Master Bornholm 2014

Trolling Master Bornholm 2014 Trolling Master Bornholm 2014 (English version further down) Den ny havn i Tejn Havn Bornholms Regionskommune er gået i gang med at udvide Tejn Havn, og det er med til at gøre det muligt, at vi kan være

Læs mere

Improving data services by creating a question database. Nanna Floor Clausen Danish Data Archives

Improving data services by creating a question database. Nanna Floor Clausen Danish Data Archives Improving data services by creating a question database Nanna Floor Clausen Danish Data Archives Background Pressure on the students Decrease in response rates The users want more Why a question database?

Læs mere

Tender Package 10 pre-description

Tender Package 10 pre-description Tender Package 10 pre-description August 2012 Banedanmark Amerika Plads 15 2100 København Ø www.banedanmark.dk Content Page TENDER PACKAGE TP 10 VESTVOLDEN 4 General description of TP 10 4 List of 5 List

Læs mere

Eksempel på eksamensspørgsmål til caseeksamen

Eksempel på eksamensspørgsmål til caseeksamen Eksempel på eksamensspørgsmål til caseeksamen Engelsk niveau E, TIVOLI 2004/2005: in a British traveller s magazine. Make an advertisement presenting Tivoli as an amusement park. In your advertisement,

Læs mere

Kompetence opbygning til bæredygtighed i FM. INNObyg Susanne Balslev Nielsen 12 November 2014

Kompetence opbygning til bæredygtighed i FM. INNObyg Susanne Balslev Nielsen 12 November 2014 Kompetence opbygning til bæredygtighed i FM INNObyg Susanne Balslev Nielsen 12 November 2014 Helhed og livsfaser Center for Facilities Management Åbning i 2008 Realdania: 25 mio. DKK til projekter opbygning

Læs mere

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus Developing a tool for searching and learning - the potential of an enriched end user thesaurus The domain study Focus area The domain of EU EU as a practical oriented domain and not as a scientific domain.

Læs mere

KONTOR OG LAGER TIL LAV LEJE Telegrafvej 5, 2750 Ballerup Sag (sk)

KONTOR OG LAGER TIL LAV LEJE Telegrafvej 5, 2750 Ballerup Sag (sk) KONTOR OG LAGER TIL LAV LEJE Telegrafvej 5, 2750 Ballerup Sag 140651 (sk) BELIGGENHED Dynamisk erhvervsområde i Ballerup DK Gode tilkørselsforhold og tæt på motorvejsnet og Ring 4 10 min. gang til busforbindelser

Læs mere

Medinddragelse af patienter i forskningsprocessen. Hanne Konradsen Lektor, Karolinska Institutet Stockholm

Medinddragelse af patienter i forskningsprocessen. Hanne Konradsen Lektor, Karolinska Institutet Stockholm Medinddragelse af patienter i forskningsprocessen Hanne Konradsen Lektor, Karolinska Institutet Stockholm Værdi eller politisk korrekt (formentlig krav i fremtidige fondsansøgninger) Hurtigere, effektivere,

Læs mere

GUIDE TIL BREVSKRIVNING

GUIDE TIL BREVSKRIVNING GUIDE TIL BREVSKRIVNING APPELBREVE Formålet med at skrive et appelbrev er at få modtageren til at overholde menneskerettighederne. Det er en god idé at lægge vægt på modtagerens forpligtelser over for

Læs mere

Byg din informationsarkitektur ud fra en velafprøvet forståelsesramme The Open Group Architecture Framework (TOGAF)

Byg din informationsarkitektur ud fra en velafprøvet forståelsesramme The Open Group Architecture Framework (TOGAF) Byg din informationsarkitektur ud fra en velafprøvet forståelsesramme The Open Group Framework (TOGAF) Otto Madsen Director of Enterprise Agenda TOGAF og informationsarkitektur på 30 min 1. Introduktion

Læs mere

Trolling Master Bornholm 2016 Nyhedsbrev nr. 7

Trolling Master Bornholm 2016 Nyhedsbrev nr. 7 Trolling Master Bornholm 2016 Nyhedsbrev nr. 7 English version further down Så var det omsider fiskevejr En af dem, der kom på vandet i en af hullerne, mellem den hårde vestenvind var Lejf K. Pedersen,

Læs mere

ATTRAKTIV BELIGGENHED I FULDT UDSTYRET EJENDOM UDLEJES I SAMARBEJDE MED SADOLIN & ALBÆK Sydvestvej 15, 3., 2600 Glostrup Sag 126672 (TG)

