ET KLINISK PERSPEKTIV PÅ REUMATOID ARTRITIS

Save this PDF as:
 WORD  PNG  TXT  JPG

Størrelse: px
Starte visningen fra side:

Download "ET KLINISK PERSPEKTIV PÅ REUMATOID ARTRITIS"

Transkript

1 ET KLINISK PERSPEKTIV PÅ REUMATOID ARTRITIS HERUNDER ANVENDELSEN AF MASSESPEKTROMETRI SOM EN NY DIAGNOSTISK METODE Udarbejdet af projektgruppe 629c: Sarah Maïken Delaire Lea Graakjær Mette Pedersen Hanna Bjarkhamar Poulsen 6. semester medicin, Aalborg Universitet 23. april 2014

2 TITELBLAD Afdeling for School Of Medicine and Health på Aalborg Universitet Titel: Et Klinisk Perspektiv på Reumatoid Artritis herunder Anvendelsen af Massespektrometri som en ny Diagnostisk Metode Projektperiode: 01/02 23/ Uddannelse: Gruppe: Medicin, 6. semester 629c Sidetal: 104 Appendix: 52 Anslag: Vejleder: Allan Stensballe Michael Kruse Olesen Projektgruppens deltagere: Dato Sarah Maïken Delaire Dato Lea Graakjær Dato Mette Pedersen Dato Hanna Bjarkhamar Poulsen Abstract Rheumatoid Arthritis (RA) is a chronic inflammatory disease which leads to the destruction of joints. The global prevalence of the disease is %, which makes it a major challenge for the society. Additionally, the disease can decrease the quality of life due to the severe systemic comorbidities. Currently, the cellular mechanisms and the cause of RA are not fully understood, but a series of risk factors, which include genetic factors, infections and smoking, are known to have an impact on the progression of the disease. In order to inhibit the progression, treatments have been developed, but the disease remains incurable. It has been proven crucial to initiate the treatment as soon as possible in order to reduce the severe consequences of a progressive RA. Therefore, early diagnosis is of great importance and in order to do so, it was essential to gain further knowledge of the underlying mechanisms in RA. The aim of the study was to investigate the current diagnostic methods and the potential of mass spectrometry as a method contributing to the improvement of the diagnosis of RA. In order to achieve this, a clinical method and an experimental method were conducted. In the clinical method, two patients from Sygehus Vendsyssel have been examined. Using the classification criteria of RA by the American College of Rheumatology, it was determined if the patient could be diagnosed with RA. One patient fulfilled the criteria. The intention of the experimental method was to compare the proteins in the inflammatory cells from an RA patient with a healthy individual by using mass spectrometry. Unfortunately, this was not possible due to the lack of results. Instead, the proteins of the different inflammatory cells were compared. It was possible to identify specific cell surface markers from macrophages, T helper cells, cytotoxic T cells and B cells. A specific cell surface marker from the Natural Killer cells was not to be found. To demonstrate the up regulation or down regulation in protein expression, the project sought to compare the expression of TNF-α-induced protein 2 in different inflammatory cell types and the expression of Pro-IL-16 in different inflammatory cell types. Conclusively, mass spectrometry has a great potential in the diagnosis of RA, but further investigations are required to establish this potential. Side 1 af 104

3 LÆSEVEJLEDNING Kildehenvisninger er anført med forfatter og udgivelsesår. Står referencen før et punktum, refererer kilden til den aktuelle sætning. Hvis kilden står efter et punktum, refererer kilden til det pågældende afsnit. Alle kilder er samlet i kildelisten, som kan findes bagest i rapporten. Der er vedlagt et appendix, som der henvises til gennem opgaven. Alle billeder, tegninger og grafer er angivet som figurer, mens tabeller er angivet som tabeller. Der henvises til figurer og tabeller i teksten, og disse er nummeret i kronologisk rækkefølge, i forhold til hvilket afsnit de tilhører. Nogle figurer er modificeret med inspiration fra illustrationer i artikler og/eller lærebøger. Figurens indhold er forklaret kort under den respektive figur, og kilden er efterfølgende angivet. Afsnittene er nummereret fra 1 til 12 og underafsnittene efter princippet 1.1, 1.2 osv. Desuden vil der i opgaven blive anvendt forkortelser. De mest anvendte forkortelser angives i parentes, når de anvendes første gang, eksempelvis reumatoid artritis (RA). Alle forkortelser er arrangeret i alfabetisk rækkefølge på efterfølgende side. Side 2 af 104

4 FORKORTELSER AC Alternating Current (Vekselstrøm) ACPA Anti-Citrullinated Protein Antibody ACR American College of Rheumatology ADAMTS A Disentegrin And Metalloprotease with Thrombospondin motifs APC Antigenpræsenterende Celle BSA Bovine Serum Albumin LC- MS/MS CD (f.eks. CD4) i.m. Intramuskulært PIP-led Proximal Interphalangealled IFN-γ Interferon-γ RA Reumatoid Artritis IgM-RF Immunoglobulin M- Reumafaktor RF Reumafaktor IL (f.eks. Interleukin RPMI Roswell Park Memorial IL-1) Institute IP1-led Interphalangeal 1-led SDC Sodium Deoxy-Cholate Liquid Chromatography- Tandem Mass Spectrometry SDS Cluster of Differentiation LFN Leflunomid SDS- PAGE Sodium Dodecyl Sulfat Sodium Dodecyl Sulfat- Polyacrylamid Gelelektroforese CRP C-Reaktivt Protein MCP-led Metacarpophalangealled SFZ Sulfasalazin DC Direct Current M-CSF Macrophage-Colony SR Sænkningsreaktion (Jævnstrøm) Stimulating Factor DMARDs Disease-Modifying MHC Major Histocompatibility Tc-celle Cytotoksisk T-celle Antirheumatic Drugs Complex DTT Dithiothreitol MMP Matrix Metalloproteinase TCEP Tris(2- carboxyethyl)phosphine EDTA Ethylene-Diamine-Tetra- MS Massespektrometri TCR T-celle Receptor Acetic acid ESI Elektrospray Ionisering MTP-led Metatarsophalangealled TFA Trifluoroacetic Acid FASP Filter-Aided Sample Preparation MTX Methotrexat TGF-β Transforming Growth Factor-β FGF Fibroblast Growth Factor m/z Masse/ladning Th-celle Hjælper T-celle Gel-MS Gelelektroforese- Massespektrometri NCBI- Blast National Center for Biotechnology Information-Blast TNF (f.eks. TNF-α) Tumor Necrosis Factor GM-CSF Granulocyte/Macrophag e-colony Stimulating Factor Higher-Energy Collisional Dissociation-celle NK-celle Natural Killer-celle TNFSF11 Tumor Necrosis Factor Super Family 11 HCD-celle NSAIDs Non-Steroidal Anti- TNFSF11R Tumor Necrosis Factor Inflammatory Drugs Super Family 11 Receptor HCQ Hydroxychloroquine OPG Osteoprotegerin Treg-celle Regulatorisk T-celle HLA Human Leukocyte Antigen P. Gingivalis Porphyromonas Gingivalis UPLC Ultra-Performance Liquid Chromatography HPLC High-Performance Liquid Chromatography p.o. Per oral VEGF Vascular Epithelial Growth Factor i.a. Intraartikulært PAD Peptidyl Arginine Deiminase Side 3 af 104

5 FORORD Denne projektrapport er udarbejdet af fire medicinstuderende fra Aalborg Universitet i forbindelse med bachelorprojektet på 6. semester. Projektgruppens arbejde tager udgangspunkt i en bred viden omkring reumatoid artritis (RA), diagnosekriterierne udarbejdet af American College of Rheumatology (ACR) og massespektrometri, herunder potentialet af massespektrometri som et nyttigt værktøj i forbindelse med diagnosticering af RA. Projektet er udarbejdet ud fra Aalborg-modellen, der anvender problem-based-learning. Rapporten beskriver således en bred viden, hvilket har ført til en projektafgrænsning, problemløsning og diskussion heraf samt konklusion. Formålet med projektet er at undersøge, om ACR-diagnosekriterierne er tilstrækkelige til at kunne diagnosticere patienterne med RA, og hvilke andre alternativer der kunne være. Projektgruppen har valgt at undersøge massespektrometri som en alternativ diagnosticeringsmetode, da massespektrometri kan anvendes til at identificere og kvantificere et stort antal proteiner i celleprøver, og derved bidrage til den viden der er på området. Projektgruppen retter en stor tak til Allan Stensballe og Michael Kruse Olesen for vejledning i alle mulige og umulige situationer. Ydermere takkes Sygehus Vendsyssel og Aalborg Universitet for at stille udstyr til rådighed. Side 4 af 104

6 INDHOLDSFORTEGNELSE Titelblad... 1 Læsevejledning... 2 Forkortelser... 3 Forord Indledning Baggrund Patofysiologi Ætiologi Inflammatoriske celler ved RA Artikulær ødelæggelse ved RA Antireumatisk behandling Økonomiske konsekvenser ved biologiske antireumatika Problematik omkring behandling af RA Problemafgrænsning Metode Klinisk metode Eksperimentel metode Databehandling Resultater Patientkonsultationer Gelelektroforese-Massespektrometri Validering af metode Proteiner identificeret ved Massespektrometri Validering af identificerede spektra Sammenligning af identificerede proteiner Diskussion...39 Side 5 af 104

7 7.1 Kliniske resultater Eksperimentelle resultater Diskussion af forsøgsopstillingen Konklusion Perspektivering Mandatory Resumé of the project Litteraturliste Appendix...52 A1 Laboratoriejournal: Separering med dynabeads...52 A2 Laboratoriejournal: SDS-PAGE...55 A3 Laboratoriejournal: In-gel digestion...56 A4 Journal: Patient nummer A5 Journal: Patient nummer A6 Blodprøve: Patient nummer A7 Blodprøve: Patient nummer A8 Spektra for CD A9 Spektrum for CD A10 udregning af aminosyresekvens for CD4 og CD A11 NCBI-blast for CD4 og CD A12 Sammenligning af CD14-proteinerne...71 A13 - Analysebrugsanvisning: Separering med dynabeads...72 A14 - Analysebrugsanvisning: In-gel digestion...73 A15 Analysebrugsanvisning: SDS-PAGE...75 A16 Udvidede APV er...77 Side 6 af 104

8 1.0 INDLEDNING Reumatoid Artritis (RA) er en kronisk inflammatorisk og uhelbredelig sygdom, som har en global prævalens på 0,5-1 % (Kvien, 2004). I Danmark har RA en årlig incidens på 36 pr kvinder og 14 pr mænd, hvorved sygdommen er 2-3 gange så hyppig for kvinder som mænd (Schaffalitzky de Muckadell, Haunsø, & Vilstrup, 2013). Årsagen til sygdommen er endnu ukendt, men der er en række anerkendte risikofaktorer, som har betydning for udviklingen af RA. Sygdommen medfører ikke kun destruktion af led, men påvirker også andre væv og organsystemer. Dette medfører i høj grad nedsat livskvalitet hos patienterne og øget mortalitet. Det er oftest systemiske manifestationer såsom hjertekarsygdomme, der øger mortaliteten, men med en effektiv antireumatisk behandling kan progressionen af disse systemiske manifestationer hæmmes. (Stoltenberg, Klamer, & Husby, 2011) Det er derfor vigtigt, at RA patienter får stillet diagnosen så tidligt som muligt og derved kommer hurtigt i behandling. Indenfor de seneste år er der kommet en del nye behandlingsmuligheder med biologiske antireumatika. Dog er effektive behandlingsmuligheder for RA stadig begrænset af, at nogle RA patienter får alvorlige bivirkninger eller danner antistoffer mod den biologiske behandling. Nogle sygdomskarakteristika kan øge risikoen for udvikling af immunitet mod behandlingen, og derfor understøtter dette vigtigheden af en tidlig diagnosticering. (Polido-Pereira, Vieira-Sousa, & Fonseca, 2011) Tidlig diagnosticering er på nuværende tidspunkt ikke altid muligt, hvilket kan føre til, at patienterne får en mere aktiv inflammation, hvorved sygdommen bliver mere fremskreden ved behandlingens start. Grundet disse udfordringer er det vigtigt at få yderligere viden om, hvorfor RA opstår, og hvilken betydning de involverede inflammatoriske celler har. Dette leder frem til følgende initierende problemstilling. Hvad er RA, herunder de inflammatoriske cellers betydning for sygdommen, og hvordan behandles det? Side 7 af 104

9 2.0 BAGGRUND 2.1 PATOFYSIOLOGI RA er en kronisk inflammatorisk autoimmun sygdom, der er associeret med ledhævelse og -smerte i flere led (McCance, Huether, Brashers, & Rote, 2010). Der ses en inflammation i synovialmembranen, hvorved der sker ændringer i de cellulære bestanddele og fysiologi i leddet, jf. figur Denne inflammation betegnes synovitis. Ved inflammationen sker der en aktivering af blandt andet cytotoksiske T-celler (Tc-celler), hjælper T-celler (Th-celler), B- celler, makrofager og Natural Killer-celler (NK-celler), hvilket fører til hyperplasi af makrofager og fibroblaster i synovialmembranen. Synoviale makrofager er med til at øge den endotheliale adhæsion, og kan derfor stimulere til yderligere infiltration af leukocytter. (Harris et al., 2005) De inflammatoriske celler, der migrerer til leddet, påvirker cytokinmiljøet lokalt, hvilket har en stor indvirkning på sygdommens progression. De væsentligste cytokiner udskilles af makrofager og omfatter blandt andet TNF-α, IL-1 og IL-6. I forbindelse med inflammationen ved RA vil det profunde artikulære miljø blive hypoksisk, hvilket fører til angiogenese i synovialmembranen. Angiogenese, infiltration af celler fra blodbanen, hyperplasi af synoviocytter, granulationsvæv og fibrose medfører ofte udvidelse af synovialmembranen og pannusdannelse, jf. figur Pannusdannelsen er tæt forbundet med knogle- og brusknedbrydelse og derved ledødelæggelse. (Choy, 2012) Figur 2.1.1: Et normalt led versus et inflammeret led ved RA. Ved RA ses synovial hyperplasi og pannusdannelse. De inflammatoriske celler, der påvirker leddet, er illustreret. Modificeret udgave af figur 42.27A fra Pathophysiology: The Biologic Basis for Disease in Adults and Children (McCance et al., 2010). Ud over den artikulære ødelæggelse ved RA er sygdommen også forbundet med en række systemiske manifestationer. Af disse systemiske manifestationer er kardiovaskulære sygdomme de hyppigste. Den kardiovaskulære involvering skyldes, at frigivelsen af TNF-α, IL-1 og IL-6 fra synovialvævet påvirker adipøst væv og Side 8 af 104

10 vaskulært endotel. Disse forandringer resulterer i blandt andet dyslipidæmi, som kan give øget risiko for aterosklerose. (Choy, 2012) En anden systemisk manifestation ved RA er anæmi, som ses ved % af patienterne. Dette menes at skyldes, at IL-6 og IL-1 har en fremmende effekt på hepcidinfrigivelsen. Hepcidin produceres af hepatocytter og har en vigtig funktion i jernregulationen. Hepcidin inhiberer makrofagernes jernfrigivelse i milten og hæmmer jernoptagelsen i duodenum. (Weiss & Schett, 2012) Mængden af hepcidin i serum kan være meget høj ved patienter med RA, hvilket fører til anæmi. Anæmi ses allerede tidligt i sygdomsforløbet. (Demirag et al., 2009) Deruodver er osteoporose en almindelig systemisk klinisk manifestation hos patienter med RA. En undersøgelse har vist, at IL-6 har en stor rolle ved osteoporose relateret til RA, da IL-6 fører til øget osteoklastgenese og nedsat osteoblastaktivitet, som fører til øget knoglenedbrydelse. (De Benedetti et al., 2006) 2.2 ÆTIOLOGI Årsagen til RA er endnu ikke fuldt forstået, men der er en række anerkendte risikofaktorer, som anses for at have betydning for udviklingen af RA. De primære risikofaktorer, som er forbundet med RA, er genetik, infektion, rygning og traume. De genetiske faktorer anses som værende af stor betydning, idet RA patienter har en variation af Human Leukocyte Antigen-genet (HLA-genet) (Choy, 2012). HLA-genet koder for MHC-klasse-II receptoren, som sidder på de antigenpræsenterende celler, og HLA-genet er dermed ansvarligt for immunsystemets respons, og er afgørende for at skelne mellem kroppens egne proteiner og fremmede antigener. HLA-genet udviser en enorm grad af strukturel variabilitet, hvilket fører til polymorfisme blandt befolkningen. Variationer i HLA-genet vil resultere i forskellige typer af antigener og derved forskelligt immunrespons mellem individer. Den primære funktion af MHC-klasse-II er præsentation af antigener til T-celler. Antigengenkendelsen resulterer i en signaltransduktion og aktivering af T-cellen. T-cellen genkender kun antigener, der præsenteres af individets egne HLA-molekyler. (Harris et al., 2005) DRB1*0401 allelen var den første HLA-gen polymorfisme, der blev associeret med RA. Denne allel findes især blandt den kaukasiske befolkning. Der er flere HLA-DRB1 alleler associeret med RA, selvom styrken af disse associationer er variable. Det er nu alment anerkendt, at følgende alleler er årsag til en øget risiko for RA ved DRB1 locus; DRB1*0401, -0404, -0405, og -1001, jf. figur (Harris et al., 2005) Mere end 80 % af patienter med RA bærer genotypen HLA-DRB1, og patienter med homozygotiske HLA-DRB1 alleler er i forhøjet risiko for komplikationer, såsom nodulære manifestationer og kardiovaskulære sygdomme (Choy, 2012). Ikke-HLA alleler, såsom PTPN22, PADI4, STAT4, TRAF1-C5 og TNFAIP3, der er associeret med RA, repræsenterer kun 3-5 % af den genetiske variation blandt RA patienter (Choy, 2012). Side 9 af 104

11 Figur 2.2.1: HLA-genet på kromosom 6, som koder for MHC-klasse-II receptoren. De vigtigste genetiske variationer i HLA-genet mellem RA patienter. HLA-genet opdeles i to isotyper, HLA klasse I og HLA klasse II, på baggrund af deres serologiske og biokemiske struktur. Der er tre subregioner ved HLA klasse II, der betegnes DP, DQ og DR. HLA-genet findes på den korte arm på kromosom 6 (6p21.3), hvor HLA klasse I og HLA klasse II findes forskellige steder på genet. Subregionen DR inddeles i 2 locus, DRA og DRB. Variation i HLA-DRB1 kan hyppigt være årsag til RA. APC: Antigenpræsenterende celle. Modificeret udgave af figur 17-4 fra Kelley's Textbook of Rheumatology (Harris et al., 2005) Udover genetiske faktorer menes infektioner også at have en effekt på indtrædelsen og progressionen af RA. Periodontitis grundet P. gingivalis er et eksempel på dette. Undersøgelser har vist, at P. gingivalis udtrykker peptidylarginin deiminase (PAD), som er ansvarlig for posttranslationel modifikation af arginin til citrullin, jf. afsnit Citrullering har en vigtig rolle ved RA patogenesen (Bennike, Birkelund, Stensballe, & Andersen, 2014). Derfor antages det, at en infektion med P. gingivalis kunne fremme autoantigen-præsentationen og dermed udvikling af RA. Endvidere ses der en korrelation mellem tilstedeværelsen af anti-p. gingivalis antistoffer og anti-citrullinated protein antibodies (ACPA) ved periodontitis-patienter. (Mikuls et al., 2012) Andre infektiøse agenser, som menes at have en indflydelse på udviklingen af RA, er eksempelvis Epstein Barr virus, Cytomegalovirus og Escherichia Coli. Ved disse infektioner dannes et immunkompleks, som menes at kunne udløse dannelsen af reumafaktor (RF), jf. afsnit (McInnes & Schett, 2011) En meget vigtig miljøfaktor, som er impliceret i udviklingen af RA hos HLA-DRB1*04-positive personer, er rygning. Det antages, at rygning giver anledning til øget apoptose og aktivering af innat immunitet i lungerne. Disse begivenheder bliver efterfulgt af øget citrullering af kroppens egne proteiner i lungerne. Derved kan rygning være med til at danne ACPA, hvilket menes at være direkte forbundet med immunresponset i RA. (Klareskog, Padyukov, & Alfredsson, 2007) En yderligere faktor, der antages at spille en rolle for udviklingen af RA, er fysisk traume. Disse traumer kunne blandt andet være alvorligt fald, trafikuheld, fraktur eller kirurgiske indgreb. Al-Allaf et al. viste ved en casekontrol undersøgelse i 2001, at fysisk traume var signifikant associeret med indtrædelsen af RA, idet 21 % af RA patienterne havde oplevet et fysisk traume op til 6 måneder før indtrædelsen af RA. Til sammenligning havde kun 6,1 % af kontrolgruppen oplevet et fysisk traume indenfor de sidste 6 måneder. (Al-Allaf, 2000) Side 10 af 104

12 2.3 INFLAMMATORISKE CELLER VED RA Det er tydeligt, at de inflammatoriske celler har indflydelse på udviklingen af RA. Det er især Th-celler, Tc-celler, B- celler, makrofager og NK-celler, samt disses påvirkning af de omkringliggende celler, der spiller en betydelig rolle ved RA. (McInnes & Schett, 2007) T-HJÆLPER-CELLER Th-celler, der er CD4-positive, er påvist i store mængder i den inflammerede synovialmembran (Agger, Nielsen, Leslie, & Aasted, 2011; McInnes & Schett, 2007). Dette menes, at skyldes den tidligere nævnte genetiske association mellem RA og MHC-klasse-II-alleler. Th-celle-aktivering involverer tilstedeværelsen af en antigenpræsenterende celle såsom dendritisk celle, makrofag eller B-celle, der bærer receptoren MHC-klasse-II. (Agger et al., 2011) Naive Th-celler aktiveres via 3 signaler jf. figur Det første aktiveringssignal er, når T-celle-receptoren (TCR) på Th-cellen binder et antigen præsenteret af MHC-klasse-II-molekylet på en antigenpræsenterende celle. Som respons på signal 1 udtrykker T-cellen CD40L, som kan reagere med CD40 på den antigenpræsenterende celle. Dette får den antigenpræsenterende celle til at opregulere CD80/CD86. Det andet aktiveringssignal er en ko-stimulatorisk aktivering fra CD80/CD86-CD28 komplekset. Hvis den naive T-celle ikke modtager dette signal, vil den blive anergisk, hvilket vil sige, at den er ude af stand til at blive aktiveret igen. Det tredje aktiveringssignal udgøres af det cytokinmiljø, som er til stede under cellernes proliferation og differentiering. Dette cytokinmiljø har betydning for, hvilken effektorcelletype den naive Th-celle udvikler sig til. De fire forskellige effektorcelletyper er Th1, Th2, Th17 og regulatoriske T-celler (Treg) jf. figur (Agger et al., 2011) Figur : Aktivering af en naiv Th-celle via 3 signaler. Skematisk afbildning af de vigtigste molekyler og deres interaktioner i forbindelse med de 3 signaler. Bindingen mellem TCR og MHC-klasse-II er antigenpræsenterende og sørger for opregulering af CD40L. CD40L binder til CD40 og sørger for opregulering af CD80/CD86. Bindingen mellem CD28-CD80/CD86 er et ko-stimulatoriske receptor/ligand par. Thceller sammenholdes med APC via adhæsionsproteinerne LFA-1/ICAM-1. APC: Antigenpræsenterende celle. Modificeret udgave af figur 7.5 fra Immunologi (Agger et al., 2011). De cytokiner, der fører til differentiering af en Th1-celle, er IL-12 og IFN-γ, mens differentieringen af Th2-celler sker ved tilstedeværelsen af IL-4 (Agger et al., 2011). Ved påvirkning af TGF-β og IL-6 dannes Th17-celler, mens påvirkning af TGF-β alene fører til dannelse af Treg-celler, jf. figur (McInnes & Schett, 2007). På denne måde kan det omkringliggende cytokinmiljø påvirke differentieringen af Th-cellerne. De fire Th-celletyper har forskellige egenskaber, og de producerer hver deres cytokiner, som har en indvirkning på andre celletyper. Denne indvirkning vil blive nærmere beskrevet i nedenstående afsnit. Side 11 af 104

13 Th1-celler producerer IFN-γ, IL-2, TNF-β og GM-CSF. IFN-γ er især vigtig for Th1-cellernes funktion, idet dette cytokin står for aktivering af makrofager, NK-celler og Tc-celler, hvilket fører til en mere effektiv celledrabsmekanisme. Ydermere opreguleres MHC-klasse-I og MHC-klasse-II på de antigenpræsenterende celler. (Agger et al., 2011) Th1- cellerne udtrykker TNFSF11, og de er dermed medvirkende til nedbrydelse af knoglerne. Knoglenedbrydelsen reguleres dog af IFN-γ og GM-CSF, som undertrykker osteoklastdifferentieringen (McInnes & Schett, 2007). Th2-celler producerer blandt andet IL-4 og IL-10. IL-4 aktiverer B-celler, opregulerer disses MHC-klasse-II-ekspression og stimulerer proliferationen og antistofproduktion, jf figur IL-10 hæmmer osteoklastdifferentieringen og virker antiinflammatorisk. (Agger et al., 2011; McInnes & Schett, 2007) Th17-celler producerer IL-17, som aktiverer neutrofile granulocytter og synoviale makrofager og stimulerer disses cytokinfrigivelse, jf Derudover aktiverer IL-17 de synoviale fibroblasters cytokin- og kemokinfrigivelse, produktion af prostaglandiner og syntese af MMP og ADAMTS 1, som alle bidrager til den artikulære ødelæggelse. IL-17 stimulerer også de synoviale fibroblasters ekspression af TNFSF11, som kan aktivere osteoklasterne, og derved fører til nedbrydelse af knoglerne. Th-17 cellerne udtrykker også selv TNFSF11. (McInnes & Schett, 2007; Weaver, Hatton, Mangan, & Harrington, 2007) Man har tidligere haft den opfattelse, at RA hovedsageligt var en Th1-cellemedieret sygdom, men forskning har senere vist, at Th17-celler har en afgørende rolle ved RA. IL-17 er opreguleret tidligt i sygdommen. (Lubberts, Koenders, & van den Berg, 2005) Regulatoriske T-celler (Treg-celler) er Th-celler, som primært leverer suppressive signaler til immunsystemet. Det formodes, at Treg-celler udøver deres inhiberende virkning på andre celler via en stor produktion af cytokiner såsom IL-10 og TGF-β, som virker inhiberende på en lang række forskellige processer i immunsystemet, blandt andet udviklingen af Th1-celler og B-cellernes antistofproduktion. (Agger et al., 2011; McInnes & Schett, 2007) Ved RA er Treg-cellernes immunsupprimerende funktion nedsat, da cytokinmiljøet hæmmer differentieringen af Treg-celler (Boissier et al., 2009). Figur : Aktivering af Th-celler og disses cytokiner. Alt efter cytokinmiljøet udvikler Th-cellen sig til Th1, Th2, Th17 og Treg. Disse celletyper udskiller cytokiner, som påvirker makrofager, B-celler, Tc-celler og neutrofile granulocytter, som alle medvirker til inflammationen og den artikulære ødelæggelse ved RA. Figuren er tilpasset fra forskellige kilder CYTOTOKISKE T-CELLER Det har længe været foreslået, at Tc-celler har en rolle i initieringen og vedligeholdelsen af RA, men på grund af modsigende resultater, er dette endnu ikke fuldt afklaret (Carvalheiro, da Silva, & Souto-Carneiro, 2013). Tc-celler er CD8-positive og udgør ca. 40 % af T-cellerne i synovialvæsken og menes at kunne have to modsatrettede funktioner i 1 MMP: Matrix metalloproteinases, ADAMTS: a disintegrin and metalloprotease with thrombospondin motifs. MMP og ADAMTS er peptidaser, der er medvirkende til at nedbryde ekstracellulært matrix og brusk (Harris et al., 2005). Side 12 af 104

14 immunresponset. De kan have en supprimerende effekt på det inflammatoriske respons i leddene, ved at secernere IL-10, som inhiberer inflammation, og samtidig kan de secernere lyserende enzymer og proinflammatoriske cytokiner, som f.eks. IL-1, IL-6, IL-17 og TNF-α. Den overordnede Tc-celles rolle i RA-processen menes at være et resultat af en fejlregulering af balancen mellem de proinflammatoriske og immunsupprimerende funktioner. En forståelse af disse processer, og faktorerne der regulerer dem, kan potentielt give vigtige informationer, som kan bidrage til nye behandlingsformer. (Carvalheiro et al., 2013; McInnes, 2003) B-CELLER B-celler, der er CD19-positive, er antigenpræsenterende celler, som er involveret i patogenesen af RA, idet de producerer autoantistofferne RF og ACPA (Harris et al., 2005). Disse autoantistoffer binder til henholdsvis kroppens egne antistoffer og citrullinerede peptider og er derved med til at forstærke inflammationen. Ved RA findes de aktiverede B-celler i det synoviale væv. Da B-cellerne via deres autoantistofproduktion forstærker T-celle-afhængig synovitis, antager man, at fjernelse af B-cellen kan have en positiv effekt på sygdomsprocessen. (Harris et al., 2005; McInnes & Schett, 2007) NATURAL KILLER-CELLER NK-celler, der er CD56-positive, er vidt distribueret i synovialmembranen ved RA, men deres rolle i den synoviale inflammation er stadig ikke fuldt forstået. De har potentialet til at bidrage til patogenesen af RA gennem forskellige mekanismer, som blandt andet inkluderer cytokinproduktion, celle-celle-interaktion og drab af andre immunologiske celler. De aktiverede NK-celler frigiver især cytokinerne TNF-α og INF-γ, som er med til at øge den inflammatoriske proces. Ved celle-celle-interaktion med andre lymfocytter kan NK-cellerne give et ko-stimulatorisk signal ved aktivering af T- og B-celler via ekspression af eksempelvis CD40L. Derudover har NK-celler potentialet til at regulere inflammationen ved at dræbe andre immunologiske celler. I RA-patienter har NK-cellerne en lavere cytotoksisk aktivitet og derved reduceres kontrollen af immunresponset. De synoviale NK-celler udtrykker TNFSF11 og M-CSF og kan derved også medvirke til knoglenedbrydelsen ved RA. (Ahern & Brennan, 2011; McInnes & Schett, 2007) SYNOVIALE MAKROFAGER OG SYNOVIALE FIBROBLASTER Th1- og Th17-cellerne udskiller cytokiner, der kan aktivere synoviocytterne i leddet. Der findes to typer synoviocytter: Type-A-synoviocytter, der er synoviale makrofager og Type-B-synoviocytter, der er synoviale fibroblaster. (Geneser, 2011) Både synoviale makrofager og synoviale fibroblaster fungerer som beklædende celler, men ved RA bliver de beklædende celler i synovialmembranen hovedsageligt erstattet med synoviale makrofager. Dette opnås ved en kemokinmedieret rekruttering af monocytter. De synoviale makrofager, der er CD14-positive, producerer en række cytokiner heriblandt TNF-α, TGF-β, IL-1 og IL-6. Disse cytokiner fremmer differentieringen af Th17-celler og supprimerer samtidig differentieringen af Treg. (Harris et al., 2005; McInnes & Schett, 2011) Cytokinerne TNF-α, IL-1 og IL-6 er dominerende i synovialmembranen og -væsken i patienter med RA. Disse cytokiner påvirker mange celletyper i leddet, herunder synoviale fibroblaster, mastceller, neutrofile granulocytter, osteoklaster, chondrocytter og adipocytter, jf. figur (McInnes & Schett, 2007, 2011) De synoviale fibroblasters funktion er at vedligeholde leddet. Dette gør de dels ved at producere komponenter til den ekstracellulære matrix i synovialmembranen, blandt andet kollagen og proteoglykaner, og dels ved at producere komponenter, der secerneres over i ledvæsken, blandt andet hyaluronan og lubricin, der nedsætter ledfladernes friktion. De synoviale fibroblaster secernerer også degraderende enzymer såsom MMP og ADAMTS, der er nødvendige for matrix remodellering. Derudover producerer de andre faktorer, såsom vækstfaktorerne FGF, VEGF, M-CSF og prostaglandiner. Disse faktorer antages at medvirke til celledeling, cellemodning, angiogenese og regulation af blodgennemstrømning. De synoviale fibroblaster producerer også IL-7, som opregulerer differentieringen til osteoklaster. (Geneser, 2011; Harris et al., 2005; McInnes & Schett, 2007) Ved RA ses der et nedsat vaskulært flow, hvilket blandt andet skyldes et øget tryk i vævet. Dette fører til hypoksi, forhøjet laktat og en lav ph-værdi på ned til 6,8. Hypoksi er en potent stimulus for angiogenese, hvor der sker en produktion af eksempelvis VEGF og FGF fra de synoviale fibroblaster. Disse vækstfaktorer ses derfor i høje mængder Side 13 af 104

15 ved RA. VEGF stimulerer til nydannelse af blodkar samt ekspression af kollagenase, der kan degradere ekstracellulær matrix for at gøre plads til nydannelse af kar og pannusdannelse. (Harris et al., 2005) Angiogenesen er ikke den eneste involvering af karrene ved RA. Endothelcellerne bliver aktiveret af cytokinerne, især TNF-α og IL-1, som er produceret af makrofager. Herved opreguleres deres adhæsionsproteiner, hvilket fører til yderligere binding af monocytter og neutrofile granulocytter, hvorved flere leukocytter diffunderer til leddet. Monocytter og neutrofile granulocytter binder til adhæsionsproteinerne på endothelcellerne via ICAM-1, og ved RA er der lokaliseret høje mængder af ICAM-1 på de synoviale makrofager. (Harris et al., 2005) 2.4 ARTIKULÆR ØDELÆGGELSE VED RA De involverede led ved RA undergår ændringer, såsom brusk- og knoglenedbrydelse. Brusknedbrydelse sker blandt andet grundet forhøjede niveauer af MMP og ADAMTS, pannusdannelse, og derudover bidrager chondrocytterne til ødelæggelse af leddet. Knoglenedbrydelsen er en ubalance mellem knogledannelse og knogleresorption. (Harris et al., 2005) Hyperplasi i synovialmembranen er en vigtig medvirkende årsag til bruskødelæggelse ved RA (McInnes & Schett, 2011). Artikulært brusk består af et non-mineraliseret superficielt lag og et mineraliseret profundt lag, som ligger tilstødende til knoglen. Begge lag indeholder chondrocytter, hvilket er afgørende for bruskmetabolismen, idet de både har funktion i dannelsen og nedbrydelsen af brusk. (McInnes & Schett, 2007) Ved RA sker der et tab af synovialmembranens normale beskyttende funktion af brusken, og herved ændres bruskens overflade. Den ændrede overflade fremmer adhæsion og invasion af synoviale fibroblaster. (McInnes & Schett, 2011) Brusknedbrydelsen er karakteriseret ved frigivelsen af matrixnedbrydende enzymer, såsom MMP og ADAMTS, der nedbryder bruskkomponenterne proteoglykan og kollagen, hvorved brusken bliver mere modtagelig for slid. Nedbrydelsen sker hovedsageligt via to mekanismer. Ved den første mekanisme skifter chondrocytterne fra at være anabolske til katabolske, hvilket er karakteriseret ved dannelse af matrixnedbrydende enzymer. Ved den anden mekanisme bliver de matrixnedbrydende enzymer frigivet af synoviale fibroblaster og neutrofile granulocytter, som er lokaliseret tæt på det artikulære brusk. (Harris et al., 2005; McInnes & Schett, 2007) Både chondrocytter og synoviale fibroblaster responderer på lokal cytokinfrigivelse. Chondrocytterne stimuleres især af IL-1, IL-17, IL-18 og TNF-α, mens de synoviale fibroblaster aktiveres af cytokiner såsom TNF-α og IL-1. Aktiveringen får dem til at producere de matrixnedbrydende enzymer, som diffunderer ind i brusken. Apoptose af chondrocytter er et karakteristika ved bruskødelæggelse, hvilket fører til dannelse af lakuner og manglende genopbygning af matrix, jf. figur (McInnes & Schett, 2007) Side 14 af 104

16 Figur 2.4.1: Brusknedbrydelse ved RA Brusknedbrydelsen sker via katabolske processer, synovial fibroblast invasion og apoptose af chondrocytter. Modificeret udgave af figur 5 fra Cytokines in the pathogenesis of rheumatoid arthritis (McInnes & Schett, 2007). Knoglenedbrydelse forekommer oftest tidligt i RA-forløbet og rammer ca. 80 % af patienterne inden for det første år efter diagnosticering (McInnes & Schett, 2011). Inflammation og knoglenedbrydelse er tæt forbundet, idet osteoklaster opreguleres af de inflammatoriske cytokiner. Normalt er der en balance mellem osteoblaster og osteoklaster, men denne balance bliver forstyrret ved RA. Osteoklasterne stammer fra den samme hæmopoietiske linie som monocytter og makrofager, og differentiering til osteoklaster opnås ved aktivering af TNFSF11 og M-CSF. Disse opreguleres af cytokinerne TNF-α, IL-1 og IL-7, som bliver udskilt af makrofager og synoviale fibroblaster. Th1- og Th2-celler udskiller derimod IL-4, IL-10 og IFN-γ, som har en inhiberende effekt på osteoklastdifferentieringen, jf. figur (Jørgensen & Kassem, 2009; McInnes & Schett, 2007) Udover cytokinmiljøet er osteoklastdifferentieringen også moduleret af osteoprotegerin (OPG), som er udtrykt af mesenchymale celler i synovialmembranen. OPG fungerer som en antagonist, der binder TNFSF11, og derved forhindrer interaktionen mellem TNFSF11R og TNFSF11. Ved RA er der en ubalance mellem ekspressionen af OPG og TNFSF11, hvor der ses mindsket ekspression af OPG og øget TNFSF11, hvilket inducerer knogleresorptionen. (McInnes & Schett, 2007) Den kliniske inhibering af TNFSF11 virker kun på knoglerne, men har ingen effekt på betændelse og brusknedbrydelse ved RA (McInnes & Schett, 2011). Ved RA opstår der derved en ubalance mellem stimulerende og hæmmende signaler, hvilket resulterer i, at osteoklasterne mellem det synoviale væv og den artikulære knogle øger knogleresorptionen. Dette tillader invasion af celler fra synovialmembranen og resulterer i pannusdannelse. (McInnes & Schett, 2007) Pannus er en biofilm bestående af inflammatoriske celler, granulationsvæv dannet af fibrin, osteoklaster og synoviale fibroblaster, som vokser hen over den artikulære overflade og medfører knogleerosion (McCance et al., 2010). Side 15 af 104

17 Figur 2.4.2: Differentieringen af osteoklast prækursor celler til osteoklaster. Synoviale fibroblaster og Th1 celler udtrykker TNFSF11 og M-CSF, der virker fremmende på differentieringen af osteoklaster. Modificeret udgave af figur 4 fra Cytokines in the Pathogenesis of Rheumatoid Arthritis. (McInnes & Schett, 2007) 2.5 ANTIREUMATISK BEHANDLING RA kan ikke helbredes, men antireumatiske lægemidler har en symptomlindrende virkning og en hæmmede effekt på sygdommens progression. Optimal behandling kræver tidlig diagnose og tidlig indsats i sygdomsforløbet med aggressiv behandling for at mindske sandsynligheden for irreversibel ledskade. (Jacobsen, Manniche, Pødenphant, Stensgaard-Pedersen, & Tarp, 2012) Siden midten af 1990 erne er der sket store ændringer i behandlingsstrategien af RA. Disse ændringer skyldes tidligere diagnostik, tidligere intervention, biologiske antireumatika og kombinationsterapi. Udviklingen indenfor behandling af RA skyldes i høj grad store fremskridt i forhold til at forstå de mekanismer, der ligger til grund for udviklingen af RA. (Harris et al., 2005) I dag inddeles antireumatiske lægemidler som anvist i tabel Tabel 2.5.1: Medikamenter anvendt ved RA. For hvert medikament er angivet et eksempel på et hyppigt anvendt præparat. (Kampmann, Brøsen, & Simonsen, 2011) Medikament Svage analgetika DMARDs (Disease-modifying antirheumatic drugs) Glukokortikoider Biologiske antireumatika Eksempel Paracetamol eller acetylsalisylsyre Methotrexat Prednisolon Cimzia Paracetamol og NSAIDs såsom acetylsalisylsyre bruges til behandling af ledsmerter og morgenstivhed, og de benyttes oftest i kombination med andre antireumatiske præparater. Da de kun er svagt antiinflammatoriske og analgetiske og dermed har en begrænset virkning i behandlingen af RA, vil de ikke blive beskrevet nærmere. Farmakologisk behandling af RA er standardiseret i en behandlingsalgoritme, som kan ses i figur Når en patient ikke responderer på behandling med DMARDs, kan man øge dosis, forsøge at kombinere denne med andre DMARDs eller skifte til en anden DMARD. Hvis dette ingen effekt har, kan man skifte til en biologisk behandling, hvor Side 16 af 104

18 førstevalgspræparatet som regel er en TNF-α-hæmmer. (Schaffalitzky de Muckadell et al., 2013) Figur 2.5.1: Farmakologisk behandlingsalgoritme for RA. Før der anvendes biologisk behandling, skal mindst 2 DMARDs afprøves monoteraputisk eller i kombinationsterapi. Svage analgetika og glukokortikoider kan benyttes efter behov. ACR: American College of Rheumatology, MTX: Methotrexat, SFZ: Sulfasalazin, LFN: Leflunomid, HCQ: Hydroxychloroquine phosphate, i.a.: Intraartikulært, i.m.: Intramuskulært, p.o.: Peroralt. Modificeret udgave af figur fra Medicinsk kompendium, bind 1. (Schaffalitzky de Muckadell et al., 2013) DISEASE-MODIFYING ANTIRHEUMATIC DRUGS DMARDs anvendes ved inflammatoriske led- og bindevævssygdomme, især RA. Virkningen af disse lægemidler er langsom, og der kan gå måneder, før der ses en effekt. Derfor kan effekten først med sikkerhed afgøres efter 4-6 måneder % af patienterne ophører behandling med DMARDs på grund af bivirkninger. (Kampmann et al., 2011) I følgende afsnit er angivet eksempler på anvendte DMARDs METHOTREXAT Methotrexat anvendes ofte som førstevalgspræparat mod RA og har en direkte inhibitorisk effekt på proliferationen af inflammatoriske celler (Katzung, Masters, & Trevor, 2009). Dette skyldes, at methotrexat virker som en folsyreantagonist. Folsyre er nødvendig for DNA-syntesen, idet folsyre aktiverer enzymet dihydrofolatreduktase, som danner folsyre-derivatet tetrahydrofolat. (Kampmann et al., 2011) Tetrahydrofolat er nødvendig for dannelsen af mange aminosyrer (Tymoczko, Berg, & Stryer, 2011). Methotrexat inaktiverer dihydrofolatreduktase, hvilket giver mangel på tetrahydrofolat, hvorved proliferation af celler hæmmes (Kampmann et al., 2011). Udover at have en inhiberende effekt på celleproliferation, har methotrexat også en inhiberende effekt på de proinflammatoriske cytokiner ved RA. Derudover stimulerer methotrexat til apoptose af de inflammatoriske celler. (Katzung et al., 2009) Forholdet mellem effekt og bivirkning er mest gunstig ved methotrexat i forhold til andre Side 17 af 104

19 DMARDs, derfor ses flere end 50 % af patienterne fortsat i behandling efter 3 år. Hyppige bivirkninger ved methotrexat er blandt andet leverpåvirkning med transminaseforhøjelse, kvalme og stomatitis. Tilskud af folsyre reducerer bivirkningerne fra lever og mave-tarm-kanalen. (Kampmann et al., 2011) ANDRE DISEASE-MODIFYING ANTIRHEUMATIC DRUGS Sulfasalazin er et stof, som hyppigst anvendes tidligt i sygdomsforløbet. Virkningsmekanismen er ukendt, men det har en moderat antiinflammatorisk aktivitet. (Jacobsen et al., 2012; Kampmann et al., 2011) Der opnås effekt ved ca. 60 % af patienterne, men bivirkninger i form af gastrointestinale symptomer og hududslæt er relativt hyppige (Jacobsen et al., 2012). Leflunomid har en ukendt virkningsmekanisme, men effekten kan sammenlignes med methotrexat (Kampmann et al., 2011). Hyppige bivirkninger til leflunomid er hududslæt, gastrointestinale symptomer, leverpåvirkning og knoglemarvsdepression (Jacobsen et al., 2012). Hydroxyklorokinfosfat er mindre effektivt end de øvrige DMARDs, men stoffet er velegnet til kombinationsterapi, da det ikke har mange bivirkninger (Jacobsen et al., 2012) GLUKOKORTIKOIDER Ved RA anvendes glukokortikoider til hæmning af det inflammatoriske respons. Glukokortikoiderne virker antiinflammatoriske, immunosuppressive og antiprolifererende. De binder til en steroidreceptor i cytoplasmaet, der danner et kompleks, hvorved dets aktivering fører til øget ekspression af gener, der har betydning for den antiinflammatoriske effekt, hvilket reducerer inflammationen drastisk. (Christophersen, Heisterberg, Senderovitz, & Rabøl, 2010) Til hurtig behandling af symptomer anvendes lokal injektion af glukokortikoider i de inficerede led. Derudover kan glukokortikoider anvendes peroralt til systemisk behandling. Ved peroral behandling anvendes der lave doser på grund af mange alvorlige bivirkninger. Disse bivirkninger er også årsag til, at glukokortikoider sjældent anvendes systemisk over længere tid. En vigtig bivirkning ved glukokortikoiderne er osteopeni. Glukokortikoiderne anvendes ved en opblussende sygdomsaktivitet eller til at nedsætte sygdomsaktiviteten indtil DMARDs virker ved nydiagnosticeret RA. (Schaffalitzky de Muckadell et al., 2013) BIOLOGISKE ANTIREUMATIKA Inden for de seneste år er der udviklet en række biologiske antireumatika mod RA (Kampmann et al., 2011). De hæmmer eller blokerer specifikke signalstoffer i den inflammatoriske kaskade ved RA. Eksempler på disse lægemidler er TNF-α-hæmmere, IL-1-receptor antagonister og IL-6-receptor antagonister TNF-ΑLFA-HÆMMERE TNF-α-hæmmere er lægemidler, der binder til TNF-α og derved hæmmer dets funktion. Et eksempel er Cimzia, som er et rekombinant humaniseret antistof 2, der binder sig med høj affinitet til TNF-α (ARHP Practice Committee, 2012). Herved reduceres migration af inflammatoriske celler ind i leddet og en række proinflammatoriske cytokiner hæmmes. TNF-α-hæmmere gives enten som en subcutan eller en intravenøs injektion. Det har en kraftig og hurtig virkning, men kan anvendes i kombination med methotrexat, idet effekten af kombinationsbehandlingen er bedre end monoterapien. (Institut for Rationel Farmakoterapi, 2009) IL-1-RECEPTOR ANTAGONISTER IL-1-receptor antagonist, eksempelvis Anakinra, blokerer effekten af det proinflammatoriske cytokin IL-1. Det gives ved en aktiv, behandlingsresistent RA. Injektionen gives subkutant, hvor det har en hurtig virkning (Kampmann et al., 2011). Effekten er ikke så god som behandling med TNF-α-hæmmere (Jacobsen et al., 2012). 2 Rekombination er en teknik, hvor bakterier (f. eks. E. coli) bruges til at producere proteiner ud fra humane gener ( Rekombinant, 2014) Side 18 af 104

20 IL-6-RECEPTOR ANTAGONISTER IL-6-receptor antagonister, eksempelvis Tocilizumab, er humaniserede monoklonale antistoffer mod IL-6-receptoren, som blokerer den proinflammatoriske IL-6 (Kampmann et al., 2011). Præparatet har en hurtigt indsættende, synovitisdæmpende effekt og hæmmer udviklingen af erosioner (Schaffalitzky de Muckadell et al., 2013). Tocilizumab gives ved aktiv RA, hvor behandlingen med DMARDs og/eller TNF-α-hæmmere ikke har været tilstrækkelig. Medikamentet gives intravenøst, hvor det har en hurtig virkning (Kampmann et al., 2011). 2.6 ØKONOMISKE KONSEKVENSER VED BIOLOGISKE ANTIREUMATIKA De nye biologiske antireumatika er på nuværende tidspunkt meget dyre og risikoen for langtidsbivirkninger er ikke fuldt afklaret (Jacobsen et al., 2012). I et forsøg på at illustrere udgifterne ved behandling af RA er der taget udgangspunkt i en standard biologisk behandling med Cimzia. Cimzia har siden 1. januar 2013 været det foretrukne biologiske lægemiddel mod RA. Rådet for anvendelse af dyr sygehusmedicin (RADS) vurderede i 2012, at de fire præparater Cimzia, Humira, Remicade og Enbrel havde samme effekt, og Cimzia blev efter en udbudsrunde på pris udpeget som førstevalg for biologisk behandling af RA, hvilket medførte, at Cimzia gives til 80 % af patienter med RA, der starter biologisk behandling. (Gigtforeningen.dk, 2012) Cimzia gives subkutant i sprøjter à 200 mg. Doseringsforslaget er 400 mg, svarende til to sprøjter, i uge 0, 2 og 4 og herefter 200 mg, svarende til én sprøjte, hver anden uge. Dette bliver i alt 29 sprøjter om året. En pakning med to stk. sprøjter koster ca kr. Behandlingen koster derved ca kr. pr. patient om året. (Friis, Hendel, Dalhoff, & Bjerrum, 2014a) I 2011 var 6500 RA patienter i biologisk behandling (Tarp, 2011). Hvis man sammenligner dette med prisen for behandling med et methotrexatpræparat kaldet 2care4, koster en pakke med 100 tabletter à 2,5 mg. 186,05 kr. For at opnå den maksimale dosis skal der gives 30 mg om ugen, hvilket svarer til 12 tabletter. Det svarer til en udgift på ca kr. årligt pr. patient, hvilket gør methotrexat ca. 134 gange billigere end Cimzia. (Friis, Hendel, Dalhoff, & Bjerrum, 2014b) Derved er udgifterne for den nye biologiske behandling meget større for samfundet end udgifterne for førstevalgspræparatet methotrexat. Dette har stor betydning for, hvornår det vurderes, at en patient kan starte på denne behandling. Generelt betyder det, at patienterne først kommer i biologisk behandling, når de har været behandlet med minimum 2 DMARDs enten som monoterapi eller kombinationsterapi. (Schaffalitzky de Muckadell et al., 2013) 2.7 PROBLEMATIK OMKRING BEHANDLING AF RA Som tidligere nævnt har der været betydelige fremskridt i behandlingen af RA indenfor de seneste år. Dog er det stadig kun få patienter, der oplever længerevarende remission, og mange patienter bliver immune overfor behandlingen. (Polido-Pereira et al., 2011) Ved behandling med DMARDs kan patienten opleve en effekt, der over tid reduceres, og hvor en dosisforhøjelse er nødvendig. Denne dosisforhøjelse kan dog lede til øgede bivirkninger, der gør behandlingsændring eller -skift nødvendigt. (van der Heijden, Dijkmans, Scheper, & Jansen, 2007). En patient i biologisk behandling med TNF-α-hæmmere kan udvikle neutraliserende antistoffer mod disse, hvilket øger clearance af antistoffet, hvorved patientens respons på behandlingen mindskes. En dosisforhøjelse vil i nogle tilfælde kunne blokere antistofdannelsen, men en patient, der er immun overfor behandlingen, vil være nødsaget til at skifte præparat. (Institut for Rationel Farmakoterapi, 2013) Risikoen for at udvikle immunitet øges, hvis der ses høje niveauer af RF eller ACPA. Derudover ses der øget risiko for immunitet ved høj sygdomsaktivitet, dårlig prognose, forsinket eller forkert behandling eller ved genetisk disponering. (Polido-Pereira et al., 2011) På trods af en øget effektivitet i behandlingen og et øget antal biologiske behandlinger ses der ingen effekt ved ca. 30 % af patienterne, der er i førstegangsbehandling med TNF-α-hæmmere. Samtidig er det kun ca % af de patienter, der prøver en anden biologisk behandling, der oplever en sygdomsforbedring på 70 %. For at mindske risikoen for at udvikle immunitet mod behandlingen er det vigtigt at diagnosticere RA patienter tidligt, at følge sygdommens progression tæt, at identificere patienterne med værst prognose og at vælge en passende behandlingsstrategi. (Polido-Pereira et al., 2011) Side 19 af 104

21 3.0 PROBLEMAFGRÆNSNING Baseret på ovenstående viden er det belyst, at RA er en kronisk inflammatorisk sygdom med store personlige konsekvenser og en betydelig økonomisk udgift for samfundet. Det er en sygdom, hvor ny viden omkring cytokinmiljøet og derved nye behandlingsmetoder er eksploderet de seneste år. Dog er behandlingsmulighederne stadig forbundet med udfordringer, da patienterne kan udvikle bivirkninger og immunitet mod disse. På baggrund af dette vides det, at en tidlig diagnosticering er essentiel for effektiv behandling. På nuværende tidspunkt anvendes de diagnostiske kriterier fra American College of Rheumatology (ACR) til diagnosticering af RA, men der kan være problemer associeret med brugen af disse. For at forbedre diagnosticeringen er det essentielt at forstå de inflammatoriske cellers funktion ved udviklingen af RA, hvor vigtigheden af CD14-, CD4-, CD8-, CD19- og CD56-celler er blevet belyst i ovenstående. Oprensning og karakterisering af disse cellers proteiner er vigtig for at forstå cellernes funktion. Massespektrometri (MS) er en metode, der kan belyse proteiners struktur og funktion ved meget præcist at kunne bestemme massen og sekvensen af et peptid. Metoden kan bruges til at bestemme tilstedeværelsen af posttranslationelle modifikationer, som ikke kan læses ud fra proteinets primære sekvens. Disse posttranslationelle modifikationer giver ofte for lille ændring i forhold til proteinets masse til at blive identificeret ved gelelektroforese alene eller ved andre separationsmetoder. (Baynes & Dominiczak, 2009; Diness Borup, 2010) MS er på nuværende tidspunkt den foretrukne metode til at identificere store mængder proteiner i en celle på (Ong & Mann, 2005). MS kunne derfor være en god måde at få mere information omkring de inflammatoriske celler, som er karakteristiske ved RA og hjælpe med eventuel hurtigere diagnosticering. Ud fra denne betragtning er følgende problemformulering blevet udformet. Hvordan diagnosticeres RA, og hvorledes kan MS anvendes til dette formål? For at søge at besvare problemformuleringen er der anvendt en klinisk og en eksperimentel tilgang. Den kliniske tilgang er baseret på den metode, hvorved RA diagnosticeres på nuværende tidspunkt. Den eksperimentelle er baseret på et forsøg, hvor proteinerne i de inflammatoriske celler søges identificeret ved brug af MS. Side 20 af 104