ATTRAKTIV BELIGGENHED I FULDT UDSTYRET EJENDOM UDLEJES I SAMARBEJDE MED SADOLIN & ALBÆK Sydvestvej 15, 3., 2600 Glostrup Sag 126672 (TG) ATTRAKTIV BELIGGENHED I FULDT UDSTYRET EJENDOM UDLEJES I SAMARBEJDE MED SADOLIN & ALBÆK Sydvestvej 15, 3., 2600 Glostrup Sag 126672 (TG) BELIGGENHED Ejendommen er nabo til Glostrup Station med kun 15

Læs mere

KALK- OG TEGLVÆRKSFORENINGEN. CPR Sustainable Construction

KALK- OG TEGLVÆRKSFORENINGEN. CPR Sustainable Construction CPR Sustainable Construction 1 Tommy Bisgaard - Direktør i Kalk- og Teglværksforeningen - Formand for DS 417 (CEN TC350 & 351) - Formand for miljøkomiteen i TBE & CU (keramiske industrier i Europa) - Medlem

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Tilmeldingen åbner om to uger Mandag den 3. december kl. 8.00 åbner tilmeldingen til Trolling Master Bornholm 2013. Vi har flere tilmeldinger

Læs mere

Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling

Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling Venka Simovska Katrine Dahl Madsen Lone Lindegaard Nordin Forskning i sundhedsfremmende og bæredygtig

Læs mere

MOMSFRIT KONTOR MIDT I PULSERENDE BYLIV Slotsgade 2, 5. th., 2200 København N Sag 13701 (TG)

MOMSFRIT KONTOR MIDT I PULSERENDE BYLIV Slotsgade 2, 5. th., 2200 København N Sag 13701 (TG) MOMSFRIT KONTOR MIDT I PULSERENDE BYLIV Slotsgade 2, 5. th., 2200 København N Sag 13701 (TG) BELIGGENHED DK Beliggende i ungt og kreativt miljø på Nørrebro. Området udmærker sig ved de mange hyggelige

Læs mere

I henhol til informationen givet i tryksagen Nationalt testcenter for vindmøller i Østerild Klitplantage fremsender undertegnede følgende forslag:

I henhol til informationen givet i tryksagen Nationalt testcenter for vindmøller i Østerild Klitplantage fremsender undertegnede følgende forslag: Page 1 of 2 Hansen, Gitte Fra: Brøndum, Jette Sendt: 19. oktober 2009 13:34 Til: 'chris@jorgensen.com' Cc: Brøndum, Jette Emne: VS: Testcenter til vindmøller Niels Christian Jørgensen: Forslag Opførelse

Læs mere

ENESTÅENDE LEJEMÅL I SMUK PARK Baunegårdsvej 73, 2900 Hellerup Sag (CG)

ENESTÅENDE LEJEMÅL I SMUK PARK Baunegårdsvej 73, 2900 Hellerup Sag (CG) ENESTÅENDE LEJEMÅL I SMUK PARK Baunegårdsvej 73, 2900 Hellerup Sag 13441 (CG) BELIGGENHED DK Midt i Hellerups flotte villakvarter er der nu en enestående mulighed for at leje sig ind i et yderst charmerende

Læs mere

Design til digitale kommunikationsplatforme-f2013

Design til digitale kommunikationsplatforme-f2013 E-travellbook Design til digitale kommunikationsplatforme-f2013 ITU 22.05.2013 Dreamers Lana Grunwald - svetlana.grunwald@gmail.com Iya Murash-Millo - iyam@itu.dk Hiwa Mansurbeg - hiwm@itu.dk Jørgen K.

Læs mere

CDIO CONCEIVE, DESIGN, IMPLEMENT, OPERATE - ELLER - UDDANNELSE PÅ INGENIØROMRÅDET

CDIO CONCEIVE, DESIGN, IMPLEMENT, OPERATE - ELLER - UDDANNELSE PÅ INGENIØROMRÅDET 22. NOVEMBER 2012 CDIO CONCEIVE, DESIGN, IMPLEMENT, OPERATE - ELLER - UDDANNELSE PÅ INGENIØROMRÅDET JENS BENNEDSEN INGENIØRDOCENT, LEDER CDL CDL cdio Dev lab HVORFOR? Personlige og sociale kompetencer