22 4.0 METODE 4.1 KLINISK METODE Diagnosticering af RA foregår via et standardiseret pointsystem, som er udviklet af American College of Rheumatology, jf. tabel Patienterne får tildelt point alt efter, hvor mange diagnostiske kriterier de opfylder, og hvis patienten får en samlet score større end eller lig med 6 ud af 10 mulige, klassificeres de som havende RA. (Schaffalitzky de Muckadell et al., 2013) I den kliniske metode er der fokuseret på disse ACR-diagnosekriterier og mødet med patienten i klinikken. På Sygehus Vendsyssel blev 2 patienter mødt, som skulle til første undersøgelse med henblik på diagnosticering af RA. Ved at sammenholde anamnesen og den objektive undersøgelse fra de 2 patienter med diagnosekriterierne, blev det undersøgt, hvilken score patienterne havde, og om det derudfra var muligt at diagnosticere dem med RA. Tabel 4.1.1: ACR-klassifikationskriterier for RA, 2010 RF: Reumafaktor, ACPA: Anti-citrullinated protein antibodies, CRP: C-reaktivt-protein, SR: sænkningsreaktion. Tabel fra American College of Rheumatology (Rheumatology.org, 2014) LEDINVOLVERING Det typiske RA-forløb viser sig ved de klassiske symptomer på inflammation. Disse symptomer er ledhævelse, -ømhed, -smerter, -varme og funktionsnedsættelse. Derudover ses ofte morgenstivhed og nedsat muskelstyrke. (Harris et al., 2005; Jacobsen et al., 2012) Rødme ses ikke altid ved RA (Jacobsen et al., 2012). RA kan involvere alle led, men de hyppigste ramte led er håndled, metacarpophalangealled (MCP-led) og proksimale interphalangealled (PIP-led) (Schaffalitzky de Muckadell et al., 2013). Diagnosekriterierne skelner imellem små og store led. De små led inkluderer MCP-led, PIP-led, metatarsophalangealled (MTP-led), interphalangealled af tommelen (IP1) og håndled, og de store led inkluderer skuldre, albuer, hofter, knæ og ankler. (Heller Asmussen et al., 2012) Vurdering af ledinvolvering inkluderer en klinisk undersøgelse af de klassiske symptomer og/eller påvisning af synovitis ved en ultralyd- eller MR-scanning Side 21 af 104

23 (Schaffalitzky de Muckadell et al., 2013). Derudover er det et kriterium, at der skal være fortsat synovitis i de involverede led i over 6 uger (Heller Asmussen et al., 2012) SEROLOGI Reumafaktor (RF) ses hos de fleste patienter med RA. Ved ca. 35 % af patienterne kan RF måles allerede ved sygdommens indtræden, og ved ca. 80 % opstår RF under sygdomsforløbet. RF er dog ikke særlig specifik for RA og findes også hos raske personer, hvor det er tiltagende med alderen. Derudover ses RF også ved andre sygdomme, eksempelvis HIV. (Harris et al., 2005; Jacobsen et al., 2012) RF er autoantistoffer af IgM-, IgA-, IgG og IgE-type med specificitet for Fc-delen af IgG (Harris et al., 2005; Jacobsen et al., 2012). IgM-RF har størst praktisk anvendelse, da den indgår i klassifikationskriterierne for RA (Schaffalitzky de Muckadell et al., 2013). IgA-RF, IgG-RF og IgE-RF er alle associeret med ekstraartikulære manifestationer, og tilstedeværelsen af IgA-RF er associeret med en hurtigt fremadskridende og mere alvorlig sygdom samt knoglenedbrydning (Harris et al., 2005). RF danner immunkomplekser, som aflejres i en række væv ved RA. Disse immunkomplekser bidrager via komplementaktivering formentlig til den inflammatoriske proces. (Jacobsen et al., 2012) RF-koncentrationen afspejler ikke direkte sygdomsaktiviteten, men er i høj koncentration forbundet med en dårligere prognose og en øget forekomst af ekstraartikulære manifestationer (Schaffalitzky de Muckadell et al., 2013). Da RF ikke er særlig specifik, bør måling af IgM-RF kombineres med andre diagnostiske tests heriblandt tests for ACPA, måling af C-Reaktivt Protein (CRP) og sænkningsreaktion (SR) (Harris et al., 2005). I kroppen er citrullinering en normal proces, som foregår ved blandt andet keratinisering af epithelceller, inflammation og apoptose. Ved RA dannes autoantistoffer mod citrullinerede peptider. Ved citrullinering dannes citrullin ud fra arginin via enzymet PAD. De inflammatoriske leukocytter udtrykker isoformer af dette enzym, hvilket betyder, at der ved inflammationen sker en øget citrulinering af peptider. ACPA er lokalt producerede antistoffer, som binder disse citrullinerede peptider, og herved bidrager til den synoviale inflammation. ACPA menes derfor at være direkte involveret i patogenesen af RA. (Baka et al., 2012; Szekanecz et al., 2008) ACPA ses meget tidligt i sygdomsforløbet og kan eventuelt bruges som en forudsigelse af sygdomsaktiviteten af RA (Jacobsen et al., 2012) AKUTFASE REAKTANTER Ved RA sker der en ændring i koncentrationen af specifikke akut-fase proteiner, eksempelvis CRP. CRP produceres i leveren, og er øget i forbindelse med betændelsestilstande i kroppen. Øgede mængder af CRP forværrer sygdomsrelateret vævsødelæggelse og medvirker til udviklingen af yderligere komplikationer, eksempelvis kardiovaskulær sygdom. CRP bruges til påvisning af en betændelsesreaktion og bruges som et diagnostisk kriterium ved RA. IL-6 har størst effekt på akut-fase proteiner, men IL-1, TNF-α, TGF-β og IFN-γ er også medvirkende til dette. (Choy, 2012) Ved RA vil sænkningsreaktion (SR) ofte være forhøjet på grund af f.eks. en forhøjelse af akutfasereaktanter i blodet eller grundet anæmi. SR anvendes som en sensitiv, men uspecifik markør for inflammation. Akutfasereaktanterne i blodet ved en RA patient påvirker erytrocytternes ladningsforhold, hvorved de aggregerer og dermed sænkes hurtigere. Derved ses forhøjet SR ved RA. (Schaffalitzky de Muckadell et al., 2013) 4.2 EKSPERIMENTEL METODE Den eksperimentelle metode fokuserede på et forsøg, hvor MS blev anvendt til at undersøge makrofager, T-celler, B- celler og NK-celler i forskellige RA-patienters blodprøver. Det blev undersøgt, hvor mange proteiner der kunne identificeres ved hver celletype. Desuden blev det undersøgt, om det var muligt at identificere de specifikke CDmarkører ved de forskellige celletyper, som for makrofager er CD14, Th-celler er CD4, Tc-celler er CD8, B-celler er CD19 og NK-celler er CD56 (Agger et al., 2011). Ved opstilling af forsøget blev der taget udgangspunkt i en eksperimentel metode kaldet shotgun proteomics. Shotgun proteomics er en analytisk strategi, som kan bruges til at identificere proteiner i celler. Det er en metode, hvor proteinerne i en prøve med lyserede celler isoleres og spaltes til peptider via en aminosyrespecifik proteolyse. Side 22 af 104

24 Herefter kan peptiderne sekventeres via MS/MS. Peptiderne kan identificeres ved at matche de eksperimentelle spektra med teoretiske spektra. Disse teoretiske spektra er beregnet ud fra humane reference-genomer, der er tilgængelige i internationale databaser. Reference-genomerne bruges til at forudse alle de proteiner, som genomet indeholder, og ud fra dette kan der laves nogle teoretiske spektra af peptiderne. Ved sammenligning mellem de eksperimentelle spektra med de teoretiske spektra kan peptidsekvenserne identificeres. På denne måde kan det bestemmes, hvilke proteiner der er til stede i cellen. Shotgun proteomics er især lovende ved identifikation af posttranslationelle modifikationer af proteiner. (Marcotte, 2007) Princippet bag shotgun proteomics er illustreret på figur Figur 4.2.1: Visualisering af shotgun proteomics metoden. Eksperimentelle spektra opnås ud fra lyserede celler og sammenlignes med teoretiske spektra. Ud fra cellernes genom kan det identificeres, hvilke proteiner der er til stede i cellerne, og herudfra kan der laves teoretiske spektra på disse proteiners peptider FORSØGSPOPULATION I eksperimentet anvendes blodprøver fra to RA-patienter og en rask kontrol. Den første patient, betegnet 1004-α, er en nydiagnosticeret RA-patient med aktiv inflammation. Det er en 65-årig kvinde, som ved diagnosetidspunktet havde en RF-IgM = 169 kiu/l (ref. < 3,5) og en anti-ccp > 340 kiu/l (ref. < 7). Blodprøven blev taget inden påbegyndelse af behandling, således at den er et udtryk for aktiv inflammation. Den anden patient, betegnet 1008-α, er en RA-patient, som har aktiv inflammation på trods af behandling med DMARDs. Det er en kvinde på 58 år, som omkring diagnosetidspunktet havde en RF-IgM = 114 kiu/l (ref. < 3,5) og en anti-ccp > 1000 kiu/l (ref.<7). Blodprøven blev taget før skift fra DMARDs til biologisk behandling. Den raske kontrol er en 22-årig kvinde uden tegn på RA eller anden inflammation FORSØGSOPSTILLING I projektet er der taget udgangspunkt i to forskellige prøveforbredelsesmetoder før MS, henholdsvis gelelektroforesemassespektrometri (Gel-MS) og Filter-Aided Sample Preparation (FASP). Patient 1008-α blev forberedt ved hjælp af gel-ms, mens blodprøver fra patient 1004-α og den raske kontrol blev forberedt ved hjælp af FASP. Ved gel-ms anvendes SDS-PAGE, der er en teknik, hvor proteinerne adskilles i bånd, der udvælges og analyseres individuelt, hvorved kun en andel af proteinerne undersøges. Ved brug af FASP isoleres alle proteinerne i prøven og samtidig er metoden hurtigere end gel-ms. Fordelen ved gel-ms er, at den er mere visuel, og derfor er begge metoder anvendt. For at illustrere eksperimentet er der anvendt et flowchart, jf. figur Hvert trin vil blive beskrevet nærmere og for yderligere gennemgang henvises til laboratoriejournaler, som kan ses i appendix A1, appendix A2 og appendix A3. Side 23 af 104

25 Figur : Flowchart over forsøgsopstilling. De forskellige trin i eksperimentet er vist. Klargøringen til MS kan foregå via enten gel-ms eller FASP BEHANDLING AF BLODPRØVER Blodprøven blev taget i rør indeholdende EDTA, som har en antikoagulerende effekt på blodet (Becton Dickenson and Company, 2010). Blodprøven blev overført til to 50 ml rør, og efterfølgende blev blodet fortyndet med RPMI-medie, som er særligt velegnet til at stabilisere cellemiljøet omkring leukocytterne ( RPMI Media - RPMI-1640 Media Sigma- Aldrich, 2014) CENTRIFUGERING MED HISTOPAQUE OG FILTERRØR Dette er en metode, som anvendes til sortering af lymfocytter fra en blodprøve. Der blev tilført histopaque-1077 i to filterrør, som blev centrifugeret for at få histopaque igennem filteret. Herefter blev blodprøven tilsat. Ved centrifugering blev erytrocytterne presset igennem filteret, hvorved kontaminering af lymfocytterne blev undgået. Efter centrifugering var de forskellige celletyper, histopaque og plasma adskilt, som illustreret på figur Plasma pipetteres væk og trombocytter, leukocytter, histopaque og overskydende plasma fra de to rør hældes sammen i et 50 ml rør. Side 24 af 104

26 Figur : Filterrør med opdeling af de forskellige celletyper før og efter centrifugering. Efter centrifugering er erytrocytterne presset gennem filteret og ligger nederst. Histopaque ligger oven på filteret og derover ligger leukocytter og trombocytter. Øverst ligger plasma. Modificeret udgave fra produktbeskrivelsen Accuspin System-Histopaque-1077 ( Accuspin System-Histopaque-1077, 2003) VASK AF CELLER Efter centrifugeringen bestod prøven af leukocytter, trombocytter, histopaque og overskydende plasma. For at fjerne histopaque og overskydende plasma blev der vasket med RPMI-medie 2 gange. Imellem hver vask blev prøven centrifugeret ved 800 g i 10 minutter ved 4 C og blev efterfølgende dekanteret ned til cellespejlet. Cellerne blev tilført RPMI-medie og overført til eppendorfrør. Herefter blev prøven centrifugeret ved 1800 g i 2 minutter ved 4 C, hvorefter RPMI-mediet blev fjernet SEPARERING MED DYNABEADS I dette eksperiment blev dynabeads anvendt til at adskille celletyperne ud fra deres specifikke cellemarkør via positiv isolation. Til at begynde med blev der tilført isolationsbuffer bestående af PBS uden calcium og magnesium, 0,4 % BSA og 2 mm EDTA til celleopløsningen. Dynabeads med specificitet for CD14-proteinet blev opløst i den samme isolationsbuffer for at ækvilibrere dem i forhold til bufferen. Isolationsbufferen blev fjernet igen fra dynabeads, førend celleopløsningen blev tilføjet og derefter inkuberet i 30 minutter ved 4 C. Herefter blev prøven placeret på en magnet, hvorved cellerne med CD14-markøren blev tiltrukket af magneten. De resterende celler blev pipetteret fra og overført til et nyt eppendorfrør. Separeringen blev gentaget for CD4-, CD8- og CD19-cellerne. Cellerne, som var bundet til dynabeads, blev vasket med isolationsbuffer to gange, og til sidst blev der tilført SDC. SDC øger opløseligheden af hydrofobe membranproteiner og cellemembranen, hvorved cellen lyseres. (Masuda, Tomita, & Ishihama, 2008) Herefter blev cellerne vortexet for at tilskynde opløsningsprocessen. Efterfølgende blev prøverne nedfrosset ved -80 C. Separering af CD56-cellerne var anderledes, idet konjugerede dynabeads for CD56-proteinet ikke var tilgængelige. I stedet blev cellerne overført til et nyt eppendorfrør, hvorefter der blev tilsat IgG-antistoffer, som var specifikke for CD56-proteinet. Eppendorfrøret blev inkuberet i 10 minutter ved 4 C i en rotator. Herefter blev prøven centrifugeret ved 1800 g i 2 minutter. Supernatanten blev fjernet, og der blev tilført isolationsbuffer, hvorved celle-pelletten blev opløst. Dette vasketrin blev gentaget, og herefter blev dynabeads tilført. Disse dynabeads binder specifikt til IgGantistofferne for CD56-proteinet, og derved kunne de bruges til at selektere CD56-cellerne. Dynabeads blev klargjort ved at blive opløst i isolationsbuffer. Efterfølgende blev isolationsbufferen fjernet fra røret med dynabeads, og opløsningen med celler og antistoffer blev tilsat. Opløsningen blev inkuberet i 20 minutter ved 4 C, hvorefter CD56- Side 25 af 104

27 cellerne kunne isoleres ved hjælp af en magnet. Overskydende celler og isolationsbuffer blev fjernet. Til sidst blev SDC tilsat, og opløsningen blev vortexet, hvorefter den kunne nedfryses ved -80 C. Herefter kunne de isolerede celletyper klargøres til MS via gel-ms eller FASP. Separeringen med dynabeads er illustreret i figur Figur : Visuel fremstilling af separering med dynabeads. CD14-, CD4-, CD8- og CD19-cellerne separeres med dynabeads, som er koblet med antistoffer, der er specifikke for de forskellige CD-markører. CD56-cellerne separeres ved først at tilsætte IgG-antistoffer, som er specifikke for CD56- proteinet og derefter tilføre dynabeads, der binder til IgG-antistofferne GELELEKTROFORESE-MASSESPEKTROMETRI Som nævnt anvendes SDS-PAGE ved gel-ms, som er en metode, hvor proteiner adskilles efter deres elektroforetiske mobilitet. Denne mobilitet afhænger af molekylets masse, struktur og ladning. Ved elektroforesen udsættes gelen for et elektrisk felt, hvilket får de negativt ladede proteiner til at migrere ned igennem gelen mod anoden. Proteinerne vandrer med varierende hastigheder gennem gelen afhængig af deres størrelse og størrelsen på gelens porer. Porestørrelserne er afhængige af akrylamidkoncentrationen i gelen. (Oswald, 2008) Før elektroforesen blev der tilføjet en sample buffer indeholdende Tris-HCl, glycerol, bromophenol blue og SDS. SDS er en anionisk detergent, som kan opløse hydrofile molekyler, og som samtidig har en negativ ladning tilknyttet sig. Derfor kan den bryde cellemembraner og opløse proteinerne samt give disse en negativ ladning, der overdøver proteinernes egen ladning. (Davidson College Department of Biology, 2001) Mængden af SDS, der bindes til proteinet, er proportionel med proteinets størrelse og herved er proteinets ladning proportionel med proteinets masse (Mullins, 2002). Udover samplebufferen blev der også tilført DTT, som er et reduktionsmiddel. DTT har til funktion at bryde disulfidbindingerne, som gør, at proteinerne mister en stor del af deres stabilitet, hvilket resulterer i udfoldning af proteinerne, der får en lineær struktur (Diness Borup, 2010). Efterfølgende stod prøverne i en varmeblok i 5 minutter ved 78,7 C, hvilket destabiliserede proteinerne yderligere. Ved polyakrylamid gelelektroforesen blev der benyttet et laemmli gelelektroforese-system. Der blev anvendt en færdigstøbt 12 % polyakrylamid gel, som blev placeret i det indre kammer. SDS-PAGE running buffer blev hældt i både det indre og det ydre kammer, og fungerede afkølende samt strømledende. Derefter blev en SeeBlue Prestained Side 26 af 104

28 Standard-markør og prøverne loadet i brøndene. Elektroforesen kørte på 157 volt i 30 minutter til båndene nåede bunden af gelen. Efterfølgende blev Coomassie stain anvendt til at visualisere proteiner, og herefter affarves gelen med destain, som består af metanol. Dette førte til, at proteinerne i gelen blev farvet blå, hvorved gelbåndene blev tydelige og klar til udskæring UDSKÆRING OG VASK For at undersøge de forskellige proteiner, blev de individuelle bånd skåret ud af gelen og overført til nye eppendorfrør, hvor de blev skåret i mindre stykker. Disse trin blev gentaget, indtil alle ønskede bånd var udskåret. Der blev udskåret 4 bånd for hver celletype, og gelstykkerne blev vasket for at trække farven ud. Dette blev gjort ved først at tilføre triethylammoniumbicarbonat-buffer. Efter centrifugering blev bufferen pippetteret fra, og der blev tilført en opløsning af acetonitril og triethylammoniumbicarbonat-buffer. Dette trin blev gentaget. Derefter blev der tilsat 100 % acetonitril til hvert eppendorfrør. Efter udtømning stod eppendorfrørene åbne, så rester af acetonitrilen kunne fordampe. Efter vasken kunne reducering og alkylering foretages REDUCERING OG ALKYLERING Reducering blev opnået ved tilførelse af en opløsning af DTT og triethylammoniumbicarbonat-buffer. Efterfølgende blev der tilført en opløsning af triethylammoniumbicarbonat-buffer og iodoacetamid for at alkylere peptiderne. Iodiacetamid er lysfølsomt, og derfor blev prøverne pakket ind i sølvpapir. Herefter blev der vasket med triethylammoniumbicarbonat/acetonitril-opløsningen og ren acetonitril. Acetonitril blev fjernet fra prøverne ved fordampning i en vakuum-centrifuge FORDØJELSE Ved dette trin blev proteinerne enzymatisk nedbrudt til et stort antal peptider ved at tilføre en opløsning af triethylammoniumbicarbonat og trypsin. Trypsin bryder peptidbindingerne ved de to basiske aminosyrer arginin og lysin (Tymoczko et al., 2011). Efterfølgende blev der tilført triethylammoniumbicarbonat-buffer for at sikre, at prøverne ikke tørrede ud. Prøverne blev sat ind i en inkubator ved 37 C natten over. Herefter blev der tilført 5 % myresyre for at stoppe reaktionen. Der blev lavet ekstraktion af peptiderne ved at tilføre acetonitril, og efterfølgende blev prøverne tørret i en vakuum-centrifuge, indtil væsken var fordampet. Til sidst blev der tilført en opløsning med 2 % acetonitril og 0,1 % myresyre, og prøverne blev sat på frys indtil udførsel af MS ISOLATION AF PROTEINER VED HJÆLP AF FILTER-AIDED SAMPLE PREPARATION FASP er en metode, hvor der anvendes et spin-filter til at filtrere proteinerne i en prøve. Efter separeringen med dynabeads blev der tilført en opløsning af 5 % SDC og 50 mm triethylammoniumbicarbonat til cellerne, hvorved cellerne blev lyseret. Efterfølgende var trinene de samme som efter gel-ms med reducering, alkylering og fordøjelse, jf. figur , men disse blev udført i et spin-filter med en porestørrelse på 10kDa. Reduceringen foregik med TCEP (tris(2-carboxyethyl)phosphine), og efter centrifugering blev der tilført iodoacetamid for at alkylere cysteinerne. Derefter blev der tilført trypsin og fordøjelsesbuffer, indeholdende SDC og triethylammoniumbicarbonat. Dette blev inkuberet ved 37 C natten over. Spin-filteret blev overflyttet til et opsamlingsrør, og efter centrifugeringen var peptiderne samlet heri. Til peptiderne blev der tilført ethylacetat og TFA. Ethylacetat er et organisk opløsningsmiddel, som kan opløse SDC. Efter centrifugering skete der en faseadskillelse, hvor peptiderne var i vandfasen. Peptiderne i vandfasen blev overført til eppendorfrør, og blev herefter tørret i en vakuum-centrifuge. De tørrede prøver fik tilsat loading buffer, som indeholder 2 % acetonitril og 0,1 % myresyre, hvorefter de blev frosset ned og var klar til MS MASSESPEKTROMETRI I dette eksperiment blev Q Exactive - Hybrid Quadrupole Orbitrap Mass Spectrometry anvendt. Opsætningen er et tandem massespektrometer, LC-MS/MS og mere specifikt en UPLC-MS/MS-maskine. Ved MS/MS anvendes quadrupolen som selektionsisolering af ioner (MS1) og orbitrappen anvendes som masseanalysator (MS2), jf. figur Imellem disse findes en HCD-celle, hvor der sker en fragmentering af peptiderne. MS1 selekterer ioner, som ønskes fragmenteret. I MS2 bliver ioner detekteret, og gennem matematiske analyser via Fourier Transformation Side 27 af 104

29 bliver der lavet et m/z-spektrum ud fra de detekterede ioner i orbitrappen. (Kielberg & Rasmussen, 2005) I det følgende forklares MS i yderligere detaljer. Figur : Skematisk opbygning af Q Exactive Massespektrometer. De forskellige komponenter i MS/MS er vist. Ionerne overføres til MS ved hjælp af UPLC-kolonnen og elektrospray. Efter detektering i iontrappen kan der, ved hjælp af Fourier Transformation, dannes spektra. Modificeret udgave fra Planet Orbitrap ( Q Exactive, Hybrid Quadrupole Orbitrap Mass Spectrometer, 2014) ULTRA-PERFORMANCE LIQUID CHROMATOGRAPHY Ultra-performance liquid chromatography (UPLC) er en metode, hvor peptiderne overføres gradvist til massespektrometret gennem en UPLC-kolonne. UPLC-teknologien virker efter de samme principper som highperformance liquid chromatography (HPLC), men foregår under højere tryk. HPLC og brug af modsat fasekromatografi er en metode, der anvendes til at separere peptider efter, hvor hydrofobe eller hydrofile de er. Peptiderne indføres i en kolonne, som har en overfladebelægning med C18-materiale, der binder peptider. Jo mere hydrofobe de er, des mere fast er de bundet til kolonnen. Peptiderne frigøres igen fra kolonnen ved at tilføre en opløsning af acetonitril og loading buffer. Der tilføres gradvist, efter en indstillet gradient, mere acetonitril til opløsningen over tid, hvorved opløsningen bliver tilsvarende mere hydrofob. De hydrofile peptider frigøres således først, hvorefter de hydrofobe peptider frigøres. Meget hydrofile peptider passerer direkte igennem kolonnen. På denne måde separeres peptiderne, inden de når frem til elektrospraytippen. (Steen & Mann, 2004) Forskellen på UPLC og HPLC er, at UPLC en anvender et højere tryk. HPLC-kolonner kan tåle et maksimum tryk på 400 bar, mens UPLC-kolonnen kan tåle et tryk på op til 1000 bar eller mere. (Roge, Firke, Dhane, Gunjkar, & Vadvalkar, 2011) Ved et højere tryk opnås en højere hastighed af analysen. Derudover kan UPLC en anvende en partikelstørrelse mindre end 2 µm i separationskolonnen, hvilket giver mulighed for bedre separation end i HPLC en, som anvender en partikelstørrelse på 5 µm. (Gumustas, Kurbanoglu, Uslu, & Ozkan, 2013; Swartz, 2005) ELEKTROSPRAY IONISERING Elektrospray ionisering (ESI) er en metode, som bruges til at overføre molekyler til gasform. Ved ESI ioniseres proteiner eller peptider, og samtidig overføres ionerne fra væskefase til gasfase. Denne proces kan groft set inddeles i tre trin: 1) Dannelse af ladede dråber, 2) Reduktion af dråbernes størrelse og 3) Frigivelse af ionerne til gasform, jf. figur Ved det første trin dannes der ladede dråber ved, at der sker en ionisering af peptiderne, som herefter sprayes gennem elektrospraynålen. Ioniseringen af peptiderne sker ved tilføjelse af protoner, hvorved peptiderne bliver Side 28 af 104

30 positivt ladede. (Kebarle & Verkerk, 2009) Trypsin blev brugt til at kløve proteinerne til peptider, jf. afsnit , hvilket førte til brydning af peptidbindinger ved aminosyrerne arginin og lysin, der begge er basiske og lokaliseret i C- terminalen (Tymoczko et al., 2011). Deres basiske egenskaber faciliterer ionisering ved let at binde en proton, hvorved peptidet bliver positivt ladet (Kebarle & Verkerk, 2009). Derudover har loading bufferen en lav ph, der betyder, at N- terminalen også protoneres, hvorved peptiderne bliver enkelt- eller multiladet (Kielberg & Rasmussen, 2005). Det elektriske felt påvirker elektrospraynålen, hvori opløsningen med peptiderne er. Denne påvirkning gør, at opløsningen polariseres ved væskemenisken, der ligger ud for spraynålen. Desuden gør det, at de positive ioner vil lægge sig i meniskens overflade, og at de negative ioner vil bevæge sig væk fra meniskens overflade. Det negative felts påvirkning af de positive ioner resulterer i, at en dråbe frigives. (Kebarle & Verkerk, 2009) Ved det andet trin fordamper væsken kontinuerligt ved opvarmning, hvilket fører til en reduktion i dråbens størrelse og dermed et mindsket overfladeareal. Frastødningen mellem de positivt ladede ioner fører til fission af dråben, hvorved mindre dråber dannes. (Kebarle & Verkerk, 2009) Efter en række af disse trin sker der en frigivelse af ionerne til gasfase, når der ikke længere er væske tilbage. Der er usikkerhed omkring, hvordan dette trin forløber, men en model kaldet Charged residue model synes at forklare denne frigivelse. Modellen beskriver frigivelsen som et resultat af gentagen fission af de dråber, der frigives fra elektrospraytippen. Dråben bliver ved med at fissionere, indtil der til sidst kun er et peptid i en dråbe. Dette peptid bliver til en fri ion i gasfase, som beholder dråbens positive ladning, idet resten af opløsningen fordamper. (Kebarle & Verkerk, 2009) De ladede ioner i gasfase accelereres videre ind i quadrupolen (Hu et al., 2005). Figur : Elektrospray ionisering. Ionerne overføres fra væske- til gasform ved charged residue modellen. Ionerne får samtidig en ladning. Tilpasset fra forskellige kilder QUADRUPOL En quadrupol er et massefilter, der er ansvarlig for selektion af ioner baseret på deres masse/ladnings-ratio. Quadrupolen kan bruges til tre funktioner, guide-quadrupol, transport-quadrupol og opbevarings-quadrupol. (Hu et al., 2005) De positive ioner flytter sig i guide-quadrupolen ved hjælp af et radiofrekvensfelt. Derefter kommer ionerne ind i transport-quadrupolen og opbevarings-quadrupolen. (Hu et al., 2005) Disse består af fire cylindriske metalstænger, der ligger symmetrisk parallelt med hinanden, jf. figur Metalstængerne fungerer som elektroder med et elektrisk felt omkring dem. To af stængerne har en positiv ladning, mens de to andre stænger har en negativ ladning. Elektroderne kan have to spændinger, jævnstrøm (DC) og vekselstrøm (AC), hvor AC har en radiofrekvens. De anvendte spændinger påvirker forløbet af ionerne, der vandrer mellem de fire stænger. For de givne DC- og AC-spændinger vil kun ioner med et bestemt masse/ladningsforhold passere gennem quadrupolfiltret, og alle andre ioner vil afbøjes fra deres oprindelige bane. Små ioner vil være i stand til at følge den varierende AC-komponent af feltet. Hvis de ikke stabiliseres, vil de svinge med stor amplitude, indtil de støder på en af de positive stænger og derved mister deres ladning. Derfor vil de positive metalstænger fungere som High-pass mass filter, hvor kun ioner med høj masse passerer gennem quadrupolen uden at kollidere med de positive metalstænger. De negative metalstænger fungerer som et Low-pass mass filter, hvor kun ioner med en lille masse vil passere igennem uden at ramme de negative metalstænger. De større ioner vil vandre mod de negative metalstænger, som er negative på Side 29 af 104

31 grund af DC, mens små ioner hurtigt vil blive stabiliserede af AC. Således kan man ved et passende valg af AC/DCratioen bestemme, hvilken ionmasse der kan passere gennem quadrupolen. (University of Michigan, 2008) Figur : Filtrering af ioner gennem quadrupol. Ionerne bliver selekteret gennem quadrupolen på baggrund af deres ladning og masse. Dermed kommer kun ioner med en bestemt masse videre til HCD-cellen. Figuren er tilpasset fra forskellige kilder HIGHER COLLISIONAL DISSOCIATION-CELLE Ioner ledes fokuseret ind i C-trappen og over i en Higher Collisional Dissociation-celle (HCD-celle). I HCD-cellen støder de sammen med nitrogen, hvilket medfører, at ionerne får en øget energi. Den eneste måde, de kan frigive denne energi på, er at dele sig i fragmenter, hvor den ene forbliver positiv ladet, mens den anden bliver neutral. Ved tilførsel af energi fragmenteres peptiderne, førend de kommer ind i orbitrappen. Peptidbindinger er de mest følsomme og brydes derfor hyppigst ved fragmenteringen, men andre bindinger kan også brydes, hvilket kan gøre spektrummet meget komplekst. Et peptid brydes som oftest kun en gang, men der kan være mange forskellige versioner af det samme peptid. Hvis N-terminalen beholder ladningen opstår der a-, b- og c-ioner alt efter, hvor spaltningen sker. Hvis C-terminalen beholder ladningen, dannes der x-, y-, og z-ioner, jf. figur Ved HCD-cellen dominerer dannelsen af y- og b-ioner. (Kielberg & Rasmussen, 2005) Efter HCD-cellen føres fragmentionerne tilbage til C-trappen, hvor de akkumuleres og afgiver deres bevægelsesenergi. Fragmentionerne bliver fokuseret i C-trappen og skudt ind i orbitrappen, hvor de detekteres. (Wieghaus et al., 2008) Figur : Peptidfragmentering Roepstorff og Fohlman indførte en nomenklatur for fragmenternes tilhørsforhold til peptidet. Hvis ladningen hører til C-terminalen dannes der x-, y- og z-ioner, og hvis ladningen hører til N-terminalen dannes der a-, b- og c-ioner. Modificeret udgave fra Proteiner - oprensning og karakterisering (Kielberg & Rasmussen, 2005) ORBITRAP Orbitrappen består af 2 elektroder; en indre elektrode og en ydre elektrode. Ionerne sendes ind i orbitrappen med høj bevægelsesenergi og fokuseret kurs fra HCD cellen, hvor de fanges og svinger langs det elektriske felt, som genereres af orbitrappen. Herved cirkulerer ionerne omkring den indre elektrode i ellipseformede baner. Ionerne bevæger sig samtidig frem og tilbage langs den indre elektrodes akse og derved er deres bevægelsesbaner helix-formede. Ionerne svinger gennem orbitrappen med en frekvens, der afhænger af masse og ladning. Denne frekvens er uafhængig af Side 30 af 104

32 energien og den fysiske spredning af ionerne. Frekvensen af de harmoniske svingninger detekteres af den ydre elektrode, hvis signaler transformeres gennem Fourier Transformation til m/z-spektra. ( About the Technology, 2014; Hu et al., 2005) SPEKTRA Fourier Transformation kan ud fra en matematisk analyse lave spektra ud fra de detekterede svingninger i iontrappen. Ionerne detekteres, digitaliseres og konverteres ud fra tidsdomænet ved hjælp af Fourier Transformation til en frekvens og derefter til spektra, som viser intensitet og m/z. (Michalski et al., 2011; Scigelova, Hornshaw, Giannakopulos, & Makarov, 2011) Denne teknik er nødvendig for at få vendt rådata fra orbitrappen til spektra. Spektra vises ved et (x,y)-diagram, hvor hver top i diagrammet repræsenterer ionens specifikke masse til ladningsforhold (m/z), som ses på x-aksen. Højden af toppen beskriver intensiteten af ionen, som ses på y-aksen. (Reusch, 2013) Et MS/MS-spektrum er lettest at tolke, hvis peptiderne er spaltet af trypsin, idet trypsin spalter ved lysin eller arginin. Dette gør, at peptidernes C-terminale ende bliver basisk, og at den positive ladning præferentielt ender på det C-terminale fragment. Ved yderligere spaltning i HCD-cellen giver C-terminalens positive ladning ophav til y-ioner på bekostning af b-ioner, som bliver neutralt ladet. (Kielberg & Rasmussen, 2005) SOFTWARE Data fra de forskellige spektra blev analyseret ved hjælp af softwareprogrammet Proteome Discoverer 1.4 fra Thermo scientific. Proteome Discoverer bruges til at opsætte et workflow, hvorudfra data analyseres. I dette workflow vælges eksempelvis at bruge programmet Mascot. Mascot er en softwarepakke fra Matrix Science, som sammenligner observerede spektra med en database over kendte proteiner og bestemmer det mest sandsynlige match. Når Mascot sammenligner teoretiske- og eksperimentelle spektra, bruger den en sandsynlighedsbaseret scoring, hvorved det er muligt at vurdere, om et resultat er signifikant eller ej. Den samlede score er sandsynligheden for, at det observerede match er en tilfældig begivenhed. Jo højere scoren er, des lavere sandsynlighed for, at det match er en tilfældig begivenhed. En score større end 67 anses som værende signifikant, idet det svarer til en sandsynlighed på mindre end 5 %. ( Scoring - Mascot Probability Based Scoring, 2014) Mascot angiver også coverage. Coverage er et procentvis mål for, hvor stor en del af proteinets aminosyresekvens der er identificeret (Thermo Fisher Scientific, 2009). Mascot tager udgangspunkt i en database for proteinsekvenser fra UniProt. UniProts databaser har til formål at give alle kendte relevante oplysninger om et bestemt protein ( About UniProt, 2014). Det blev via programmet Proteome Discoverer valgt, at der i UniProt kun skulle tages udgangspunkt i det humane genom. Side 31 af 104

33 5.0 DATABEHANDLING Ud fra patientkonsultationerne blev der ved hjælp af ACR-diagnosekriterierne beregnet en totalscore for hver patient, som blev anvendt i vurderingen af, hvorvidt patienten kunne diagnosticeres med RA. Der blev kigget på blodprøvesvar, og værdier, som var uden for referenceværdien, blev angivet. Gelelektroforesen blev sammenlignet med standardmarkøren, og ud fra dette kunne det vurderes, hvilke proteinbånd der kunne identificeres i gelen. MS-resultaterne for de prøver, der blev forberedt ved gelelektroforese, kan ikke sammenlignes med FASP-metoden. Dette skyldes, at det er to forskellige metoder, som ender ud i forskellige data. Ved gel-ms udvælges nogle proteiner, mens alle proteiner analyseres med FASP. Derfor blev MS-resultaterne for gel- MS ikke vist. For at validere prøveforberedelsesmetoden blev der ved hjælp af Proteome Discoverer genereret et cirkeldiagram, hvor det kunne ses, hvor effektiv kløvningen med trypsin havde været. Dette cirkeldiagram blev lavet for en af CDmarkørerne. For at undersøge for fejlkilder blev der søgt efter keratin i prøverne, da dette er en hyppig kontaminant. For at validere resultaterne var det vigtigt at bekræfte, at det er den rigtige celletype, der blev isoleret. For at bekræfte dette blev det undersøgt, om cellernes respektive CD-markør kunne genfindes i data fra MS. Dette blev gjort ved at søge efter proteinerne i Proteome Discoverer. Herefter kunne CD-markørernes score og coverage sammenlignes. For at sikre, at der var statistisk signifikans for, at CD-markørerne reelt blev set i cellen, blev grænsen for en accepteret score sat til 100. For øvelsens skyld blev det undersøgt, om det var de rigtige peptider, der blev fundet ved dataanalysen. Dette kunne gøres ved at analysere spektrummet manuelt. Aminosyresekvensen blev beregnet ved at trække y-ionerne fra hinanden og sammenligne med en tabel over aminosyrernes masse. Der blev taget udgangspunkt i CD-markørerne fundet med størst og lavest score. Efterfølgende kunne de fundne aminosyresekvenser indsættes i NCBI-Blast, hvorved det kunne undersøges, om de var specifikke for proteinet. NCBI- Blast er et program, hvor den fundne aminosyresekvens kan sammenlignes med andre proteiner, som også indeholder denne sekvens. Det var intentionen at sammenligne de identificerede proteiner for patient 1004-α med den raske kontrol ved hjælp af programmet Proteome Discoverer. For at sammenligne dette kunne et Venn-diagram udarbejdes for de forskellige celletypers proteiner. Dette ville have vist, hvor mange proteiner cellerne havde tilfælles, og hvor mange der var specifikke for cellerne. Til udarbejdelsen af Venn-diagrammet ville det være blevet valgt, at det udelukkende var de proteiner, der havde en score på over 100, som blev medregnet. For at lave en yderligere sammenligning af de identificerede proteiner kunne programmet Progenesis være blevet anvendt til at vurdere, om de specifikke proteiner var opreguleret eller nedreguleret i cellerne hos RA-patienten i forhold til kontrollen. På grund af mangel på resultater fra kontrollen var det ikke muligt at lave en sammenligning. I stedet blev den syge patients celletyper sammenlignet med hinanden. Side 32 af 104

34 6.0 RESULTATER I det følgende er de indsamlede data fra både patientkonsultationerne og proteom-analysen præsenteret. 6.1 PATIENTKONSULTATIONER Patient nummer 1 var en mand på 84 år, der blev henvist fra ortopædkirurgisk afdeling på grund af mistanke om RA. Det var en patient med smerter, hævelse og funktionsnedsættelse af venstre hånd, men leddene var ikke varme. Patienten havde haft disse symptomer i 5 måneder. For at be- eller afkræfte, at der var synovitis i håndens led, blev der foretaget en ultralydsscanning. Der var ikke synovitis i leddene, men derimod en subkutan hævelse i hele hånden. For yderligere information, se journaloptagelsen i appendix A4. Blodprøverne viste en normal RF, og anti-ccp var ukendt. CRP var normal, og SR var ukendt. P-urat viste en værdi på 0,15 nanomol/l (ref.: 0,23-0,48 nanomol/l). Alle blodprøvesvar kan ses i appendix A6. Patienten scorer 0 point ved ledinvolvering. Symptomvarigheden var 5 måneder, og derfor scorer han 1 point. Desuden scorer han 0 point ved serologi og akutfasereaktanter. Dette giver patient nummer 1 en samlet score på 1 point. Se tabel Patient nummer 2 var en kvinde på 74 år, som blev henvist fra egen læge på grund af mistanke om RA. Patienten har tidligere haft en pulmonal cancer med metastaser til columna, men på dette tidspunkt var canceren i bero. Patienten beretter om aktuel ømhed, hævelse og rødme i 3. og 4. MCP-led samt 3. og 4. PIP-led på venstre hånd. Patienten har haft disse turevise smerter gennem et halvt års tid. Ved objektiv undersøgelse blev der set funktionsnedsættelse i 3. og 4. MCP-led og 3. og 4. PIP-led på venstre hånd. Ved palpation kunne der mærkes væske i og omkring leddene. Ultralyd af 3. og 4. MCP-led på venstre hånd viste øget synovialvæske i leddene. Derudover oplevede patienten smerte i 1. MTP-led, jf. figur 6.1.1, på både venstre og højre side ved palpation. For yderligere information se journaloptagelse i appendix A5. Blodprøven viste en RF på 84 klu/l (ref. <5) og en anti-ccp på 92 ku/l (ref. <10). Derudover ses også basisk fosfatase på 232 U/L (ref.: U/L). Lymfocyttallet var 1,14*10 9 pr. L. (ref.: 1,30-3,5 * 10 9 pr. L). Alle blodprøvesvar kan ses i appendix A7. I forhold til diagnosekriterierne scorer patienten 3 point i ledindvolvering, da mere end fire små led var involveret. Blodprøverne viste forhøjet anti-ccp og RF, hvilket giver 3 point. Derudover var CRP også forhøjet, hvilket giver 1 point. Da symptomvarigheden var over 6 uger, scorer hun også 1 point. I alt giver det en totalscore på 8 point, se tabel Figur 6.1.1: Ledinvolvering for patient nummer 2 De involverede led for patient nummer 2 er markeret. Disse omfatter 3. og 4. MCP-led og 3. og 4. PIP-led på venstre side samt 1. MTP-led på både højre og venstre side. Modificeret udgave af figur 4.1 fra Reumatologi (Jacobsen et al., 2012) Side 33 af 104

35 Tabel Pointfordeling hos patient 1 og patient 2 Pointfordelingen for patient nummer 1 vises med en grøn cirkel, og pointfordelingen for patient nummer 2 vises med en rød firkant. 6.2 GELELEKTROFORESE-MASSESPEKTROMETRI Gel-MS blev udført for prøverne udtaget fra patient 1008-α. Celletyperne blev isoleret og efterfølgende blev proteinerne fraktioneret ved gelelektroforesen, som vist på figur Disse bånd navngives med tallene 1, 2, 3 og 4. Figur 6.2.1: Billede af gel-ms Separation af proteiner fra CD14-, CD4-, CD8-, CD19- og CD56-celler ved gelelektroforese. De markerede områder på gelen viser de udskårne stykker. Bånd 1 ses ved 62 kda (Thermo Fisher Scientific Inc., 2014). Side 34 af 104

36 6.3 VALIDERING AF METODE Proteome Discoverer genererede et cirkeldiagram, hvor det kan ses, hvor effektiv kløvningen med trypsin var ved CD4-cellens proteiner. På figur ses det, at 75,99 % af proteinerne er fuldendt kløvede. Ved 20,18 % mangles én kløvning og ved 3,83 % mangles to kløvninger. Figur 6.3.1: Kløvning af CD4-cellens proteiner 75,99 % af proteinerne har ingen manglende kløvninger, 20,18 % mangler én kløvning og 3,83 % mangler to kløvninger. Ved undersøgelse for kontaminering blev der fundet keratin i alle celleprøverne med en score over PROTEINER IDENTIFICERET VED MASSESPEKTROMETRI Der vises i det følgende afsnit resultater fra patient 1004-α. Data blev indhentet fra hver af de fem separerede celletyper: CD4, CD8, CD14, CD19 og CD56. De forskellige CD-markøres score og coverage er vist i tabel På grund af tidsrammerne for dette projekt, blev der ikke udført MS på den raske kontrol. Tabel 6.4.1: CD-markører fundet i cellerne. De forskellige CD-markører er vist, og for hver CD-markør er der angivet score, coverage og antallet af unikke peptider, hvorudfra proteinet er identificeret. Celletype Celleproteiner Score Coverage Unikke peptider CD14 CD ,71 44,80 % 14 CD4 CD4 57,84 4,15 % 2 CD14 207,34 16,90 % 2 CD8 CD8 705,57 22,73 % 5 CD14 113,49 9,86 % 1 CD19 CD19 222,53 2,34 % 1 CD14 109,61 9,86 % 1 CD56 CD14 166,31 18,78 % 2 Side 35 af 104

37 6.5 VALIDERING AF IDENTIFICEREDE SPEKTRA Ved MS havde CD4-proteinet en score på 57,84. Proteinet blev identificeret ud fra to peptider. Spektra for de to peptider er vist i figur og figur Ud fra disse to spektra kunne de to peptiders aminosyresekvens findes. De to peptider havde en ion-score på henholdsvis 26 og 21. Figur 6.5.1: MS/MS-spektrum for aminosyresekvensen for peptid 1 fra CD4-markøren Aminosyresekvensen for peptidet er angivet i venstre hjørne. I spektrummet er identificeret y1, y2, y6 og y9 og en enkelt b-ion. På x-aksen ses m/z, og på y-aksen er intensiteten vist. For større illustration af spektrummet se appendix A8. Figur 6.5.2: MS/MS-spektrum for aminosyresekvensen for peptid 2 fra CD4-markøren. Aminosyresekvensen for peptidet er angivet i venstre hjørne. Der er identificeret y1, y3-y6, y5++ og en enkelt b-ion. På x-aksen ses m/z, og på y-aksen er intensiteten vist. For større illustration af spektrummet se appendix A8. For peptid 1 er aminosyresekvensen GNQGSFLT identificeret, og for peptid 2 er ITFDL identificeret. For beregning se appendix A10. Ved NCBI-Blast blev det vist, at både peptid 1 og peptid 2 var specifikke for CD4-proteinet, jf. appendix A11. CD14-proteinet havde en score på 2448,71 og blev identificeret ud fra 14 unikke peptider. Spektrummet for en af CD14 s peptider er vist i figur CD14-peptidet havde en ion-score på 85,7, og ved spektrummet var massepræcisionen 1,3 ppm. Derudover ses der en ubrudt række af 9 y-ioner, jf. appendix A9. Side 36 af 104

38 Figur 6.5.3: MS/MS-spektrum for aminosyresekvens fra CD14-markøren. Spektrum for et af CD14-markørens peptider. Der ses en række af y-ioner. På x-aksen ses m/z, og på y-aksen er intensiteten vist. For peptidet blev der identificeret MPPLPLEATGLAL, jf. appendix A10. Ved indsættelse af den givne aminosyresekvens i programmet NCBI-Blast database sås det, at størstedelen af peptiderne tilhørte CD14 proteinet, jf. appendix A SAMMENLIGNING AF IDENTIFICEREDE PROTEINER Proteinerne i de forskellige celletyper for patient 1004-α blev sammenlignet via et Venn-diagram for CD14-, CD4-, CD8- og CD19-cellerne. CD56-cellerne er ikke medtaget, da CD56-proteinet ikke kunne identificeres i cellerne ved separering. I CD14 ses der 419 specifikke proteiner, som kun ses ved denne celletype, ved CD4 ses der 501, ved CD8 ses der 255 og ved CD19 ses der 244. Disse fire celletyper har 1106 proteiner tilfælles, jf. figur Figur 6.6.1: Venn-diagram for CD14-, CD4-, CD8- og CD19-celler. Antallet af proteiner, som de enkelte celletyper har tilfælles, samt de proteiner der kun er udtrykt i hver enkelt celletype. Side 37 af 104

39 For at lave en yderligere sammenligning kunne nogle proteiner udvælges, og via programmet Progenesis kunne det undersøges, om de var op- eller nedreguleret i de forskellige celletyper hos patient 1004-α. Der er taget udgangspunkt i proteinerne TNF-α-induceret protein 2 og Pro-IL-16. I figur og figur vises den relative mængde af TNF-αinduceret protein 2 og pro-il-16 i de forskellige celler fra patient 1004-α. Figur 6.6.2: TNF-α-induceret protein 2 Den relative forskel i mængden af TNF-α-induceret protein 2 i de forskellige celletyper ved patient 1004-α. Figur 6.6.3: Pro-IL-16 Den relative forskel i mængden af pro-il-16 i de forskellige celletyper ved patient 1004-α. Side 38 af 104

40 7.0 DISKUSSION 7.1 KLINISKE RESULTATER Patient nummer 1 havde en score på 1, og han har derved ikke opnået nok point til at blive diagnosticeret med RA. Hans P-urat var for lav, og det kan derved også udelukkes, at der er tale om urinsyregigt. Det tyder på, at patienten har en anden ikke-reumatisk lidelse, der giver subkutan hævelse i hele hånden. Patient nummer 2 havde en score på 8, og dermed havde patienten point nok til at få stillet diagnosen RA. Både anti- CCP og RF var meget forhøjede, hvilket giver en god indikation for denne diagnose. Patienten blev dog stadig ikke sat i behandling, da lægen først ville sikre, at der ikke var en anden underliggende årsag. Dette kunne f.eks. være den pulmonale cancer, som gav et immunrespons, der kom til udtryk i leddene. Hvis ikke der blev fundet en anden underliggende årsag, ville der højst sandsynligt blive opstartet en behandling med DMARDs, hvis denne ikke interagerede med anden behandling. Patienten havde en let forhøjet basisk fosfatase. Dette er et tal, der bruges til at vurdere knogledestruktion, og kan være et tegn på RA eller knoglemetastase (Hornung, Hansen-Nord, Gerdes, & Kjeldsen, 2014). I forhold til ACR-kriterierne er der således fokus på to patienter, hvor den ene kan diagnosticeres med RA, mens den anden patient ikke kan. Det kan dog diskuteres, hvor gode ACR-kriterierne er til at diagnosticere RA. Fordelene ved kriterierne er, at de er simple og let tilgængelige. Derudover er de billige, idet de kun kræver en blodprøve og en undersøgelse foretaget af en reumatolog. Da der er så fastsatte kriterier for, hvornår en patient må diagnosticeres med RA, kan det undgås, at patienter med andre sygdomme får stillet RA som fejldiagnose. En ulempe ved metoden er, at den i høj grad afspejler subjektivitet, idet de første kriterier omkring ledinvolvering hviler på lægens subjektive vurdering. En anden ulempe ved at benytte ACR-kriterierne er, at patienter skal opfylde nogle meget faste kriterier, før de kan få stillet diagnosen RA. Dette kan føre til, at patienterne bliver sendt hjem, indtil de får flere symptomer, hvorefter de kommer tilbage på afdelingen. Samtidig kræver en diagnose ofte, at sygdommen har været aktiv i minimum 6 uger. Derved kan der i nogle tilfælde være unødig ventetid, inden patienterne kan få lov til at opstarte behandling. Denne problemstilling er blevet bedre, efter man er begyndt at bruge ACPA, idet denne ses tidligt i forløbet. Uden ledinvolvering er det dog stadig ikke nok til at stille diagnosen. Samtidig er det svært at finde patienter med forhøjet ACPA uden ledinvolvering, da patienterne først bliver henvist til reumatologisk afdeling og får taget de nødvendige blodprøver efter indtrædelsen af symptomerne. For at forkorte diagnosticeringstiden kunne det være en fordel, hvis patienten havde fået taget de nødvendige blodprøver ved henvisning til reumatologisk afdeling. På denne måde ville reumatologen have et bedre overblik og mulighed for diagnosticering allerede ved den første konsultation. Hvis patienterne kan få en tidligere diagnose, ville de hurtigere kunne starte behandling. Dette er en fordel, da der går lang tid, inden der ses en effekt ved behandling med DMARDs. Tidlig behandling er af stor betydning, da man ikke kan kurere RA, men kun stoppe progressionen af sygdommen. Derudover har det også stor betydning for udviklingen af ekstraartikulære og systemiske manifestationer. Endnu en ulempe ved diagnosemetoden kan være, at de serologiske værdier vægtes ligeligt i pointfordelingen. En undersøgelse af Amri et al. fra 2011, med 90 RA patienter, viste, at værdier for ACPA havde en højere sensitivitet i diagnosticering af RA end IgM-RF. ACPA viste en sensitivitet på 71,1 % og en specificitet på 98 % for diagnose af RA, mens sensitiviteten for IgM-RF var 65,6 %, og specificiteten var 98 %. (Amri et al., 2011) Det tyder derfor på, at ACPA er en mere sensitiv indikator for RA. Samtidig ses den også tidligere i sygdomsforløbet end RF. (Jacobsen et al., 2012; Schaffalitzky de Muckadell et al., 2013) Man kan derfor sætte spørgsmålstegn ved, hvorfor RF og ACPA vægtes som værende af lige stor betydning i diagnosticeringen af RA. Som opsummering er ACR-kriterierne en god metode til at diagnosticere RA, men der er visse udfordringer forbundet ved brug af et pointsystem til at diagnosticere patienter. Disse er blandt andet, at patienten skal opfylde et vist antal diagnosekriterier, førend denne patient kan diagnosticeres, hvilket kan resultere i, at patienter i et tidligt stadie af RA, kan være svære at diagnosticere. Herved risikeres det, at diagnosen først kan stilles, når sygdommen er fremskreden, og derved bliver patienten sat sent i behandling. Lige nu er dette dog den eneste måde, hvorpå RA kan diagnosticeres. Side 39 af 104