Læs mere

Forslag til implementering af ResearcherID og ORCID på SCIENCE

Forslag til implementering af ResearcherID og ORCID på SCIENCE SCIENCE Forskningsdokumentation Forslag til implementering af ResearcherID og ORCID på SCIENCE SFU 12.03.14 Forslag til implementering af ResearcherID og ORCID på SCIENCE Hvad er WoS s ResearcherID? Hvad

Læs mere

148 M² LAGER/ARKIV Rahbeks Alle 21, kld., 1801 Frederiksberg C Sag (AW)

148 M² LAGER/ARKIV Rahbeks Alle 21, kld., 1801 Frederiksberg C Sag (AW) 148 M² LAGER/ARKIV Rahbeks Alle 21, kld., 1801 Frederiksberg C Sag 129617 (AW) BELIGGENHED DK Lokalerne er beliggende i idylliske omgivelser på Rahbeks Alle, en rolig sidegade til Vesterbrogade, med Søndermarken

Læs mere

SHOWROOM / GALLERI / FOTOSTUDIE / LAGER / ARKIV VED KONGENS HAVE Sølvgade 38E, kld., 1307 København K Sag 107159 (NRL)

SHOWROOM / GALLERI / FOTOSTUDIE / LAGER / ARKIV VED KONGENS HAVE Sølvgade 38E, kld., 1307 København K Sag 107159 (NRL) SHOWROOM / GALLERI / FOTOSTUDIE / LAGER / ARKIV VED KONGENS HAVE Sølvgade 38E, kld., 1307 København K Sag 107159 (NRL) BELIGGENHED DK Lejemålet er beliggende ved Kongens Have nær Frederiksstaden og Indre

Læs mere

USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION

USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION P E R H E I S E L BERG I N S T I T U T F OR BYGGERI OG A N L Æ G BEREGNEDE OG FAKTISKE FORBRUG I BOLIGER Fra SBi rapport 2016:09

Læs mere

LEJEMÅL VED S-TOG OG ADGANG TIL TAGTERRASSE Torveporten 2, 2500 Valby Sag (TG)

LEJEMÅL VED S-TOG OG ADGANG TIL TAGTERRASSE Torveporten 2, 2500 Valby Sag (TG) LEJEMÅL VED S-TOG OG ADGANG TIL TAGTERRASSE Torveporten 2, 2500 Valby Sag 124943 (TG) BELIGGENHED Attraktiv "upcoming" beliggenhed tæt på Ny Ellebjerg Station, der ombygges til at blive en af Københavns

Læs mere

Shoppingcenter Field s Copenhagen Title Fashion is cool. Attitude is everything City / Country Copenhagen / Denmark Categori C Advertising

Shoppingcenter Field s Copenhagen Title Fashion is cool. Attitude is everything City / Country Copenhagen / Denmark Categori C Advertising Shoppingcenter Field s Copenhagen Title Fashion is cool. Attitude is everything City / Country Copenhagen / Denmark Categori C Advertising Campaign idea The fashion campaign was based on a celebration

Læs mere

Aktivering af Survey funktionalitet

Aktivering af Survey funktionalitet Surveys i REDCap REDCap gør det muligt at eksponere ét eller flere instrumenter som et survey (spørgeskema) som derefter kan udfyldes direkte af patienten eller forsøgspersonen over internettet. Dette

Læs mere

Hvad er Asset Management

Hvad er Asset Management Hvad er Asset Management 1 Klaus Rosendal Head of the Water Department Grontmij Denmark M : +45 2723 6645 E: Klaus.Rosendal@grontmij.dk Javier Serrano Alonso Technical Director Grontmij UK M : +44 7738

Læs mere

Historien om en ikonisk vase

Historien om en ikonisk vase Varekatalog 2016 ...tilbage til de danske hjem Historien om en ikonisk vase Lyngby by Hilfling er en dansk virksomhed, der genopdager og genskaber brugskunst fra vores fælles skandinaviske designarv og

Læs mere

KONTORLEJEMÅL I BALLERUP ERHVERVSPARK Telegrafvej 8-10, 2750 Ballerup Sag (sk)

KONTORLEJEMÅL I BALLERUP ERHVERVSPARK Telegrafvej 8-10, 2750 Ballerup Sag (sk) KONTORLEJEMÅL I BALLERUP ERHVERVSPARK Telegrafvej 8-10, 2750 Ballerup Sag 84349 (sk) BELIGGENHED Ejendom beliggende i Ballerup Erhvervspark DK Rigtig gode tilkørselsforhold Ejendom er indhegnet Ca. 1.200