41 7.2 EKSPERIMENTELLE RESULTATER Ved analyse af gel-ms blev der sammenlignet med producentens standardmarkør, men det var vanskeligt at tyde båndene, da de ikke stemte helt overens (Thermo Fisher Scientific Inc., 2014). Bånd 1, som var det tydeligste bånd, blev vurderet til at være BSA. De andre bånd var for vanskelige at tyde, så derfor blev der ikke konkluderet yderligere på dem. For at undersøge hvilke proteiner der var til stede i disse bånd, kunne der ikke laves MS. Det er dog ikke blevet udført i dette forsøg, da gel-ms hovedsageligt blev udført for at visualisere adskillelsen af proteinerne i prøverne ud fra deres molekylære vægt. Grunden til, at der var BSA til stede, er, at BSA blev tilført ved separeringen med dynabeads, jf. appendix A1. BSA hindrer uspecifik antistofbinding, hvorved andre proteiner ikke binder sig til de specifikke dynabeads. BSA var dermed ikke kun til stede ved gel-ms metoden, men også ved FASP metoden. Grunden til, at der ikke kunne ses BSA ved MS, er, at der ved analysen blev anvendt en human database. Tilsætningen af BSA kan dog stadig medføre, at der kan forekomme kontaminering ved MS, hvilket kan påvirke resultaterne. Derfor kunne det være at foretrække at undgå denne kontaminering. Undgåelse af BSA ville dog kunne medføre en øget uspecifik antistofbinding, og derfor kunne BSA ikke udelades i hele separeringen. I stedet kunne BSA udelades fra isolationsbufferen i de efterfølgende vasketrin, hvorved mængden af BSA ville kunne minimeres. Ved trypsinering blev 75,99 % af peptiderne kløvet uden nogen manglende kløvninger. 24,01 % manglede 1 eller 2 kløvninger. Dette kan skyldes, at trypsinen ikke har været tilsat i tilstrækkelig lang tid, og dermed ikke har været effektiv nok til at kløve alle proteiner. Trypsin er det mest brugte enzym ved MS, primært på grund af dens høje kløvningsspecificitet, tilgængelighed og lave omkostning. Det spalter altid ved lysin og arginin, og dette kan give et simplere spektrum. (Siepen, Keevil, Knight, & Hubbard, 2007) Dog er der visse begrænsninger forbundet med trypsin. Hvis udfoldningen af proteinerne ikke har været effektiv, vil trypsin ikke kløve proteinerne optimalt. Dette kan resultere i, at peptiderne bliver for lange eller for korte til MS analyse. Derudover udviser membranproteiner ofte resistens mod trypsin, hvilket giver meget få kløvningssteder. Dette gør, at nogle membranproteiner er for lange til MS analyse. (Saveliev, Engel, Strauss, Jones, & Rosenblatt, 2012) Der findes andre alternativer til trypsin, men da trypsin havde en succesfuld kløvning i 75,99 % af tilfældene vurderes det, at trypsin var brugbar til kløvning af peptiderne. Der vil dermed ikke blive kommenteret yderligere på disse alternativer. Blandt de identificerede proteiner er keratin identificeret med en score over 100 i alle fem celletyper. Hvis mængden af keratin overstiger mængden af peptidet af interesse, vil det kunne skjule dette peptid (Biringer, 2002; Kielberg & Rasmussen, 2005). Således kan keratinkontaminering være et væsentligt problem ved analyse af proteiner med lav forekomst ved MS (Biringer, 2002). Ved mistanke om keratinkontaminering kan keratin sættes på en eksklusionsliste, hvorved peptider med keratins størrelse ikke inkluderes i MS. Det ville dog være ufordelagtigt at ekskludere keratin, da det kan risikeres, at andre peptider med lignende størrelse også frasorteres. Derfor er keratin ikke sat på en eksklusionsliste i dette forsøg. For at undgå kontaminering blev der anvendt handsker, og arbejdsområdet blev afsprittet ved laboratoriearbejdet. Det tyder dog på, at metoden kunne forbedres, idet der er fundet keratin i alle prøver. Ved hjælp af dynabeads er de forskellige celletyper blevet adskilt ud fra deres specifikke CD-markører og for at bekræfte, at det er den rigtige celletype, der er blevet isoleret, er det blevet undersøgt, om cellernes respektive CDmarkør kunne genfindes i data fra MS. Det var forventet, at de respektive CD-markører kunne identificeres i hver af de isolerede celletyper. I resultaterne kan det ses, at CD14-proteinet er fundet i CD14-cellerne med en høj score og coverage, og samtidig er den identificeret ud fra 14 peptider. Dette giver en god sikkerhed for, at det er CD14-celler, som er blevet isoleret. I CD8-cellerne er både score og coverage for CD8-proteinet lidt lavere, men da proteinet er identificeret ud fra 5 peptider, antages det, at det er CD8-proteinet, der er til stede. CD4-proteinet i CD4-cellen er identificeret med en score på under 100, hvilket er under den accepterede grænse. Proteinet har en lav coverage på 4,15 % og er identificeret ud fra 2 peptider. Derfor kan der herske tvivl om CD4-proteinets tilstedeværelse. CD19- proteinet er identificeret i CD19-cellen med en score på over 100, hvilket giver en sikker indikation på, at CD-markøren er til stede i CD19-cellen. Dog er proteinet kun fundet med en coverage på 2,34 %, og det er samtidig kun identificeret ud fra et enkelt peptid. CD56-proteinet blev ikke identificeret i CD56-cellen, og det kan dermed ikke siges med sikkerhed, om det er CD56-celler, der er blevet isoleret. Dette kan være forårsaget af, at separeringen af cellerne ikke har været optimal, hvilket muligvis kan skyldes, at dynabeads ikke har været effektive ved binding til Side 40 af 104

42 immunoglobulinerne, eller at immunoglobulinerne ikke har bundet specifikt til CD56-cellerne. Derudover er det også muligt, at der på grund af tilfældigheder ikke er blevet sekventeret CD56-proteiner i MS. Ud fra ovenstående kan det konkluderes, at der er fundet specifikke CD-markører i CD14-, CD8- og CD19-cellerne. I CD4-cellerne blev CD4-proteinet fundet, men med en lav score. Den specifikke cellemarkør blev ikke identificeret for CD56-cellerne. I CD14-, CD4-, CD8- og CD19-cellerne blev der identificeret over 2000 forskellige proteiner med en score over 100, hvorimod der i CD56-cellerne kun blev identificeret 1515 forskellige proteiner. Dette kunne indikere, at prøven har indeholdt et for lille antal CD56-celler. Man kunne eventuelt opnå bedre resultater, hvis isolationen var blevet udført på flere celler. Dette kunne opnås ved at analysere en større mængde prøvemateriale. Ud over at undersøge, hvorvidt cellernes respektive cellemarkør var til stede i de forskellige celletyper, blev der også taget højde for, om der var nogle CD-markører til stede i cellerne, som ikke var specifikke for den enkelte celletype. Herved viste det sig, at CD14-markøren var til stede i alle celletyperne med en score over 100. Ved nærmere undersøgelse af CD14-markørens accession number sås det, at der var to forskellige former for CD14-proteiner til stede i henholdsvis CD14-cellen og de andre celletyper. Forskellen mellem de to proteiner blev undersøgt ved brug af programmet ClustalW2, se appendix A12. Herudfra kunne det ses, at de to proteiner var ens bortset fra, at det protein, der sås i CD14-cellen, var længere end det protein, der sås i CD4-, CD8-, CD19- og CD56-cellerne. CD14- proteinet, der var til stede i CD14-cellen, var membranbundet, hvorimod det var en opløselig form af CD14-proteinet, der var til stede i de andre celletyper. Den opløselige form findes i serum, hvorved alle cellerne var i kontakt med det. (Funda et al., 2001) Derfor menes det ikke at være et tegn på ufuldent celleseparering. For øvelsens skyld blev det undersøgt, om det var de korrekte peptider, der blev fundet ved dataanalysen. Dette blev gjort ved manuelt at analysere spektra for CD4- og CD14-proteinernes fundne peptider, idet disse proteiner var identificeret med den laveste og højeste score. Efterfølgende kunne de fundne aminosyresekvenser indsættes i NCBI- Blast, hvorved det kunne konkluderes, om de var specifikke for proteinet. Scoren for CD4-proteinet var 57,84, hvorved scoren var for lav til at blive accepteret i forhold til kriteriet omkring en score på minimum 100. Dette giver en lav indikation for, at de analyserede peptider kommer fra et CD4-protein, og at CD4-cellerne derfor indeholder CD4. De to peptider havde en ionscore på henholdsvis 26 og 21, hvilket ikke er særlig højt. Der kunne derfor være tvivl om, hvorvidt det var en tilfældighed, at CD4-proteinet blev identificeret i CD4- cellerne. Ud fra beregningen af aminosyresekvensen kunne det konkluderes, at spektrummet stemmer overens med det peptid, der skulle være fundet. De fundne aminosyresekvenser kunne sammenlignes med andre proteiner, som også indeholder disse sekvenser ved hjælp af programmet NCBI-Blast. Herudfra kunne det konkluderes, at aminosyresekvenserne kun findes i CD4-proteinet, jf. appendix A11. Derfor kan det afgøres, at spektrummet kommer fra CD4-proteinet på trods af den lave score. Scoren for CD14-proteinet var 2448,71. Et af CD14-proteinets peptiders spektrum er udvalgt, og ud fra dette kunne aminosyresekvensen findes. Ion-scoren for dette enkelte peptid var 85,7, hvilket er højt. Herved er der høj indikation for, at det analyserede peptid kommer fra et CD14-protein, og at CD14-cellerne derfor indeholder CD14-protein. Desuden ses der i CD14-spektrummet en lang ubrudt række af y-ioner. Dette indikerer, at C-terminalen har fået en positiv ladning, hvilket stemmer overens med, at den identificerede aminosyresekvens for peptidet har den basiske arginin ved C-terminalen, jf. figur Dette er også, hvad der kunne forventes, eftersom trypsin er blevet anvendt til kløvning af proteinerne. Derudover blev CD14-proteinet identificeret med 14 peptider. Fundene giver høj evidens for, at det netop er et CD14-peptid, der er fundet i spektrummet. Ved spektrummet var massepræcisionen 1,3 ppm. Massepræcisionen angiver, hvor tæt den eksperimentelle masse er på CD14-peptidets teoretiske masse. Et tal tæt på 0 giver en god indikation for, at CD14-peptidets teoretiske masse passer med det fundne peptids masse. Der er derfor en god indikation for, at det fundne peptid er fra CD14-proteinet. Ud fra beregningen af aminosyresekvensen sås det, at spektrummet passer overens med det peptid, der skulle være fundet. Ved sammenligning med NCBI-Blast kunne det konkluderes, at aminosyresekvensen kun findes i CD14-proteinet, jf. appendix A11. Derfor kan det afgøres, at spektrummet kommer fra CD14-proteinet. For at sammenligne patient 1004-α med den raske kontrol ville det have været interessant at lave et Venn-diagram, som kunne vise antallet af specifikke proteiner og fælles proteiner i de to prøver. Dette var dog ikke muligt, da der ikke er indhentet data for kontrollen. I stedet blev der udarbejdet et Venn-diagram for at sammenligne de forskellige celletypers proteiner for patient 1004-α. I dette diagram kunne det ses, at cellerne havde 1106 proteiner til fælles og derudover havde hver celletype nogle proteiner, som var specifikke for denne celletype. Da cellerne var forskellige, Side 41 af 104

43 var det forventet, at en forskel i proteinerne i cellerne kunne ses. Det kunne have været interessant at vide noget om, hvilken funktion henholdsvis de fælles og de specifikke proteiner havde. For at finde ud af dette kunne programmet STRAP være blevet anvendt til at finde funktionen af proteinerne og sætte det op i et diagram. Dette var dog desværre ikke muligt på grund af tekniske problemer. Ved hjælp af programmet Progenesis var det intentionen at sammenligne mængden af specifikke proteiner i patient 1004-α med den raske kontrol. Herved ville det være muligt at identificere en eventuel opregulering eller nedregulering i proteiner, som herved kunne vises at have en sammenhæng med udviklingen af RA. Dette ville eventuelt kunne anvendes som en sygdomsmarkør ved diagnosticering af RA eller i behandlingsøjemed. Da der ikke blev indhentet data fra den raske kontrol, kunne dette ikke lade sig gøre. I stedet er mængden af specifikke proteiner i de forskellige celler fra patient 1004-α blevet sammenlignet. Dette var for at vise potentialet i MS til at identificere forskelle i mængden af proteiner. I figur er den relative difference i forekomsten af TNF-α-induceret protein 2 illustreret. Herudfra kan det ses, at CD14-celler indeholder en stor mængde af dette protein i forhold til de andre celletyper. TNF-α-induceret protein 2 er et protein, hvis ekspression induceres af TNF og andre proinflammatoriske faktorer ( Tumor necrosis factor alpha-induced protein 2 - TNFAIP2 - Homo sapiens (Human), 2014). Derfor stemmer ekspressionen af TNF-α-induceret protein overens med, at cellerne kommer fra en patient med RA, hvor der må formodes at være meget TNF og mange proinflammatoriske faktorer til stede. TNF-α-induceret protein 2 menes at have en medierende rolle i inflammation og angiogenese ( Tumor necrosis factor alpha-induced protein 2 - TNFAIP2 - Homo sapiens (Human), 2014), og derfor ville det ikke være overraskende, hvis dette protein var opreguleret ved RApatienten i forhold til den raske kontrol. Det kunne være interessant at undersøge dette protein nærmere for at finde ud af, om det kunne være en potentiel sygdomsmarkør for RA. På figur ses, at der er mere pro-il-16 i CD4- og CD8-celler end i de andre celler. IL-16 stimulerer CD4-celler til migration, samt CD4- og CD8-celler til ekspression af IL-2-receptoren ( Pro-interleukin-16 - IL16 - Homo sapiens (Human), 2014). IL-2 har en stimulerende effekt på CD4- og CD8-cellers proliferation ( Interleukin-2 - IL2 - Homo sapiens (Human), 2014). Derved er tilstedeværelsen af pro-il-16 i overensstemmelse med, at patienten har RA. 7.3 DISKUSSION AF FORSØGSOPSTILLINGEN I forbindelse med projektet er der gjort nogle overvejelser om, hvorledes forsøgsopstillingen kunne forbedres. Det ville have været en fordel at bruge blodprøver fra de patienter, der deltog i patientkonsultationerne, da der herved ville have været mulighed for at sammenligne data fra MS med data indsamlet i forhold til ACR-diagnosekriterierne. Dette kunne muligvis have givet et overblik over sammenhængen mellem aktiv RA og de tilstedeværende proteiner i de inflammatoriske celler. Det ville også have været interessant at følge patienterne over en længere periode og samtidig analysere blodprøver fra både før og efter behandling. Dette ville åbne op for muligheden for at se en ændring i cellernes proteiner, når sygdommen ændres fra en aktiv RA til en RA i behandling. Desuden ville det være muligt at få en større indsigt i, hvad der sker, når patienten bliver immun over for en behandling. I projektet er det søgt at vise potentialet i MS som muligt diagnostisk værktøj ved RA. Den indsamlede data og den efterfølgende diskussion har ledt op til den følgende konklusion. Side 42 af 104

44 8.0 KONKLUSION Der er i dette projekt blevet arbejdet med problemformuleringen: Hvordan diagnosticeres RA, og hvorledes kan MS anvendes til dette formål? Ved hjælp af den kliniske og eksperimentelle metode er denne problemformulering forsøgt besvaret. I den kliniske del blev det klargjort, at ACR-kriterierne er en billig og let-anvendelig metode til diagnosticering af RA. Dog er kriterierne også forbundet med nogle problemer blandt andet sygdommens progression ved diagnosetidspunktet. Derfor ville det være relevant at finde et supplement til denne diagnosemetode. Der er arbejdet med MS i et forsøg på at tydeliggøre metodens anvendelighed i diagnosticeringen. Ved hjælp af MS er det lykkedes at identificere proteiner i fem forskellige inflammatoriske celler fra en RA-patient. Intentionen med projektet var at sammenligne en RA-patient med en rask kontrol for at identificere forskelle i ekspressionen af proteiner. Dette var ikke muligt, da data fra kontrolprøven manglede, men der er vist et stort potentiale for MS i at identificere op- og nedregulering af forskellige proteiner i de undersøgte celler. Ud fra dette er det forventeligt, at sammenligning mellem en syg patient og en rask kontrol er mulig. Det kan derved konkluderes, at MS er en potentiel brugbar metode til at forbedre diagnostikken af RA, men dette ville kræve yderligere undersøgelser. Dette projekt kan dermed være et springbræt til at lave flere studier, hvorved der ved MS kan indhentes brugbar viden i forhold til sygdommens patofysiologi og derved forbedre diagnosticeringen af RA. Side 43 af 104

45 9.0 PERSPEKTIVERING Det innovative element i dette projekt er, at MS kunne være en potentiel brugbar metode til at diagnosticere RA, men for at muliggøre dette kræves yderligere viden på området. MS har den fordel, at den kan give en stor indsigt i postmodificerede proteiner, og derfor er den særlig brugbar til at forbedre den nuværende viden. For at opnå denne viden kunne der opstilles flere forsøg, som har til formål at undersøge, hvilke proteiner der er specifikke for en RApatient i forhold til en rask kontrol. Ved sammenligning af en RA-patient med en rask kontrol, ville der kunne opnås større indsigt i den patologiske proces. Derved kunne der opnås tilstrækkelig viden til at skelne mellem proteinerne ved en RA-patient og en rask kontrol. For at MS ville kunne forbedre de nuværende diagnosemetoder, er det af stor betydning, at den kan identificere en specifik ændring i proteinindholdet tidligere i sygdomsforløbet, end eksempelvis en stigning i RF og anti-ccp ville kunne ses i blodprøver. Det ville være en fordel, hvis denne specifikke ændring i cellerne alene kunne give ophav til diagnosticering. For at alt dette kunne være en mulighed, ville det kræve yderligere studier med flere ressourcer, såsom større studiepopulation og bredere rammer i forhold til tidsperspektiv og økonomi. På nuværende tidspunkt anvendes MS til forskellige undersøgelser og herunder også diagnosticering, for eksempel inden for endokrinologien og toksikologien (Meng, 2013). Det er derfor også muligt at gøre dette inden for diagnosticering af RA-patienter, hvis der kommer mere viden om specifikke markører for RA. En sådan markør for RA er mulig at selektere ved MS, da MS apparatet kan indstilles til at selektere specifikke masser og dermed søge efter et enkelt protein. På baggrund af dette ville MS være realistisk at anvende til diagnosticering af RA. Der er dog stadig visse udfordringer ved anvendelse af denne teknologi, da det kræver en del ressourcer at forberede prøverne. Det kunne derfor være fordelagtigt at automatisere metoden (Meng, 2013). Hvis MS blev en brugbar metode til diagnosticering af RA, ville det være muligt at foretage en screening af personer i risikogruppen. Mænd og især kvinder over 50 år er i højere risiko for at udvikle RA. Denne screening kunne føre til, at RA-patienter fik en tidligere diagnose og muligheden for at starte tidlig behandling. Dette kunne betyde, at patienten ville gennemgå et mildere sygdomsforløb. I dette projekt blev der kigget på de inflammatoriske celler i blodprøver. Det kunne også være en fordel at undersøge serum, hvorved der muligvis ville kunne detekteres IgM-RF og ACPA, som normalt findes heri. Derudover kunne cytokinmiljøet undersøges. Dette ville være af stor interesse, da cytokinmiljøet har en stor indvirkning på de inflammatoriske celler. Her kunne MS bruges til at detektere betydelige cytokiner, som er til stede ved RA. Således kunne denne viden omkring de intracellulære proteiner og cytokiner give nye behandlingsmuligheder. Her kunne målet ikke blot være at give flere behandlingsmuligheder, men muligvis også at finde billigere antireumatika, da dette er en stor økonomisk belastning for samfundet. Derudover kunne man sigte efter at finde medikamenter med færre bivirkninger, da dette ville kunne bibeholde flere RA-patienter i effektiv antireumatisk behandling. MS har vist sig at have et stort potentiale i at opnå indsigt i flere sygdomme, og ved yderligere viden indenfor området er det sandsynligt, at det kan anvendes i diagnostikken af RA. Med dette taget i betragtning tyder det på, at MS i fremtiden kunne være en god investering, da den har et stort potentiale indenfor forskning. Side 44 af 104

46 10.0 MANDATORY RESUMÉ OF THE PROJECT Background Rheumatoid Arthritis (RA) is a chronic inflammatory disease that affects the joints and causes systemic manifestations. Therefore, patients suffering from RA often have a lower quality of life and a higher mortality rate. The prevalence of RA is % of the global population. The cause of the disease is unknown, but a series of risk factors are associated with the progression, including genetic factors, smoking, infections and trauma. The disease is incurable, but with treatment the progression can be inhibited. The disease can be treated using different strategies including DMARDs and biological drugs. Even though the development of treatment options has exploded during the past few years, some patients still experience side effects or immunity towards the treatment. In order to avoid progression of the disease and development of immunity it is essential to diagnose the disease as early as possible. Currently, RA is diagnosed by using the classification criteria from the American College of Rheumatology (ACR), which is a scorebased diagnostic method. There are some difficulties associated with the use of these criteria, as the disease has already progressed at the time of diagnosis. In order to improve the diagnosis of RA, it is essential to understand the function of the inflammatory cells in the development of RA. The characterization of the inflammatory cells can be done through investigation of the proteins in the cells. Purpose and method The aim of this project was to identify how RA currently is diagnosed, and how this method could be improved using mass spectrometry (MS). In order to do so, a clinical method and an experimental method were conducted. The clinical method was based on diagnosis of two patients referred to the department of rheumatology at Sygehus Vendsyssel. The experimental method was based on the detection of the differences in the amount of proteins in inflammatory cells by MS. MS is a method which enables the identification of the structure and the function of a large amount of proteins through sequencing of peptides. Therefore, MS could be used to obtain further knowledge of RA and subsequently used as a diagnostic tool. The intention of the experiment was to conduct a comparison between proteins in the inflammatory cells of an RA-patient with a healthy individual. Unfortunately, this was not possible because of lacking results. Instead the proteins in the different inflammatory cells have been compared to show the potential of using MS to identify differences in protein expression. Results The clinical results showed that the first patient did not suffer from RA, while the second fulfilled the diagnostic criteria. The intention of the experiment was to conduct a comparison between proteins in the inflammatory cells of an RA patient with a healthy individual by using mass spectrometry. Unfortunately, this was not possible because of the lack of results. Instead, the proteins of the different inflammatory cells were compared. The identification of specific cell surface markers from macrophages, T helper cells, cytotoxic T cells and B cells was possible. The specific cell surface marker from the Natural Killer cells was not to be found. To demonstrate the up regulation or down regulation in protein expression, the project sought to compare the expression of TNF-α-induced protein 2 in different inflammatory cell types and the expression of Pro-IL-16 in different inflammatory cell types. Conclusion Using the clinical method, it was found that the classification criteria of RA by the American College of Rheumatology are inexpensive and easy to apply. However, they are associated with some challenges among these the progression of the disease at the time of diagnosis. Using the experimental method, the role of MS in identifying proteins in five different inflammatory cells of a patient diagnosed with RA was investigated. The intention of the study was to compare the patient with a healthy individual and to identify the difference in the expression of proteins. Although, this was not possible, specific proteins were identified and compared among different inflammatory cells. The up regulation and down regulation of these specific proteins were examined and hereby, the great potential of MS was shown. Side 45 af 104

47 11.0 LITTERATURLISTE About the Technology. (2014). ThermoFisher Scientific. Retrieved April 14, 2014, from About UniProt. (2014). uniprot.org. Retrieved April 15, 2014, from Accuspin System-Histopaque (2003). Sigma-Aldrich, Inc., 1 2. Agger, R., Nielsen, C. H., Leslie, G., & Aasted, B. (2011). Immunologi. (M. Shack, D. R. Andersen, L. Skogemann, & S. L. Harbo, Eds.) (1. udgave.). København: Munksgaard Danmark. Ahern, D. J., & Brennan, F. M. (2011). The role of Natural Killer cells in the pathogenesis of rheumatoid arthritis: major contributors or essential homeostatic modulators? Immunology Letters, 136(2), doi: /j.imlet Al-Allaf, A. W. (2000). A case-control study examining the role of physical trauma in the onset of rheumatoid arthritis. Rheumatology, 40(3), doi: /rheumatology/ Amri, M., Sfar, I., Ounallah, H. S., Dhaouadi, T., Bel Hadj, N., Abdelmoula, L., Gorgi, Y. (2011). Anti-CCP antibodies, rheumatoid factors and anti-keratin antibodies: clinical value in established rheumatoid arthritis. La Tunisie Médicale, 89(3), Retrieved from ARHP Practice Committee. (2012). Certolizumab Pegol (Cimzia) American College of Rheumatology ACR. rheumatology.org. Retrieved April 13, 2014, from Baka, Z., György, B., Géher, P., Buzás, E. I., Falus, A., & Nagy, G. (2012). Citrullination under physiological and pathological conditions. Joint, Bone, Spine : Revue Du Rhumatisme, 79(5), doi: /j.jbspin Baynes, J. W., & Dominiczak, M. H. (2009). Medical Biochemistry (Third edit.). Mosby Elsevier. Becton Dickenson and Company. (2010). BD Vacutainer Venous Blood Collection - Tube Guide. Bd.com, Retrieved from Bennike, T., Birkelund, S., Stensballe, A., & Andersen, V. (2014). Biomarkers in inflammatory bowel diseases: Current status and proteomics identification strategies. World Journal of Gastroenterology : WJG, 20(12), doi: /wjg.v20.i Biringer, R. (2002). Protocol for a Keratin-Free Environment. Thermo Electron Corporation. Retrieved from Boissier, M.-C., Assier, E., Biton, J., Denys, A., Falgarone, G., & Bessis, N. (2009). Regulatory T cells (Treg) in rheumatoid arthritis. Joint, Bone, Spine : Revue Du Rhumatisme, 76(1), doi: /j.jbspin Carvalheiro, H., da Silva, J. A. P., & Souto-Carneiro, M. M. (2013). Potential roles for CD8(+) T cells in rheumatoid arthritis. Autoimmunity Reviews, 12(3), doi: /j.autrev Side 46 af 104

48 Choy, E. (2012). Understanding the dynamics: pathways involved in the pathogenesis of rheumatoid arthritis. Rheumatology (Oxford, England), 51 Suppl 5, v3 11. doi: /rheumatology/kes113 Christophersen, B., Heisterberg, J., Senderovitz, T., & Rabøl, R. (2010). Kompendium i Farmakologi. (K. Kesje, Ed.) (2. udgave,., p. 303). Aarhus: FADL s Forlag. Davidson College Department of Biology. (2001). SDS-PAGE (PolyAcrylamide Gel Electrophoresis). bio.davidson.edu. Retrieved April 14, 2014, from De Benedetti, F., Rucci, N., Del Fattore, A., Peruzzi, B., Paro, R., Longo, M., Teti, A. (2006). Impaired skeletal development in interleukin-6-transgenic mice: a model for the impact of chronic inflammation on the growing skeletal system. Arthritis and Rheumatism, 54(11), doi: /art Demirag, M. D., Haznedaroglu, S., Sancak, B., Konca, C., Gulbahar, O., Ozturk, M. A., & Goker, B. (2009). Circulating hepcidin in the crossroads of anemia and inflammation associated with rheumatoid arthritis. Internal Medicine (Tokyo, Japan), 48(6), Retrieved from Diness Borup, V. (2010). Biokemi (1. udgave., p. 871). FADL s Forlag. Friis, H., Hendel, J., Dalhoff, K. P., & Bjerrum, L. (2014a). Cimzia - pro.medicin.dk. pro.medicin.dk. Retrieved April 14, 2014, from Friis, H., Hendel, J., Dalhoff, K. P., & Bjerrum, L. (2014b). Methotrexat 2care4. Pro.medicin.dk. Retrieved March 19, 2014, from Funda, D. P., Tucková, L., Farré, M. A., Iwase, T., Moro, I., & Tlaskalová-Hogenová, H. (2001). CD14 is expressed and released as soluble CD14 by human intestinal epithelial cells in vitro: lipopolysaccharide activation of epithelial cells revisited. Infection and Immunity, 69(6), doi: /iai Geneser, F. (2011). Histologi - på molekylærbiologisk grundlag. (B. Østergaard, Ed.) (1. udgave,.). Munksgaard Danmark. Gigtforeningen.dk. (2012). Cimzia bliver det foretrukne biologiske lægemiddel mod gigt. gigtforeningen.dk. Retrieved March 11, 2014, from Gumustas, M., Kurbanoglu, S., Uslu, B., & Ozkan, S. a. (2013). UPLC versus HPLC on Drug Analysis: Advantageous, Applications and Their Validation Parameters. Chromatographia, 76(21-22), doi: /s Harris, E. D. J., Budd, R. C., Firestein, G. S., Genovese, M. C., Sergent, J. S., Ruddy, S., & Sledge, C. B. (2005). Kelley s Textbook of Rheumatology (7th editio.). Philadelphia: Elsevier Saunders. Heller Asmussen, K., Steensgaard Pedersen, K., Hørslev Petersen, K., Schlemmer, A., Hansen, A., Stoltenberg, M., & Gam, A. (2012). Dansk Reumatologisk Selskabs Kliniske Retningslinje for Diagnostik, Behandling og Monitorering af Reumatoid Artrit. Dansk Reumatologisk Selskab. Retrieved from s_kliniske_retningslinje_for_diagnostik_klassifikation_behandling_og_monitorering_af_reumatoid_artrit_revi deret_september_2012_pdf_kopi_.pdf Side 47 af 104

49 Hornung, N., Hansen-Nord, G., Gerdes, U., & Kjeldsen, H. C. (2014). Basisk fosfatase - sundhed.dk. Sundhed.dk. Retrieved April 15, 2014, from https://www.sundhed.dk/sundhedsfaglig/laegehaandbogen/undersoegelser-ogproever/klinisk-biokemi/blodproever/basisk-fosfatase/ Hu, Q., Noll, R. J., Li, H., Makarov, A., Hardman, M., & Graham Cooks, R. (2005). The Orbitrap: a new mass spectrometer. Journal of Mass Spectrometry : JMS, 40(4), doi: /jms.856 Institut for Rationel Farmakoterapi. (2009). Institut for Rationel Farmakoterapi - Cimzia (certolizumab pegol). irf.dk. Retrieved April 13, 2014, from Institut for Rationel Farmakoterapi. (2013). Institut for Rationel Farmakoterapi Biologiske antirheumatika - spiller antistoffer mod medicinen en rolle? Institut for Rationel Farmakoterapi. Retrieved April 14, 2014, from Interleukin-2 - IL2 - Homo sapiens (Human). (2014). uniprot.org. Retrieved April 19, 2014, from Jacobsen, S., Manniche, C., Pødenphant, J., Stensgaard-Pedersen, K., & Tarp, U. (2012). Reumatologi (3. udgave.). København: FADL s Forlag. Jørgensen, R., & Kassem, M. (2009). Knoglevævets opbygning og funktion. Dansk Knoglemedicinsk Selskab, Kampmann, J. P., Brøsen, K., & Simonsen, U. (2011). Basal og klinisk farmakologi. (T. B. Thomsen, Ed.) (4. udgave.). København: FADL s Forlag. Katzung, B. G., Masters, S. B., & Trevor, A. J. (2009). Basic and clinical pharmacology (11th editi.). The McGraw-Hill Companies, Inc. Kebarle, P., & Verkerk, U. H. (2009). Electrospray: From ions in solution to ions in the gas phase, what we know now. Mass Spectrometry Reviews, 28, doi: /mas Kielberg, V., & Rasmussen, L. (2005). Proteiner - oprensning og karakterisering (3. udgave,.). København: Nordisk Forlag A/S. Klareskog, L., Padyukov, L., & Alfredsson, L. (2007). Smoking as a trigger for inflammatory rheumatic diseases. Current Opinion in Rheumatology, 19(1), doi: /bor.0b013e c8 Kvien, T. K. (2004). Epidemiology and burden of illness of rheumatoid arthritis. PharmacoEconomics, 22(2 Suppl 1), Retrieved from Lubberts, E., Koenders, M. I., & van den Berg, W. B. (2005). The role of T-cell interleukin-17 in conducting destructive arthritis: lessons from animal models. Arthritis Research & Therapy, 7(1), doi: /ar1478 Marcotte, E. M. (2007). How do shotgun proteomics algorithms identify proteins? Nature Biotechnology, 25(7), doi: /nbt Masuda, T., Tomita, M., & Ishihama, Y. (2008). Phase Transfer Surfactant-Aided Trypsin Digestion for Membrane Proteome Analysis research articles. Journal of Proteome Research, 7(2), Side 48 af 104

50 McCance, K. L., Huether, S. E., Brashers, V. L., & Rote, N. S. (2010). Pathophysiology: the Biologic Basis for Disease in adults and children. (S. Clark, C. C. Jones, C. Ketchum, & B. Bagwill, Eds.) (6th editio.). Maryland Heights: Mosby Elsevier. McInnes, I. B. (2003). Leukotrienes, mast cells, and T cells. Arthritis Research & Therapy, 5(6), doi: /ar1017 McInnes, I. B., & Schett, G. (2007). Cytokines in the Pathogenesis of Rheumatoid Arthritis. Nature Reviews. Immunology, 7(6), doi: /nri2094 McInnes, I. B., & Schett, G. (2011). The pathogenesis of rheumatoid arthritis. The New England Journal of Medicine, 365(23), doi: /phc c8797 Meng, Q. H. (2013). Mass Spectrometry Applications in Clinical Diagnostics. Clinical & Experimental Pathology, 6(1). doi: / s6-e001 Michalski, A., Damoc, E., Hauschild, J.-P., Lange, O., Wieghaus, A., Makarov, A., Horning, S. (2011). Mass spectrometry-based proteomics using Q Exactive, a high-performance benchtop quadrupole Orbitrap mass spectrometer. Molecular & Cellular Proteomics : MCP, 10(9), M doi: /mcp.m Mikuls, T. R., Thiele, G. M., Deane, K. D., Payne, J. B., O Dell, J. R., Yu, F., Norris, J. M. (2012). Porphyromonas gingivalis and disease-related autoantibodies in individuals at increased risk of rheumatoid arthritis. Arthritis and Rheumatism, 64(11), doi: /art Mullins, D. (2002). How does an SDS PAGE gel really work? mullinslab.ucsf.edu. Retrieved April 14, 2014, from HTML/SDS_PAGE_protocol.htm Ong, S.-E., & Mann, M. (2005). Mass spectrometry-based proteomics turns quantitative. Nature Chemical Biology, 1(5), doi: /nchembio736 Oswald, N. (2008). How SDS-PAGE works Bitesize Bio. Protein analysis, Detection & Assay. Retrieved April 14, 2014, from Polido-Pereira, J., Vieira-Sousa, E., & Fonseca, J. E. (2011). Rheumatoid arthritis: what is refractory disease and how to manage it? Autoimmunity Reviews, 10(11), doi: /j.autrev Pro-interleukin-16 - IL16 - Homo sapiens (Human). (2014). uniprot.org. Retrieved April 19, 2014, from Q Exactive, Hybrid Quadrupole Orbitrap Mass Spectrometer. (2014). ThermoFisher Scientific. Retrieved April 19, 2014, from Rekombinant. (2014). E-ordbog Immunforsvaret. Retrieved March 25, 2014, from Reusch, W. (2013). Mass Spectrometry. www2.chemistry.msu.edu. Retrieved April 14, 2014, from Rheumatology.org. (2014) Rheumatoid Arthritis Classification. Retrieved March 17, 2014, from Side 49 af 104

51 Roge, A. B., Firke, S. N., Dhane, R. M., Gunjkar, V. J., & Vadvalkar, S. M. (2011). Novel Achievement of HPLC : UPLC. International Journal of PharmTech Research, 3(3), Retrieved from RPMI Media - RPMI-1640 Media Sigma-Aldrich. (2014). sigmaaldrich.com. Retrieved April 14, 2014, from Saveliev, S., Engel, L., Strauss, E., Jones, R., & Rosenblatt, M. (2012). The Advantages to Using Arg-C, Elastase, Thermolysin and Pepsin for Protein Analysis The Arg-C Advantage. Promega Corporation, 1 6. Retrieved from Schaffalitzky de Muckadell, O. B., Haunsø, S., & Vilstrup, H. (2013). Medicinsk Kompendium - bind 1 (18. udgave.). Nyt Nordisk Forlag Arnold Busck A/S. Scigelova, M., Hornshaw, M., Giannakopulos, A., & Makarov, A. (2011). Fourier transform mass spectrometry. Molecular & Cellular Proteomics : MCP, 10(7), M doi: /mcp.m Scoring - Mascot Probability Based Scoring. (2014). matrixscience.com. Retrieved April 14, 2014, from Siepen, J. A., Keevil, E.-J., Knight, D., & Hubbard, S. J. (2007). Prediction of missed cleavage sites in tryptic peptides aids protein identification in proteomics. Journal of Proteome Research, 6(1), doi: /pr060507u Steen, H., & Mann, M. (2004). The ABC s (and XYZ's) of peptide sequencing. Nature Reviews. Molecular Cell Biology, 5(9), doi: /nrm1468 Stoltenberg, M. B., Klamer, F., & Husby, G. (2011). Reumatoid artritis - sundhed.dk. Sundhed.dk. Retrieved April 13, 2014, from https://www.sundhed.dk/sundhedsfaglig/laegehaandbogen/reumatologi/tilstande-ogsygdomme/artritter/reumatoid-artritis/ Swartz, M. E. (2005). Ultra Performance Liquid Chromatography (UPLC): An Introduction. Separation Science Redefined, (May), Szekanecz, Z., Soós, L., Szabó, Z., Fekete, A., Kapitány, A., Végvári, A., Lakos, G. (2008). Anti-citrullinated protein antibodies in rheumatoid arthritis: as good as it gets? Clinical Reviews in Allergy & Immunology, 34(1), doi: /s Tarp, U. (2011). Institut for Rationel Farmakoterapi Biologisk behandling: Need to know! Institut for Rationel Farmakoterapi. Retrieved March 19, 2014, from _know.htm Thermo Fisher Scientific. (2009). Proteome Discoverer, version 1.1, User Guide. Thermo Scientific, (October). Retrieved from Thermo Fisher Scientific Inc. (2014). SeeBlue Pre-stained Protein Standard. lifetechnologies.com,. Retrieved April 15, 2014, from Tumor necrosis factor alpha-induced protein 2 - TNFAIP2 - Homo sapiens (Human). (2014). Uniprot.org. Retrieved April 19, 2014, from Side 50 af 104

52 Tymoczko, J. L., Berg, J. M., & Stryer, L. (2011). Biochemistry (7th revise., p. 1026). W.H. Freeman & Co Ltd. University of Michigan. (2008). Mass Spectrometry: Quadrupole Mass Filter. Advanced Lab, (1918). Retrieved from Van der Heijden, J. W., Dijkmans, B. a C., Scheper, R. J., & Jansen, G. (2007). Drug Insight: resistance to methotrexate and other disease-modifying antirheumatic drugs--from bench to bedside. Nature Clinical Practice. Rheumatology, 3(1), doi: /ncprheum0380 Weaver, C. T., Hatton, R. D., Mangan, P. R., & Harrington, L. E. (2007). IL-17 family cytokines and the expanding diversity of effector T cell lineages. Annual Review of Immunology, 25, doi: /annurev.immunol Weiss, G., & Schett, G. (2012). Anaemia in inflammatory rheumatic diseases. Nature Reviews. Rheumatology, 9(4), doi: /nrrheum Wieghaus, A., Makarov, A., Froehlich, U., Kellmann, M., Denisov, E., & Lange, O. (2008). The Thermo Scientific Exactive Benchtop LC/MS Orbitrap Mass Spectrometer. thermo.com. Retrieved from Side 51 af 104

53 12.0 APPENDIX A1 LABORATORIEJOURNAL: SEPARERING MED DYNABEADS Dato: 24/ Blodudtagning 1. Der tappes blod i 8 EDTA rør (ca. 40 ml i alt). Disse rør er coated med EDTA (ethyldiamintetra-eddikesyre), som gør, at blodet ikke kan størkne. EDTA virker hæmmende på koagulationen, da det binder Ca2+. Klargøring af accuspin tubes 1. Først hældes ca. 15. ml histopaque 1077 i 2 acuspin tubes. Dette gøres først, fordi histopaque skal have stuetemperatur før, det virker. 2. Der centrifugerer for at få histopaque ned gennem membranen Behandling af prøver 1. Vi hældte 20 ml blod over i to 50 ml rør. Det er vigtigt, at blodet ikke skvulper og danner bobler, da det kan medføre, at cellerne dør. 2. Herefter tilsættes 10 ml RPMI til prøverne. 3. Dette hældes over i de to accuspin tuber. 4. Vi centrifugerede begge rør ved 800 g i 20 min. ved stuetemperatur for at faseadskille blodprøven. Derfor centrifugeres uden bremse, hvorved der tillægges 10 min. indtil centrifugen er færdig. I centrifugerørene er lagene: plasma, trombocytter (buffycoat), mononukleære celler (buffycoat), granulocytter og erytrocytter. 5. Vi pipetterer plasma væk. Der er ca. 23 ml plasma. 6. Buffy coat, histopaque og overskydende plasma fra begge rør hældes over i et 50 ml rør, hvorved prøverne hældes sammen. 7. For at fjerne histopaque og overskydende plasma vaskes prøverne efterfølgende med RPMI-buffer. Det er vigtig at opløse cellepallet fuldstændigt i hvert vasketrin. Først opløses det i en lille volumen (i pipettespidsen) og derefter tilføjes resten. 8. Der fyldes op med RPMI medie til 50 ml og prøven vendes for at blande det. 9. Vi centrifugerer ved 800 g i 10 min. ved 4 grader Celcius. 10. Vi dekanterer ned til cellespejlet. 11. Ved hjælp af 1 ml RPMI buffer pipetteres op og ned for at opløse cellepellet. 12. Derefter hældes 20 ml RPMI buffer oveni og der centrifugeres i 10 min. 13. Herefter dekanteres igen ned til cellespejlet. (Der sad nogle ting op ad kanterne, hvilket vi er bange for kan være celler. Dette er ikke så godt.) 14. Cellerne blev suget op med en pipette efter, at der var blevet tilført 1 ml RPMI buffer og puttet i et eppendorfrør. 15. Vi centrifugerer 1800 g i 2 min ved 4 grader med bremse, herefter tager vi væsken fra. Celletælning mikroliter leukocytter blandes med 10 mikroliter trypanblå og hældes under plexiglassene på tællekammeret. Det blandes først umiddelbart lige før, cellerne skal tælles, da trypanblå efterhånden også trænger ind i de døde celler. 2. Cellerne i 5 kamre fra 4 kvadranter tælles. Side 52 af 104

54 Udregning: Først udregnes der et gennemsnit af antallet af celler i hvert kvadrant: Herefter beregnes antallet af celler i celleprøven via formlen: (25/5) = antal kamre vi talte = afhænger af størrelsen på tællekammeret 2 = fortyndingsfaktor Man tæller cellerne for at kunne vide, hvor meget dynabeads vi skal tilsætte. Vi brugte dog ikke dette tal til noget da vi fulgte en standardiseret protokol og dermed allerede vidste hvr meget der skulle tilsættes. Isolation af celler ud fra CD markør CD14-røret 1. Marker et 1,5 ml eppendorfrør (uden RNAse) med CD14 + patient nr. 2. Ryst Dynabeads for at få dem til at gå i opløsning. 3. Flyt 25 µl beads over i det markerede eppendorfrør. 4. Tilføj 1 ml isolationsbuffer for at indstille miljøet, så det passer sammen med cellemiljøet. 5. Placer eppendorfrøret på magneten i minimum 2 minutter. 6. Fjern herefter supernatanten fra dynabeads, mens røret stadig er på magneten. 7. Leukocytrør: Tilføj 1 ml isolationsbuffer, for at tilpasse miljøet til dynabeads. Sørg for at cellebundfaldet er helt opløst. 8. Overfør cellerne til Dynabeads med CD14 (CD14-røret). 9. Inkuber i 30 min ved 4 grader C i en rotator. Cellerne skal være ved 4 grader C, både fordi antistoffer er mere stabile ved lav temperatur, og fordi cellerne har lavere aktivitet ved lav temperatur og derfor holdes i live i længere tid. 10. CD14-røret udtages fra rotatoren og placeres på magneten i 2 min for at adskille CD14-cellerne fra de resterende celler. 11. Mens cellerne stadig er på magneten, flyttes cellerne (uden CD14 markør) over i et andet eppendorfrør uden mærkning, som også er på magneten. 12. Vask cellerne bundet til dynabeads i CD14-røret med isolationsbuffer. Herefter opløses disse celler i isolationsbuffer (de skal opløses fuldstændig). 13. Placér røret på magneten igen i 2 min. 14. Fjern supernatanten fra cellerne bundet til CD14-dynabeads. Side 53 af 104

55 15. Fjern cellerne fra magneten og opløs dem i 1 ml isolationsbuffer. 16. Placer på magneten i 2 min. 17. Fjern supernatanten fra cellerne bundet til CD14-dynabeads. 18. Tilføj 350 µl 5 % SDC buffer for at lysere cellerne. Vortex CD14-røret. 19. Pipetter op og ned for at opløse DNA et. Frys CD14-røret. IgG-røret: 1. Cellerne fra det umarkerede rør føres over i et eppendorfrør, hvorpå der står IgG. 2. Tilsæt 2 µl primært CD56+ antistof til prøven. (Pipettespidsen skal sættes ned i prøven). 3. Inkubér i 10 min ved 4 grader C i en rotator. 4. Centrifuger ved 1800 g i 2 min ved 4 grader C. 5. Fjern supernatanten. 6. Tilføj 1 ml isolations buffer og være sikker på at opløse cellepellet helt (Opløs cellepellet med 100 µl i pipettespidsen og tilføj de resterende 900 µl). 7. Gentag vaske trin ved at centrifugere prøverne ved 1800 g i 2 min ved 4 grader celcius. 8. Der markeredes et nyt eppendorfrør med CD56 + Dynabeads. 9. IgG dynabeads (CD56) omrystes mikroliter dynabeads overføres til CD56 + Dynabeadsrøret, og tilføres 1 ml isolationsbuffer. Dette er vigtigt for at kalibrere dynabeads til cellemiljøet. Placeres på magneten i 1 min. 11. Fjern supernatanten (isolationsbuffer) fra IgG-røret. Tilsæt 1 ml isolationsbuffer og pipetter indtil celleklumpen er helt opløst i isolationsbufferen. 12. Fjern supernatanten fra CD56 + Dynabeadsrøret. 13. Tag cellerne fra IgG-røret over i CD56 + Dynabeadsrøret. 14. Inkuber i rotator i 20 minutter ved 4 grader C. 15. Herefter placeres CD56 + Dynabeadsrøret på magneten i 2 minutter. Efter de 2 minutter fjernes supernatanten og CD56 + Dynabeadsrøret placeres på magneten i 2 minutter igen. 16. Vask CD56+dynabeads bundne celler ved at tilsætte 1 ml isolationsbuffer og sørg for at cellerne er helt opløst. 17. Røret placeres på magnet en i 2 min. 18. Efter de to minutter fjernes isolationsbufferen, mens røret sidder på magneten. 19. Der tilsættes 1 ml isolationsbuffer til de CD56+dynabeads bundne celler, og der pipetteres for at sikre, at cellerne er blandet med bufferen. 20. Røret placeres på magneten i 2 min. Herefter fjernes supernatanten, mens prøven sidder på magneten. 21. Der tilsættes 350 mikroliter 5 % SDC, som lyserer cellerne og CD56 + Dynabeadsrøret vortexes. 22. Herefter sørges der for, at prøverne er helt blandet med en pipette. 23. CD56 + Dynabeadsrøret sættes i fryseren. Side 54 af 104

56 A2 LABORATORIEJOURNAL: SDS-PAGE Laboratorie journal - SDS-PAGE Prøver: 1. Alfa 1008 CD14 2 NaDoc (Monocytter, makrofager) 2. Alfa 1008 CD4 (Th-celler) 3. Alfa 1008 CD8 (Tc-celler) 4. Alfa 1008 CD19 (B-celle) 5. Alfa 1008 CD56 (NK-celle) Udfoldning af proteiner 1) 25 mikroliter af 1 M DTT over i sample buffer (= et reduktionsbuffer). Sample bufferen er lavet ud fra protokollen Mini protean 3 cell. Den består af demineraliseret vand, 0,5 M Tris-HCl ph 6,8 (buffer), glycerol (gør opløsningen tung), 10 % (w/v) SDS (giver en negativ overfladeladning) og 0,5 % (w/v) bromophenol blue (som er ph-indikator, bliver gul i sur opløsning, er blå i neutral og rød i basisk opløsning). 2) 15 mikroliter af prøve + 15 mikroliter sample buffer i nyt rør (nr. 1,2,3,4,5) 3) Rørene kommer over i varmeblokkene i 5 min (ca. 78,7 grader celcius) Denaturering. Elektroforese Vi bruger et laemmli gel elektroforese-system og vi bruger bufferen 1x SDS-PAGE RUNNING BUFFER. Udstyret gøres rent for at sikre, at der ikke er gammelt hud på det. Da støv består af proteiner (keratin). Brøndene rummer 30 mikroliter og gelen er 1 mm tyk. 1) Vi benytter en mini-protean TGX Precast Gels, som placeret i det indre kammer. 2) SDS-buffer hældes i det indre kammer. Det er vigtigt, at brønden ikke må løbe tør under elektroforesen. Der må ikke være luftbobler i kammeret. 3) Det ydre kammer fyldes også med SDS-buffer. Det fungerer bl.a. som køling. Og hvad mere?? 4) 10 mikroliter SeeBlue Pre-stain standard loades i brønd 1. Dette er en standard markør. 5) Herefter putter vi prøve nr. 1 i brønd 2. Prøve nr. 2 i brønd 4. Prøve nr. 3 i brønd 6. Prøve nr. 4 i brønd 8. Prøve nr. 5 i brønd 10. (se skema) Brønd Prøve 10 mikro-liter SeeBlue 30 mikro-liter nr mikro-liter nr mikro-liter nr mikro-liter nr mikro-liter nr. 5 NB! Vi centrifugerer de prøver, hvor der er bobler eller noget af prøven på siden af røret, så det kommer helt ned i bunden. Det gjorde vi ved prøve 1,2,3,4. 6) Elektroforesen tændes og sættes på 157 volt. Den kører i 30 min. 7) Sluk for elektroforesen og tag låget af. De blå streger skal være helt nede i bunden. 8) Hæld buffer væk og skyld efter med demineraliseret vand. Alt dette udføres i stinkskab 9) Coomassie stain (G % eddikesyre + 60 % methanol) hældes i et bæger, som farver overfladen af proteinerne. Der hældes så meget i så den dækker gelen. 10) Gelen brydes op og gelen får gelen til at slippe ned i bægeret. 11) Sættes på en omryster i en halv time. 12) Hælder Coomasse stain farve fra. 13) Skyller med Destain (eddikesyre + lidt ethanol) hvorefter det kan stå til i morgen ved stuetemp. Side 55 af 104

57 A3 LABORATORIEJOURNAL: IN-GEL DIGESTION Onsdag d. 5/3 klargøring til digestion 1. Sætter fingeren (med handske) på gel og hælder væske over i plastikkrus. 2. Skylder gel med ultrafiltreret vand: 2 * 10 minutter. 3. Vi skærer 7 markører, 1 kontrol og 8 bånd fra hver celletype (CD14, CD4, CD8, CD19 og CD56) se billede. 4. Skærer båndene i små stykker og puttes i et eppendorfrør. 5. Mellem hver udskæring vasker vi skalpellerne med 70 % ethanol. 6. gelstykkerne kom på køl til dagen efter (4 grader) Vi har navngivet alle proteinbåndene med tal: 1,2,3 og 4. Vi har navngivet alle områderne udenfor proteinbåndene med bogstaver: A, B, C og D. Opstilling: M1 M2 M3 M4 M5 M6 M7 Kontrol* CD14 A CD14 1 CD14 B CD14 2 CD14 C CD14 3 CD14 4 CD14 D CD4 A CD4 1 CD4 B CD4 2 CD4 C CD4 3 CD4 4 CD4 D CD8 A CD8 1 CD8 B CD8 2 CD8 C CD8 3 CD8 4 CD8 D CD19 A CD19 1 CD19 B CD19 2 CD19 C CD19 3 CD19 4 CD19 D CD56 A CD56 1 CD56 B CD56 2 CD56 C CD56 3 CD56 4 CD56 D *Kontrol: Gel uden proteinbånd Side 56 af 104