Læs mere

The effects of occupant behaviour on energy consumption in buildings

The effects of occupant behaviour on energy consumption in buildings The effects of occupant behaviour on energy consumption in buildings Rune Vinther Andersen, Ph.D. International Centre for Indoor Environment and Energy Baggrund 40 % af USA's samlede energiforbrug sker

Læs mere

DK - Quick Text Translation. HEYYER Net Promoter System Magento extension

DK - Quick Text Translation. HEYYER Net Promoter System Magento extension DK - Quick Text Translation HEYYER Net Promoter System Magento extension Version 1.0 15-11-2013 HEYYER / Email Templates Invitation Email Template Invitation Email English Dansk Title Invitation Email

Læs mere

LABORATORIER & CAMPUS MILJØ fokus på de fysiske rammer for fremtidens universiteter

LABORATORIER & CAMPUS MILJØ fokus på de fysiske rammer for fremtidens universiteter LABORATORIER & CAMPUS MILJØ fokus på de fysiske rammer for fremtidens universiteter Den særlige oplevelse Freie Universitätm, Berlin Den særlige oplevelse Salk Institute, San Diego, US > læringsrum Den

Læs mere

Agenda Subject Time Status Annex Comments

Agenda Subject Time Status Annex Comments Board Meeting - Draft Agenda Wednesday, January, 30 th From 15.00 to 20.00 19.30: Dinner Agenda 1, Annex 01 Agenda Subject Time Status Annex Comments 1. Welcome and approval of the agenda 15.00 15.10 01

Læs mere

Betina Simonsen Man. Director Development Centre UMT the secretariat of.

Betina Simonsen Man. Director Development Centre UMT the secretariat of. Betina Simonsen Man. Director Development Centre UMT the secretariat of Lifestyle & Design Cluster 2 min. background: -A cluster since 2002, originally for wood and furniture -Merge into lifestyle and

Læs mere

FOKUSGRUPPE TYSKLAND. LOGSTOR Claus Brun

FOKUSGRUPPE TYSKLAND. LOGSTOR Claus Brun FOKUSGRUPPE TYSKLAND LOGSTOR Claus Brun Market overview Customer Segments Contractors End User Consulting Engineer 60% of turnover Main Focus: 1. Price 2. Delivery performance 3. Product Quality 25% of

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Trolling Master Bornholm 2013 Husk at tjekke jeres reservationer! Vi ved, at der er nogen, som har lavet reservationer af overnatning, og at

Læs mere

Totally Integrated Automation. Totally Integrated Automation sætter standarden for produktivitet.

Totally Integrated Automation. Totally Integrated Automation sætter standarden for produktivitet. Totally Integrated Automation Totally Integrated Automation sætter standarden for produktivitet. Bæredygtighed sikrer konkurrenceevnen på markedet og udnytter potentialerne optimalt. Totally Integrated

Læs mere

MODERNE KONTOREJENDOM I ATTRAKTIVT OMRÅDE Lautruphøj 5-7, 2750 Ballerup Sag 13639 (NIT)

MODERNE KONTOREJENDOM I ATTRAKTIVT OMRÅDE Lautruphøj 5-7, 2750 Ballerup Sag 13639 (NIT) MODERNE KONTOREJENDOM I ATTRAKTIVT OMRÅDE Lautruphøj 5-7, 2750 Ballerup Sag 13639 (NIT) BELIGGENHED DK Ejendommen er beliggende i et meget attraktivt og veludbygget erhvervsområde i Ballerup Kommune blot

Læs mere

ACADEMIC EDUCATION TO PROFESSIONS WITH A BACHELOR DEGREE - EXIT FROM OR BACK TO WORK AS HEALTH PROFESSIONAL

ACADEMIC EDUCATION TO PROFESSIONS WITH A BACHELOR DEGREE - EXIT FROM OR BACK TO WORK AS HEALTH PROFESSIONAL til Passata Light ACADEMIC EDUCATION TO PROFESSIONS WITH A BACHELOR DEGREE - EXIT FROM OR BACK TO WORK AS HEALTH PROFESSIONAL Berit Eika, professor, MD, Ph.D. r 2. linje i overskriften til Passata Light

Læs mere

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen The X Factor Målgruppe 7-10 klasse & ungdomsuddannelser Engelskundervisningen Læringsmål Eleven kan give sammenhængende fremstillinger på basis af indhentede informationer Eleven har viden om at søge og

Læs mere