58 Bemærkninger: Under udskæringen blev gelen tør og begyndte at krølle sammen. Vi hældte derfor ultrafilteret vand over og gik til pause. Dette hjalp og gelen rettede sig ud igen. Billeder fra dagen: Torsdag d. 6/3: Opløsninger: Opløsning 1: 100 mm triethylammonium bicarbonat buffer Opløsning 2: 100 mm triethylammonium bicarbonat buffer/acetonitril 1:1 (v/v) Opløsning 3: Ren acetonitril (100 %) Opløsning 4: 10 mm dithiotreitol (DTT)/0,1 M triethylammonium bicarbonat buffer Opløsning 5: 25 mm iodoacetamid/0,1 M triethylammonium bicarbonat buffer Opløsning 6: 50 mm triethylammonium bicarbonat buffer og 12,5 ng/mikroliter trypsin Opløsning 7: 50 mm triethylammonium bicarbonat buffer Opløsning 8: 5 % myresyre Opløsning 9: 2 % acetonitril, 0,1 % myresyre Opstilling i holderen: CD 14: CD 4: CD 8: Side 57 af 104

59 CD 19: CD 56: Kontrol Vask af gelstykker: Opløsning 1: 1 ml triethylammonium bicarbonat buffer + 9 ml Milli-Q, jf. beregning. Vi vasker hver prøve med 100 mikroliter 100 mm triethylammonium bicarbonat buffer (for at stabilisere ph). Herefter centrifugerer vi alle rør for at sikre, at gelstykkerne kom ned i bunden af røret (+ evt. vortex). Hvis der stadig er gelstykker på kanterne af rørene, skubbes disse ned med en pipettespids. Efterfølgende hvis der var gelstykker på kanterne, så centrifugerede vi prøverne. Herefter tømmer vi hvert eppendorfrør for opløsning 1. Opløsning 2: 4400 mikroliter fra opløsning mikroliter acetonitril, jf. beregning. Vi tilsætter 100 mikroliter af opløsning 2 til hvert eppendorfrør. Acetonitril vrider gelstykkerne og trækker vandet til sig. Dette gør, at farven trækkes ud af gelstykkerne. Denne opløsning skal være i rørene i 15 min. Herefter tager vi opløsning 2 op af eppendorfrørene. Vi skyller med 100 mikroliter af opløsning 2 igen for at få den sidste farve trukket ud af gelstykkerne. Vi lader prøverne stå i 15 minutter, hvorefter vi fjerner det. Opløsning 3: 2200 mikroliter ren acetonitril. Der tilsættes 100 mikroliter af ren acetonitril til hvert eppendorfrør. Herefter tømmes alle rør. Gelstykkerne er nu mere hvide og klistrer sammen, fordi acetonitril har trukket yderligere væske ud af gelstykkerne. Efter tømning lader vi eppendorfrørene stå åbne, så acetonitril kan fordampe, hvis der skulle være nogle rester tilbage i eppendorfrørene. (acetonitrile fordamper hurtigt) Reduktion og alkylering: Opløsning 4: 22 mikroliter DTT mikroliter triethylammonium bicarbonat buffer, jf. beregning. Der tilsættes 100 mikroliter af opløsning 4 til hvert eppendorfrør. Herefter inkuberes prøverne i 45 min. ved ca. 56 grader celcius. DTT er den reducerende stof. Det bryder disulfidbindinger (bindinger mellem 2 thiolgrupper), hvorved proteinet udfoldes. Efter 45 minutter tages eppendorfrørene op og opløsning 4 fjernes, hvorved gelstykkerne hurtigt når stuetemperatur. Side 58 af 104

60 Opløsning 5: 55 mikroliter iodoacetamid mikroliter triethylammonium bicarbonat buffer, jf. beregning. Der tilsættes 100 mikroliter af opløsning 5 til hver af prøverne. Prøverne pakkes ind i sølvpapir, da iodoacetamid er lysfølsom. Iodoacetamid er det alkylerende stof. Iodoactamid binder kovalent til thiolgrupper af cystein, således at proteinet ikke danner disulfidbindinger. (wiki-fact) Vi inkuberer i 30 min. ved stuetemperatur. Vi fjernede herefter opløsning 5 fra prøverne. Efterfølgende vasker vi igen med triethylammonium bicarbonat/acetonitrile (opløsning 2). Dette fjernes umiddelbart efter opfyldning og herefter tilsættes acetonitril. Acetonitril gør, at gelen tørrer ud. Herefter fjerner vi acetonitril fra prøverne. Vi lader lågene stå åben, så acetonitrilen kan fordampe. Opløsning 6: 1,6 ml triethylammonium bicarbonat + 20 µg 12,5 ng/mikroliter trypsin, jf. beregning Der tilsættes 50 mikroliter af opløsning 6 til hver af prøverne. Gelen opsuger trypsin ved tilsætning af dette (rehydrering). Trypsin nedbryder proteinerne. Da gelstykkerne opsuger væsken, skal der tilføres mere, når væskestanden er faldet, så trypsin er i kontakt med alle gelstykkerne. Opløsning 7: 550 mikroliter triethylammonium bicarbonat buffer og 550 mikroliter Milli Q, jf. beregning. Vi tilsætter 50 mikroliter af opløsning 7 for at sikre, at de ikke tørrer ud natten over. Vi bruger 50mM i stedet for 100 mm for at mindske saltkoncentrationen før MS. Prøverne sættes i inkubator ved 37 grader celcius natten over. De kom i inkubatoren kl Billeder fra dagen: Fredag d. 7/3: Ekstraktion: Prøverne blev taget ud af inkubatoren kl Peptiderne er nu i væsken. Alle prøverne centrifugeres for at sikre, at kondens på kanterne samles i bunden. Side 59 af 104

61 Opløsning 8: 5% myresyre Herefter tilsættes der 5 mikroliter myresyre. Myresyrens lave ph stopper reaktionen. Efterfølgende flyttes væsken over i nye eppendorfrør, for at undgå evt. kontaminering fra rørene. Der tilsættes 50 mikroliter acetonitril over gelstykkerne i de gamle rør for at vride det sidste væske ud af gelstykkerne. Vi centrifugerer alle prøverne for at få gelstykkerne ned i bunden, herefter pipetterer vi væsken over i de nye eppendorfrør. Prøverne er sat til at tørre kl Vi tager prøverne ud af vakuum centrifugen kl Ikke alle prøverne var tørre, så vi satte dem på frys weekenden over. Billeder fra dagen: Mandag d. 10/3 Opløsning 9: 88 mikroliter 2 % acetonitril mikroliter 0,1 % FA Der var en prøve, som var helt tørret ind (CD4-1). Til den tilsætter vi 20 mikroliter af opløsning 9 og sætter alle prøverne på frys. Efter weekenden tøer vi resten af prøverne op kl 9 og sætter dem i tørremaskinen igen for at få tørret de sidste prøver. Efter 2 timer tages de prøver ud som er tørre og der tilsættes 20 mikroliter af opløsning 9 og prøverne sættes på frys. De resterende prøver blev sat til tørre igen. Efter yderligere 1 time tog vi de resterende prøver ud, tilsatte opløsning 9 og satte alle prøver på frys (-80 grader) indtil vi kan lave MS. Side 60 af 104

62 A4 JOURNAL: PATIENT NUMMER 1 D. 25/ årig mand henvist til reumatologisk afdeling fra ortopædkirurgisk afdeling pga. mistanke om RA. Subjektivt: Allergier: nej Dispositioner: Nej Ekspositioner: Nej Tidligere: Pt. har KOL og diabetes type 2. Derudover har pt. haft forhøjet blodtryk, men er nu i blodtrykssænkende behandling. Han har forhøjet kolesterol. Pt. har tidligere på året oplevet hævelse på højre hånd, som dog forsvandt for få uger siden. Aktuelt: Pt. kommer ind pga. smerter, hævelse og funktionsnedsættelse i venstre håndled og albue siden december måned. Har fået taget en blodprøve. Viste ikke tegn på en RA, dog manglede de infektionstal. Øvrige organsystemer: ingen klager Medicin: Pt. får blodtrykssænkende medicin. Tobak/alkohol: Pt. drikker ikke alkohol, men han har røget pibe i 70 år, og ryger stadig. Socialt: Pensioneret enlig landmand, vant til at klare tingene selv. Bor stadig på egen gård og har et barnebarn, som hjælper med indkøb. Derudover har han hjemmehjælp, som gør rent én gang hver anden uge. Objektivt: Alment: God almen tilstand. Lymfeknuder: i.a. St.p.: i.a St.c.: i.a. Abdomen: i.a. Ekstremiteter: Pt. havde mange smerter i venstre arm. Kunne ikke strække albuen eller lave en gribehånd. Subkutan hævelse på hele ve. hånd og omkring ve. ankel. Ultralyd viste, at hævelsen lå subkutant i hele hånden, og derved var der ingen direkte ledhævelse. Hud: Sår på venstre fod. Lægen anbefalede, at pt. skulle se en hudlæge, da der hurtigt ville kunne komme infektion i såret. Plan: Lægen obs på lungecancer. Pt. henvises til Frederikshavns sygehus, hvor han skal have taget røntgen af thorax og en MR af venstre arm. Derudover skal patienten sove med armen liggende højt. Pt. bedes om at henvende sig igen, hvis resultaterne fra røntgen og thorax ikke viste noget, da han eventuelt ville kunne have gavn af en injektion med glukokortikoid. Lægen troede umiddelbart, at diagnosen var Puffy hand. Skulle ellers være obs på lungecancer. Side 61 af 104

63 A5 JOURNAL: PATIENT NUMMER 2 d Kvinde, 68 år henvist fra egen læge pga. mistanke om RA Subjektivt: Allergier: Nej Dispositioner: Kvinde Ekspositioner: Nej Tidligere: Har tidligere været i behandling for lungecancer, som har metastaser til columna. Hun går til løbende kontrol for denne cancer, og alle prøver viser tegn på, at den på nuværende tidspunkt er i bero. Aktuelt: Pt. beretter om aktuel ømhed, hævelse og rødme i 3. og 4. MCP-led samt 3. og 4. PIP-led. Derudover har hun i løbet af ugen haft smerter i begge håndled og ve. tommelfinger, som dog er kommet i bero. Pt. har haft disse turevise smerter gennem et halvt års tid. Øvrige organsystemer: nej Medicin: --- Tobak/alkohol: Nej Socialt: Er gift, men manden er svært ramt af demens. Hun plejer at passe manden hjemme, men pga. egen sygdom har dette ikke længere været muligt, og derfor er manden for nyligt flyttet på plejehjem. Hun besøger ham dagligt. Pt. er meget påvirket af dette. Objektivt: Alment: meget god almen tilstand Lymfeknuder: i.a. St.p.: i.a. St.c.: i.a. Abdomen: i.a. Ekstremiteter: pt. havde fuld mobilitet i sine led undtagen 3. og 4. MCP-led og 3. og 4. PIP-led på venstre hånd. Disse led var også hævede, røde og varme. Derudover var der smerte i 1. MTP-led på både ve. og hø. side. Ved palpation kunne der mærkes væske i og omkring leddene. Ultralyd af 3. og 4. MCP-led på venstre hånd viste øget synovialvæske i leddet. Hud: varm, tør og gode farver Plan: Patienten fik en injektion med glukokortikoider i 3. MCP-led på venstre hånd. Dette skulle gerne hjælpe i løbet af et døgns tid. Derudover fik hun taget nye blodprøver med infektionstal, RF og anti-ccp og røntgen af begge hænder og fødder. Der afventes på blodprøver og røntgen, inden patienten opstarter behandling med DMARDs, idet lægen ville sikre sig, at det var RA og ikke cancer, som gav symptomerne. Patienten fik en henvisning til Reumatologisk afdeling således, at hun kan komme ind, lige så snart leddene hæver op igen. Side 62 af 104

64 A6 BLODPRØVE: PATIENT NUMMER 1 Blodprøve for patient 1 Værdier Reference CRP 0,4 KIU/L <5 KIU/L Hæmoglobin 7,4 mmol/l 8,3-10,5 mmol/l Thrombocytter 353 * 10 9 pr. L * 10 9 pr. L Leukocyt 7,9 * 10 9 pr. L 3,5 10 * 10 9 pr. L Neutrofile granulocytter 5,31 * 10 9 pr. L 2,0-7,0 * 10 9 pr. L Lymfocytter 1,67 * 10 9 pr. L 1,30-3,5 * 10 9 pr. L Monocytter 0,72 * 10 9 pr. L 0,2-0,7 * 10 9 pr. L GFR > 90 ml/min > 60 ml/min Albumin 33 g/l g/l ALAT 17 unit/l unit/l Basisk phosphatase 69 unit/l unit/l RF 0,4 KlU/L <5 KlU/L D2 + D3 74 nanomol/l nanomol/l P-urat (dato 13.12) 0,15 nanomol/l 0,23-0,48 nanomol/l Side 63 af 104

65 A7 BLODPRØVE: PATIENT NUMMER 2 Blodprøve for patient 2 Værdier Reference CRP 11 mg/l 8 mg/l Hæmoglobin 7,6 mmol/l 7,3-9,5 mmol/l Thrombocytter 241 * 10^9 pr. L * 10^9 pr. L Leukocyt 6,4 * 10^9 pr. L 3,5* 10 9 pr. L Neutrofile granulocytter 4,12 * 10^9 pr. L 2-7 * 10 9 pr. L Lymfocytter 1,14 * 10^9 pr. L 1,30-3,5 * 10 9 pr. L Monocytter 0,41 * 10^9 pr. L GFR 76 ml/min > 60 ml/min Albumin 36 g/l g/l ALAT 29 unit/l unit/l Basisk phosphatase 232 unit/l unit/l RF 84 klu/l <5 KlU/L ACPA 92 ku/l <10 KlU/L D2-D3 99 nanomol/l nanomol/l Side 64 af 104

66 A8 SPEKTRA FOR CD4 Side 65 af 104

67 A9 SPEKTRUM FOR CD14 Side 66 af 104

68 A10 UDREGNING AF AMINOSYRESEKVENS FOR CD4 OG CD14 CD4 - Peptid 1 m/z for y-ion Udregning (Y x -ion Y x -ion) Aminosyresekvens Y9: 951,49908 m/z Y6: 652,37146 m/z Y6: 652,37146 m/z Y2: 248,16287 m/z Y2: 248,16287 m/z Y1: 147,11432 m/z 951,49908 m/z - 652,37146 m/z = 299,12762 m/z QNG 652,37146 m/z - 248,16287 m/z = 404,20859 m/z LFSG 248,16287 m/z - 147,11432 m/z = 101,04855 m/z T CD4 - Peptid 2 m/z for y-ion Udregning (Y x -ion Y x -ion) Aminosyresekvens Y6: 736,43018 m/z Y5: 623,34528 m/z Y5: 623,34528 m/z Y4: 522,29681 m/z Y4: 522,29681 m/z Y3: 375,22699 m/z Y3: 375,22699 m/z Y1: 147,11414 m/z 736,43018 m/z - 623,34528 m/z= 113,0849 m/z I 623,34528 m/z - 522,29681 m/z = 101,04847 m/z T 522,29681 m/z - 375,22699 m/z = 147,069 m/z F 375,22699 m/z - 147,11414 m/z = 228,11285 m/z DL CD14 peptid m/z for y-ion Udregning (Y x -ion Y x -ion) Aminosyresekvens Y17: 1765,9881 m/z Y16: 1634,9476 m/z Y16: 1634,9476 m/z Y15: 1537,8948 m/z Y15: 1537,8948 m/z Y14: 1440,8421 m/z Y14: 1440,8421 m/z Y13: 1327,7580 m/z Y13: 1327,7580 m/z Y12: 1230,7052 m/z Y12: 1230,7052 m/z Y11: 1117,6212 m/z Y11: 1117,6212 m/z Y10: 988,5786 m/z Y10: 988,5786 m/z Y9: 917,5415 m/z Y9: 917,5415 m/z Y6: 646,3882 m/z Y6: 646,3882 m/z Y4: 462,2671 m/z 1765,9881 m/z ,9476 m/z = 131,0405 m/z M 1634,9476 m/z 1537,8948 m/z = 97,0528 m/z P 1537,8948 m/z ,8421 m/z = 97,0527 m/z P 1440,8421 m/z ,7580 m/z = 113,0841 m/z L 1327,7580 m/z ,7052 m/z = 97,0528 m/z P 1230,7052 m/z ,6212 m/z = 113,084 m/z L 1117,6212 m/z - 988,5786 m/z = 129,0426 m/z E 988,5786 m/z 917,5415 m/z = 71,0371 m/z A 917,5415 m/z - 646,3882 m/z = 271,1533 m/z TGL 646,3882 m/z - 462,2671 m/z = 184,1211 m/z AL Side 67 af 104

69 Oversigt over aminosyrers masse Aminosyre Kode (3 bogstaver) Kode (1 bogstav) Monoisotopisk masse Kemisk masse Glycin Gly G 57, ,052 Alanin Ala A 71, ,079 Serin Ser S 87, ,078 Prolin Pro P 97, ,117 Valin Val V 99, ,133 Threonin Thr T 101, ,105 Cystein Cys C 103, ,144 Isoleucin Ile I 113, ,160 Leucin Leu L 113, ,160 Asparagin Asn N 114, ,104 Aspartat Asp D 115, ,089 Glutamin Gln Q 128, ,131 Lysin Lys K 128, ,174 Glutamat Glu E 129, ,116 Methionin Met M 131, ,198 Histidin His H 137, ,142 Phenylalanin Phe F 147, ,177 Arginin Arg R 156, ,188 Tyrosin Tyr Y 163, ,17 Tryptofan Trp W 186, ,213 Side 68 af 104

70 A11 NCBI-BLAST FOR CD4 OG CD14 NCBI-Blast for peptid 1. Tabel over mulige proteiner den fundne aminosyresekvens kunne findes i. NCBI-Blast for peptid 2. Tabel over mulige proteiner den fundne aminosyresekvens kunne findes i. Side 69 af 104

71 Udsnit fra NCBI-Blast for CD14. Tabel over mulige proteiner den fundne aminosyresekvens kunne findes i. Side 70 af 104

72 A12 SAMMENLIGNING AF CD14-PROTEINERNE Sammenligningen er lavet ved hjælp af programmet Clustal W2 ud fra proteinerne P08571 (Membranbundet form af CD14-proteinet) og D6RFL4 (urinær form af CD14-proteinet). CLUSTAL 2.1 multiple sequence alignment sp P08571 CD14_HUMAN MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQ 50 tr D6RFL4 D6RFL4_HUMAN MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQ 50 ************************************************** sp P08571 CD14_HUMAN CVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQ 100 tr D6RFL4 D6RFL4_HUMAN CVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQ 100 ************************************************** sp P08571 CD14_HUMAN VPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLR 150 tr D6RFL4 D6RFL4_HUMAN VPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLR 150 ************************************************** sp P08571 CD14_HUMAN NVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLD 200 tr D6RFL4 D6RFL4_HUMAN NVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLD 200 ************************************************** sp P08571 CD14_HUMAN LSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQ 250 tr D6RFL4 D6RFL4_HUMAN LSDNPGLGERGLM ************* sp P08571 CD14_HUMAN PHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR 300 tr D6RFL4 D6RFL4_HUMAN sp P08571 CD14_HUMAN VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP 350 tr D6RFL4 D6RFL4_HUMAN sp P08571 CD14_HUMAN ACARSTLSVGVSGTLVLLQGARGFA 375 tr D6RFL4 D6RFL4_HUMAN Side 71 af 104

73 A13 - ANALYSEBRUGSANVISNING: SEPARERING MED DYNABEADS Navn Bovine serum albumin PBS RPMI 1640 medium Cas nr Koncentratio n H/R-sætninger P/S-sætninger Piktogram Affaldsgrupp e 98 % H X H Penicillin U/mL R43: Kan give overfølsomhed ved kontakt med huden. R36 + R37 + R38: Irriterer øjnene, åndedrætsorganern e og huden. S26: Kommer stoffet i øjnene, skylles straks grundigt med vand og læge kontaktes. S36 + S37: Brug særligt arbejdstøj og egnede beskyttelseshandsker. S24 + S25: Undgå kontakt med huden og øjnene. H Streptomyci n (OBS) H Histopaque 1077 H319: Forårsager alvorlig øjenirritation. H315: Forårsager hudirritation. P305 + P351 + P338: Ved kontakt med øjnene: Skyl forsigtigt med vand i flere minutter. Fjern eventuelle kontaktlinser, hvis dette kan gøres let. Fortsæt skylning. H Trypan blue (OBS) 0,4 % H350: Kan fremkalde kræft. P201: Indhent særlige anvisninger før brug. P308 + P313: Ved eksponering eller mistanke om eksponering: Søg lægehjælp. B EDTA (OBS) H319: Forårsager alvorlig øjenirritation. P280: Bær beskyttelseshandsker/øjenbeskyttels e. P305 + P351 + P338: Ved kontakt med øjnene: Skyl forsigtigt med vand i flere minutter. Fjern eventuelle kontaktlinser, hvis dette kan gøres let. Forsæt skylning. H FBS H Side 72 af 104

74 A14 - ANALYSEBRUGSANVISNING: IN-GEL DIGESTION Navn Cas nr. Koncentrati on H/R-sætninger P/S-sætninger Piktogram Affaldsgruppe Triethylammonium bicarbonat buffer M Acetonitril H225: Meget brandfarlig væske og damp. H302: Farlig ved indtagelse. H312: Farlig ved hudkontakt. H319: Forårsager alvorlig øjenirritation. H332: Farlig ved indånding. Dithiotreitol H302: Farlig ved indtagelse. H315: Forårsager hudirritation. H319: Forårsager alvorlig øjenirritation. H335: Kan forårsage irritation af luftvejene. Iodoacetamid H301: Giftig ved indtagelse. H317: Kan forårsage allergisk hudreaktion. H334: Kan forårsage allergi- eller astmasymptomer eller åndedrætsbesvær ved indånding. H413: Kan forårsage langvarige skadelige virkninger for vandlevende organismer. Trypsin H319: Forårsager alvorlig øjenirritation. H335: Kan forårsage irritation af luftvejene. H315: Forårsager hudirritation. H334: Kan forårsage allergi- eller astmasymptomer eller åndedrætsbesvær ved indånding. P210: Holdes væk fra varme/gnister/åben ild/varme overflader. Rygning forbudt. P280: Bær beskyttelseshandsker/beskyttelsestøj /øjenbeskyttelse/ansigtsbeskyttelse. P305+P351+ P338: Ved kontakt med øjnene: skyl forsigtigt med vand i flere minutter. Fjern eventuelle kontaktlinser, hvis dette kan gøres let. Fortsæt skylning. P261: Undgå indånding af pulver. P305+P351+P338: Ved kontakt med øjnene: Skyl forsigtigt med vand i flere minutter. Fjern eventuelle kontaktlinser, hvis dette kan gøres let. Fortsæt skyldning. P261: Undgå indånding af pulver. P280: Bær beskyttelseshandsker/beskyttelsestøj / øjenbeskyttelse ansigtsbeskyttelse. P301+P310: I tilfælde af indtagelse: Ring omgående til en giftinformation eller en læge. P342+P311: Ved luftvejssymptomer: Ring til en giftinformation eller en læge. P261: Undgå indånding af pulver. P280: Bær beskyttelseshandsker/beskyttelsestøj /øjenbeskyttelse/ansigtsbeskyttelse. P337+P313: Ved vedvarende øjenirritation: Søg lægehjælp. P304+P341: Ved indånding: Ved vejrtrækningsbesvær: Flyt personen til et sted med frisk luft og sørg for, at vedkommende hviler i en stilling, som letter vejrtrækningen. P342+P311: Ved luftvejssymptomer: Ring til en giftinformation eller en læge. P403+P233: Opbevares på et godt ventileret sted. Hold beholderen tæt lukket. C B Z H Side 73 af 104

75 Formic acid /myresyre % H314: Forårsager svære forbrændinger af huden og øjenskader. P280: Bær beskyttelseshandsker/beskyttelsestøj /øjenbeskyttelse/ansigtsbeskyttelse. P305+P351+P338: Ved kontakt med øjnene: Skyl forsigtigt med vand i flere minutter. Fjern eventuelle kontaktlinser, hvis dette kan gøres let. Fortsæt skyldning. P310: Ring omgående til en giftinformation eller en læge. Z Side 74 af 104

76 A15 ANALYSEBRUGSANVISNING: SDS-PAGE Navn Cas nr. Koncentrat ion Sodium dodecyl sulfate solution Tris(hydrox ymethyl)a minometh ane hydrochlor ide solution (også kaldt Tris-HCl) Glycerol Bromophe nol blue H/R-sætninger P/S-sætninger Piktogram Affaldsgr uppe 10 % i vand H315: Forårsager hudirritation. H318: Forårsager alvorlig øjenskade. H315: Forårsager hudirritation. H319: Forårsager alvorlig øjenirritation. P280: Bær beskyttelseshandsker /beskyttelsestøj/øjenbeskyttelse /ansigtsbeskyttelse. P305+P351+P338: Ved kontakt med øjnene: Skyl forsigtigt med vand i flere minutter. Fjern eventuelle kontaktlinser, hvis dette kan gøres let. Fortsæt skylning. P305+P351+P338: Ved kontakt med øjnene: Skyl forsigtigt med vand i flere minutter. Fjern eventuelle kontaktlinser, hvis dette kan gøres let. Fortsæt skylning. >99 % Ingen mærkning. Ingen mærkning. H H410: Meget giftig med langvarige virkninger for vandlevende organismer. P273: Undgå udledning til miljøet. Z Z H Glycine Mini Protean Tris-HCl ready gel Brilliant Blue G Methanol % Ingen mærkning Ingen mærkning H 4-20 % Ingen mærkning Ingen mærkning Ingen mærkning Ingen mærkning B H225: Meget brandfarlig væske og damp. H301: Giftig ved indtagelse. H311: Giftig ved hudkontakt. H331: Giftig ved indånding. H370: Forårsager organskader. P210: Holdes væk fra varme/gnister/åben ild/varme overflader. Rygning forbudt. P260: Indånd ikke pulver/røg/ tåge/damp/spray. P280: Bær beskyttelseshandsker/ beskyttelsestøj/øjenbeskyttelse /ansigtsbeskyttelse. P301+P310: I tilfælde af indtagelse: Ring omgående til en giftinformation eller en læge. P311: Ring til en giftinformation eller en læge. C Side 75 af 104

Reumatoid Artrit Hvad a er e r eu e mat a o t id i ar a trit i (RA)? Prævalens og forekomst

Reumatoid Artrit Hvad a er e r eu e mat a o t id i ar a trit i (RA)? Prævalens og forekomst Reumatoid Artrit Hvad er reumatoid artrit (RA)? Reumatoid artrit (RA) er en kronisk autoimmunologisk sygdom, som er karakteriseret ved inflammation i synovialmembranen (synovium), hvilket fører til leddestruktion,

Læs mere

Eksamen i Modul 2.2, Det hæmatologiske system og immunforsvaret MEDIS, AAU, 2. semester, juni 2010

Eksamen i Modul 2.2, Det hæmatologiske system og immunforsvaret MEDIS, AAU, 2. semester, juni 2010 MedIS, AAU. Det hæmatologiske system og immunforsvaret, 7. Juni 2010 1 Navn: Studienummer: Eksamen i Modul 2.2, Det hæmatologiske system og immunforsvaret MEDIS, AAU, 2. semester, juni 2010 Dette eksamenssæt

Læs mere

Skriftlig eksamen april 2017

Skriftlig eksamen april 2017 Studienummer: 1/10 Skriftlig eksamen april 2017 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Medicin og medicin med industriel specialisering 2. semester Eksamensdato:

Læs mere

Reeksamen 2013. Det hæmatologiske system og immunsystemet. Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11.

Reeksamen 2013. Det hæmatologiske system og immunsystemet. Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11. 1/10 Reeksamen 2013 Titel på kursus: Uddannelse: Semester: Eksamensdato: Tid: Bedømmelsesform Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Læs mere

Re- eksamen 2014. Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11.

Re- eksamen 2014. Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11. 1/10 Re- eksamen 2014 Titel på kursus: Uddannelse: Semester: Eksamensdato: Tid: Bedømmelsesform Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Læs mere

Forårseksamen 2016. Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Forårseksamen 2016. Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 1 Forårseksamen 2016 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 2. semester Eksamensdato: 11. april

Læs mere

Immunologi- det store overblik. Dyrlæge Rikke Søgaard Teknisk rådgiver, Merial Norden A/S

Immunologi- det store overblik. Dyrlæge Rikke Søgaard Teknisk rådgiver, Merial Norden A/S Immunologi- det store overblik Dyrlæge Rikke Søgaard Teknisk rådgiver, Merial Norden A/S Hvem er jeg Rikke Søgaard Uddannet dyrlæge i 1998 Ansat 5 år i praksis både blandet og svinepraksis Ansat 5 år på

Læs mere

Europaudvalget EUU alm. del - Bilag 146 Offentligt. Resumé

Europaudvalget EUU alm. del - Bilag 146 Offentligt. Resumé Europaudvalget EUU alm. del - Bilag 146 Offentligt Grundnotat til Folketingets Europaudvalg om forslag til kommissionsbeslutning om udstedelse af markedsføringstilladelse med betingelser for lægemidlet

Læs mere

MÅLRETTET BEHANDLING AF LUNGEKRÆFT PATIENTINFORMATION OM NYESTE BEHANDLINGSMULIGHEDER

MÅLRETTET BEHANDLING AF LUNGEKRÆFT PATIENTINFORMATION OM NYESTE BEHANDLINGSMULIGHEDER MÅLRETTET BEHANDLING AF LUNGEKRÆFT PATIENTINFORMATION OM NYESTE BEHANDLINGSMULIGHEDER I løbet af det seneste årti har vi fået langt mere viden om, hvordan kræft udvikler sig. På baggrund af denne viden

Læs mere

Reeksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Reeksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 1 Reeksamen 2015 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 2. semester Eksamensdato: 10. august

Læs mere

DANBIO, Copenhagen University Hospital at Hvidovre

DANBIO, Copenhagen University Hospital at Hvidovre Hvordan kan data fra helseregistre bedre pasientbehandlingen og sikre rasjonell bruk av medisiner i et samfunnsperspektiv? Merete Lund Hetland, MD, PHD, ass. professor The DANBIO registry Department of

Læs mere

Immunforsvar. Kampen i kroppen. Immunforsvar. Praxis Nyt Teknisk Forlag. Immunforsvar kampen i kroppen. Ib Søndergaard Mads Duus Hjortsø

Immunforsvar. Kampen i kroppen. Immunforsvar. Praxis Nyt Teknisk Forlag. Immunforsvar kampen i kroppen. Ib Søndergaard Mads Duus Hjortsø Immunforsvar kampen i kroppen Vores krop bliver dagligt angrebet af bakterier, virus, parasitter og mikrosvampe. Men vi har heldigvis et immunforsvar, der er i stand til at kæmpe mod disse angreb. Forklaringen

Læs mere

Sommereksamen 2011. Uddannelse: Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Sommereksamen 2011. Uddannelse: Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 1/14 Sommereksamen 2011 Titel på kursus: Det hæmatologiske system og immunsystemet Uddannelse: Bacheloruddannelsen i Medicin/Medicin med industriel specialisering Semester: 2. semester Eksamensdato: 06.

Læs mere

A ô. H صدêس ëà شâطâµش مà apple é µfiàëà êëسà àëشق ëمappleشêس ëس à àش ششâapple صâ éصéëش. . é î à,. ½ش ز

A ô. H صدêس ëà شâطâµش مà apple é µfiàëà êëسà àëشق ëمappleشêس ëس à àش ششâapple صâ éصéëش. . é î à,. ½ش ز A ô H صدêس ëà شâطâµش مà apple é µfiàëà êëسà àëشق ëمappleشêس ëس à àش ششâapple صâ éصéëش. é î à,. ½ش ز ئ ô شش ëéش طشàش, appleappleâ é ë شâ âêâ âق â œ êê طâà س, ô شش ëéش fi àâêâطâµش fi ش ں ق ëâطâµش fi دàëéâ

Læs mere

Forårseksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Forårseksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 1 Forårseksamen 2015 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 2. semester Eksamensdato: 10. april

Læs mere

www.printo.it/pediatric-rheumatology/dk/intro

www.printo.it/pediatric-rheumatology/dk/intro www.printo.it/pediatric-rheumatology/dk/intro PAPA syndromet Version af 2016 1. HVAD ER PAPA 1.1 Hvad er det? PAPA er en forkortelse for Pyogen Artritis, Pyoderma gangrenosum og Akne. Det er en genetisk

Læs mere

IL-1 receptor antagonist mangel (DIRA)

IL-1 receptor antagonist mangel (DIRA) www.printo.it/pediatric-rheumatology/dk/intro IL-1 receptor antagonist mangel (DIRA) Version af 2016 1. HVAD ER DIRA 1.1 Hvad er det? IL-1 receptor antagonist mangel (Deficiency of IL-1Receptor Antagonist,

Læs mere

Humanbiologi - Lymfesystemet og Immunologi

Humanbiologi - Lymfesystemet og Immunologi Humanbiologi - Lymfesystemet og Immunologi Lymfekarrets vægge er tyndere end venernes og har ligesom dem også klapper. Der er fælles indløb til vena cava superior, hvor den øvre indløbsgren drænerer koppens

Læs mere

Sommereksamen 2013 Med korte, vejledende svar

Sommereksamen 2013 Med korte, vejledende svar 1/10 Sommereksamen 2013 Med korte, vejledende svar Titel på kursus: Uddannelse: Semester: Eksamensdato: Tid: Bedømmelsesform Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin

Læs mere

www.printo.it/pediatric-rheumatology/dk/intro

www.printo.it/pediatric-rheumatology/dk/intro www.printo.it/pediatric-rheumatology/dk/intro Blau syndrom Version af 2016 1. HVAD ER BLAU SYNDROM/JUVENIL SARKOIDOSE 1.1 Hvad er det? Blau syndrom er en genetisk sygdom. Som patient lider man af en kombination

Læs mere

Målepunkter vedr. reumatologi for Sundhedsstyrelsens tilsyn med private behandlingssteder

Målepunkter vedr. reumatologi for Sundhedsstyrelsens tilsyn med private behandlingssteder Målepunkter vedr. reumatologi for Sundhedsstyrelsens tilsyn med private behandlingssteder 30. januar 2014 1. Reumatoid artrit 1.1 Journal: Udredning Gennemgang af et antal journaler viste, at nydiagnosticerede

Læs mere

Elektronisk kvalitetsredskab, forskningsdatabase og patientjournal.

Elektronisk kvalitetsredskab, forskningsdatabase og patientjournal. Elektronisk kvalitetsredskab, forskningsdatabase og patientjournal. Udfordringer og muligheder. Erfaringer fra DANBIO Dansk Reumatologisk Database Merete Lund Hetland, MD, PHD, DMSc, ass. professor The

Læs mere

Re- eksamen 2014. Med korte, vejledende svar

Re- eksamen 2014. Med korte, vejledende svar 1/10 Re- eksamen 2014 Med korte, vejledende svar (Heri angives de facts, der skal nævnes i besvarelserne, men ikke de uddybende forklaringer, tegninger etc., der i nogle af opgaverne også forventes, for

Læs mere

ved inflammatorisk tarmsygdom

ved inflammatorisk tarmsygdom BEHANDLING MED ADACOLUMN ved inflammatorisk tarmsygdom www.adacolumn.net INDHOLD Mave-tarmkanalen...4 Colitis ulcerosa...6 Crohns sygdom...8 Immunforsvaret ved IBD...10 Sådan fungerer Adacolumn...12 Behandling

Læs mere

Cancerbehandling: Vaccination med dendritiske celler

Cancerbehandling: Vaccination med dendritiske celler Cancerbehandling: Vaccination med dendritiske celler P4-projekt udarbejdet af gruppe 407, 4. semester 2009 Medicin med Industriel Specialisering Aalborg Universitet, Danmark Det Ingeniør-, Natur- og Sundhedsvidenskabelige

Læs mere

Immunologi- det store overblik

Immunologi- det store overblik Immunologi- det store overblik Dyrlæge Rikke Søgaard Teknisk rådgiver, Merial Norden A/S Hvem er jeg Rikke Søgaard Uddannet dyrlæge i 1998 Ansat 5 år i praksis både blandet og svinepraksis Ansat 5 år på

Læs mere

Biosimilær behandling med monoklonalt antistof i Danmark Synspunkter

Biosimilær behandling med monoklonalt antistof i Danmark Synspunkter Biosimilær behandling med monoklonalt antistof i Danmark Synspunkter Ulrik Tarp Ledende overlæge, lektor, dr.med. Reumatologisk afdeling Aarhus Universitetshospital Interessekonflikt Investigator/konsulent/underviser:

Læs mere

Forårseksamen Med korte, vejledende svar

Forårseksamen Med korte, vejledende svar Studienummer: 1/10 Forårseksamen 2014 Med korte, vejledende svar (Heri angives de facts, der skal nævnes i besvarelserne, men ikke de uddybende forklaringer, tegninger etc., der i nogle af opgaverne også

Læs mere

Behandlingsvejledning for biologisk behandling af reumatoid artritis (RA)

Behandlingsvejledning for biologisk behandling af reumatoid artritis (RA) Behandlingsvejledning for biologisk behandling af reumatoid artritis (RA) Fagudvalg under Rådet for Anvendelse af Dyr Sygehusmedicin, RADS, er et rådgivende udvalg, som udarbejder udkast til behandlingsvejledning

Læs mere

Reeksamen 2015. Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11.

Reeksamen 2015. Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11. 1 Reeksamen 2015 Titel på kursus: Uddannelse: Semester: Eksamensdato: Tid: Bedømmelsesform Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Læs mere

SLE - Systemisk Lupus Erythematosus

SLE - Systemisk Lupus Erythematosus www.printo.it/pediatric-rheumatology/dk/intro SLE - Systemisk Lupus Erythematosus Version af 2016 2. DIAGNOSE OG BEHANDLING 2.1 Hvordan stilles diagnosen? Diagnosen SLE stilles udfra en kombination af

Læs mere

www.printo.it/pediatric-rheumatology/dk/intro CANDLE Version af 2016 1. HVAD ER CANDLE 1.1 Hvad er det? Kronisk Atypisk Neutrofil Dermatose med Lipodystrofi og forhøjet temperatur (CANDLE) er en sjælden

Læs mere

Immunologi. AMU kursus

Immunologi. AMU kursus Immunologi AMU kursus Udarbejdet af Morten Kobæk Larsen 2012 Indledning Mennesker og dyr er konstant truet af sygdomsfremkaldende mikroorganismer, f.eks. virus og bakterier, og ville hurtigt blive bukke

Læs mere

Behandling af Crohn s sygdom med lægemidlet Methotrexat

Behandling af Crohn s sygdom med lægemidlet Methotrexat Hillerød Hospital Kirurgisk Afdeling Behandling af Crohn s sygdom med lægemidlet Methotrexat Patientinformation April 2011 Forfatter: Gastro-medicinsk ambulatorium Hillerød Hospital Kirurgisk Afdeling

Læs mere

Juvenil Spondylartrit/Enthesitis-relateret artrit (GIGT) (SPA-ERA)

Juvenil Spondylartrit/Enthesitis-relateret artrit (GIGT) (SPA-ERA) www.printo.it/pediatric-rheumatology/dk/intro Juvenil Spondylartrit/Enthesitis-relateret artrit (GIGT) (SPA-ERA) Version af 2016 2. DIAGNOSE OG BEHANDLING 2.1 Hvordan stilles diagnosen? Lægen kalder sygdommen

Læs mere

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred Kandidatuddannelsen i Folkesundhedsvidenskab Aalborg Universitet 1. Semester projekt Gruppe nummer: 755 Vejleder: Henrik Bøggild

Læs mere

Re- eksamen 2012 Med korte, vejledende svar

Re- eksamen 2012 Med korte, vejledende svar Studienummer: 1 Re- eksamen 2012 Med korte, vejledende svar Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Læs mere

Behandlingsvejledning for biologisk behandling af Reumatoid Artritis (RA)

Behandlingsvejledning for biologisk behandling af Reumatoid Artritis (RA) Behandlingsvejledning for biologisk behandling af Reumatoid Artritis (RA) Fagudvalg under Rådet for Anvendelse af Dyr Sygehusmedicin, RADS, er et rådgivende udvalg, som udarbejder udkast til behandlingsvejledning

Læs mere

Oliver Hendricks Overlæge, ph.-d. Klinisk lektor Syddansk Universitet

Oliver Hendricks Overlæge, ph.-d. Klinisk lektor Syddansk Universitet Oliver Hendricks Overlæge, ph.-d. Klinisk lektor Syddansk Universitet Compounds which are chemically foreign or hostile to a biological system Eukaryotic drugs Other chemical compounds Drugs Eukaryotedirected

Læs mere

Reeksamen Det hæmatologiske system og immunsystemet. Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Reeksamen Det hæmatologiske system og immunsystemet. Bacheloruddannelsen i Medicin/Medicin med industriel specialisering Studienummer: 1/10 Reeksamen 2013 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 2. semester Eksamensdato:

Læs mere

Sommereksamen 2012 Med korte, vejledende svar

Sommereksamen 2012 Med korte, vejledende svar 1 Sommereksamen 2012 Med korte, vejledende svar Titel på kursus: Uddannelse: Semester: ksamensdato: Tid: Bedømmelsesform Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin

Læs mere

Studieplan Biomedicin og humanbiologi Semester 5

Studieplan Biomedicin og humanbiologi Semester 5 OMRÅDET FOR SUNDHEDSUDDANNELSER Studieplan Biomedicin og humanbiologi Semester 5 Bioanalytikeruddannelsen i Odense Efterår 2017 Semester 5 Indhold 1. Fagets fokus og emner... 3 2. Lektionsplan... 4 3.

Læs mere

Forårseksamen 2016. Med korte, vejledende svar

Forårseksamen 2016. Med korte, vejledende svar 1 Forårseksamen 2016 Med korte, vejledende svar (Heri angives de facts, der skal nævnes i besvarelserne, men ikke nødvendigvis de uddybende forklaringer, der i nogle af opgaverne forventes, for at man

Læs mere

Leucocyt-forstyrrelser

Leucocyt-forstyrrelser Leucocyt-forstyrrelser Udarbejdet af KLM med inspiration fra Kako S4 pensum fra bogen Hæmatologi af H. Karle Granulocytsygdomme Lymfocytsygdomme Leukæmier M-proteinæmi Analyser Referenceområde [LKC]: 3.0

Læs mere

Syge- og reeksamen august 2011 Med svar. Uddannelse: Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Syge- og reeksamen august 2011 Med svar. Uddannelse: Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 1/10 Syge- og reeksamen august 2011 Med svar Titel på kursus: Det hæmatologiske system og immunsystemet Uddannelse: Bacheloruddannelsen i Medicin/Medicin med industriel specialisering Semester: 2. semester

Læs mere

Im-F1 Det medfødte immunsystem Modul b10 E08

Im-F1 Det medfødte immunsystem Modul b10 E08 Det medfødte immunsystem defineres og sammenlignes med det erhvervede immunsystem mht. receptorspecificitet ( pathogen-associated molecular patterns ) herunder hvordan det medfødte immunsystem diskriminerer

Læs mere

Alfa-1-antitrysin mangel hos børn. Elisabeth Stenbøg, Afd.læge, PhD Børneafd. A, AUH

Alfa-1-antitrysin mangel hos børn. Elisabeth Stenbøg, Afd.læge, PhD Børneafd. A, AUH Alfa-1-antitrysin mangel hos børn Elisabeth Stenbøg, Afd.læge, PhD Børneafd. A, AUH Hvad er det? Alfa-1-antitrypsin Proteinstof Produceres i leveren Fungerer i lungerne Regulerer neutrofil elastase balancen

Læs mere

Behandlingsvejledning for terapiområdet Biologisk Behandling af Kroniske Inflammatoriske Tarmsygdomme

Behandlingsvejledning for terapiområdet Biologisk Behandling af Kroniske Inflammatoriske Tarmsygdomme Behandlingsvejledning for terapiområdet Biologisk Behandling af Kroniske Inflammatoriske Tarmsygdomme Fagudvalg under Rådet for Anvendelse af Dyr Sygehusmedicin, RADS, er interne, rådgivende arbejdsgrupper,

Læs mere

GENMABS HUMAX-CD4 FÅR FAST TRACK STATUS FRA FDA

GENMABS HUMAX-CD4 FÅR FAST TRACK STATUS FRA FDA Contact: Genmab A/S Bredgade 23 1260 København K Danmark Tel + 45 7020 2728 Fax + 45 7020 2729 CVR no. 2102 3884 Rachel Gravesen VP IR&PR T: +45 33 44 77 30 M: +45 25 40 30 01 E: rcg@genmab.com Bea Evangelista

Læs mere

langerhans celle histiocytose i Børnecancerfonden informerer

langerhans celle histiocytose i Børnecancerfonden informerer langerhans celle histiocytose i langerhans celle histiocytose 3 Fra de danske børnekræftafdelinger i Aalborg, Århus, Odense og Rigshospitalet, September 2004. Biologi Langerhans cellerne spiller den centrale

Læs mere

Syv transmembrane receptorer

Syv transmembrane receptorer Syv transmembrane receptorer Receptoren som kommunikationscentral Cellemembranen definerer grænsen mellem en celles indre og ydre miljø, der er meget forskelligt. Det er essentielt for cellens funktion

Læs mere

Title Mevalonat Kinase Defekt (MKD) (eller HYper IgD syndrome)

Title Mevalonat Kinase Defekt (MKD) (eller HYper IgD syndrome) www.printo.it/pediatric-rheumatology/dk/intro Title Mevalonat Kinase Defekt (MKD) (eller HYper IgD syndrome) Version af 2016 1. HVAD ER MKD 1.1 Hvad er det? Mevalonat kinase mangel er en genetisk sygdom.

Læs mere

Skriftlig eksamen april 2017

Skriftlig eksamen april 2017 Skriftlig eksamen april 2017 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Medicin og medicin med industriel specialisering 2. semester Eksamensdato: 6. april 2017 Tid:

Læs mere

MOLEKYLÆR MEDICN BACHELORUDDANNELSEN MEDICINSK MIKROBIOLOGI OG IMMUNOLOGI

MOLEKYLÆR MEDICN BACHELORUDDANNELSEN MEDICINSK MIKROBIOLOGI OG IMMUNOLOGI AARHUS UNIVERSITET MOLEKYLÆR MEDICN BACHELORUDDANNELSEN MEDICINSK MIKROBIOLOGI OG IMMUNOLOGI Tirsdag den 7. juni 2011 kl. 9.00-13.00 ************** Alle opgaver i dette sæt skal besvares. Essays A. Staphylococcus

Læs mere

Modul 09a F902a-2. Dysregulering og analyser af Calcium-Fosfat Stofskiftet

Modul 09a F902a-2. Dysregulering og analyser af Calcium-Fosfat Stofskiftet Modul 09a F902a-2 Dysregulering og analyser af Calcium-Fosfat Stofskiftet Søren Frank Jørgensen Lektor Navn Navnesen Titel Side 1 Afdelning 10 august 2009 Ændringer til næste gang. FO i dysreg er nu lidt

Læs mere

Kræft. Alex Hansen Euc-Syd Sønderborg HTX 10/1/2010. news/possible-cancer-vaccines/. 29.09.2010. (Billede)

Kræft. Alex Hansen Euc-Syd Sønderborg HTX 10/1/2010. news/possible-cancer-vaccines/. 29.09.2010. (Billede) 2010 Kræft Alex Hansen Euc-Syd Sønderborg HTX 1 Cancer cells. Densley, Ross. Set: http://www.ngpharma.com/ news/possible-cancer-vaccines/. 29.09.2010. (Billede) 10/1/2010 Titelblad Skolens navn: Euc-Syd

Læs mere

www.printo.it/pediatric-rheumatology/dk/intro

www.printo.it/pediatric-rheumatology/dk/intro www.printo.it/pediatric-rheumatology/dk/intro Majeed Version af 2016 1. HVAD ER MAJEED 1.1 Hvad er det? Majeed er en sjælden genetisk sygdom. Børn med denne sygdom lider af CRMO (kronisk rekurrent multifokal

Læs mere

Behandling af Crohn s sygdom med Humira.(Adalimumab)

Behandling af Crohn s sygdom med Humira.(Adalimumab) Hillerød Hospital Kirurgisk afdeling Behandling af Crohn s sygdom med Humira.(Adalimumab) Patientinformation 2011 Forfattere: Gastro-medicinsk ambulatorium Hillerød Hospital Kirurgisk Afdeling Helsevej

Læs mere

SLIDGIGT GIGT. samt udtalt hypermobilitet kan også være medvirkende årsager til, at du får slidgigt.

SLIDGIGT GIGT. samt udtalt hypermobilitet kan også være medvirkende årsager til, at du får slidgigt. Gigt SLIDGIGT Slidgigt er den hyppigste form for gigt. Omkring halvdelen af den voksne befolkning over 40 år har tegn på slidgigt i et eller flere led og alle får det, hvis de lever længe nok. Slidgigt

Læs mere

IM-H11 Parasitter og immunsystemet Modul b10 E08 Abstrakt Grith Lykke Sørensen Senest opdateret: 13-11-2008

IM-H11 Parasitter og immunsystemet Modul b10 E08 Abstrakt Grith Lykke Sørensen Senest opdateret: 13-11-2008 IM-H11 Parasitter og immunsystemet Forskellige parasitters metoder til at omgå det adaptive immunsystem gennemgås, bla malaria og trypanosomiasis. TH2 celler defineres og deres dannelse udfra TH0 omtales.

Læs mere

21. Mandag Kroppens forsvar (at last...)

21. Mandag Kroppens forsvar (at last...) 21. Mandag Kroppens forsvar (at last...) Kroppens forsvar overordnet Det er formålet med immunforsvaret at: 1) beskytte mod indtrængende mikrober (mikroorganismer), f.eks. virus, bakterie, svampe og parasitter,

Læs mere

Juvenil Idiopatisk Artrit (JIA) / børneleddegigt

Juvenil Idiopatisk Artrit (JIA) / børneleddegigt www.printo.it/pediatric-rheumatology/dk/intro Juvenil Idiopatisk Artrit (JIA) / børneleddegigt Version af 2016 1. HVAD ER BØRNELEDDEGIGT (JIA) 1.1 Hvad drejer det sig om? Juvenil Idiopatisk Artrit (JIA)

Læs mere

Patientinformation DBCG 04-b

Patientinformation DBCG 04-b information DBCG 04-b Behandling af brystkræft efter operation De har nu overstået operationen for brystkræft. Selvom hele svulsten er fjernet ved operationen, er der alligevel i nogle tilfælde en risiko

Læs mere

Anvendelse af anti-ccp i praksis Kan anti-ccp erstatte Rheumafaktor? ANA analyse og anvendelse i praksis

Anvendelse af anti-ccp i praksis Kan anti-ccp erstatte Rheumafaktor? ANA analyse og anvendelse i praksis Anvendelse af anti-ccp i praksis Kan anti-ccp erstatte Rheumafaktor? ANA analyse og anvendelse i praksis Trine Korsholm Klinisk Immunologisk Afdeling CEK Aarhus Universitetshospital, Skejby November 2016

Læs mere

Familiær middelhavsfeber

Familiær middelhavsfeber www.printo.it/pediatric-rheumatology/dk/intro Familiær middelhavsfeber Version af 2016 2. DIAGNOSE OG BEHANDLING 2.1 Hvordan diagnosticeres det? Overordnet set anvendes følgende tilgang: Klinisk mistanke:

Læs mere

Hvad er Myelodysplastisk syndrom (MDS)?

Hvad er Myelodysplastisk syndrom (MDS)? Hvad er Myelodysplastisk syndrom (MDS)? En information til patienter og pårørende Denne folder støttes af: Patientforeningen for Lymfekræft, Leukæmi og MDS Velkommen Dette hæfte er udviklet for at give

Læs mere

Sommereksamen 2013. Det hæmatologiske system og immunsystemet. Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11.

Sommereksamen 2013. Det hæmatologiske system og immunsystemet. Bacheloruddannelsen i Medicin/Medicin med industriel specialisering. kl. 09.00-11. 1/10 Sommereksamen 2013 Titel på kursus: Uddannelse: Semester: Eksamensdato: Tid: Bedømmelsesform Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Læs mere

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen Øjnene, der ser - sanseintegration eller ADHD Professionshøjskolen UCC, Psykomotorikuddannelsen Professionsbachelorprojekt i afspændingspædagogik og psykomotorik af: Anne Marie Thureby Horn Sfp o623 Vejleder:

Læs mere

Patientinformation DBCG 2007- b,t

Patientinformation DBCG 2007- b,t information DBCG 2007- b,t Behandling af brystkræft efter operation De har nu overstået operationen for brystkræft. Selvom hele svulsten er fjernet ved operationen, er der alligevel i nogle tilfælde en

Læs mere

Behandling med Adacolumn ved inflammatorisk tarmsygdom

Behandling med Adacolumn ved inflammatorisk tarmsygdom Behandling med Adacolumn ved inflammatorisk tarmsygdom A gentle revolution in IBD therapy INDHOLD Mave-tarmkanalen...4 Colitis ulcerosa...6 Crohns sygdom...8 Immunforsvaret ved IBD...10 Sådan fungerer

Læs mere

Titel: Donorudvælgelse

Titel: Donorudvælgelse Instruksbog 2.1.1 Område: Emne: Donor Titel: Donorudvælgelse Forfatter: Niels Jacobsen Gitte Olesen Godkendt af: Faste læger i allogen transplantationsgruppe Type/målgruppe: Standardnr.: Udarbejdet: April

Læs mere

Methotrexat. Patientvejledning. Regionshospitalet Silkeborg Diagnostisk Center Reumatologisk Ambulatorium

Methotrexat. Patientvejledning. Regionshospitalet Silkeborg Diagnostisk Center Reumatologisk Ambulatorium Methotrexat Patientvejledning Regionshospitalet Silkeborg Diagnostisk Center Reumatologisk Ambulatorium Methotrexat (MTX) VIRKNING Methotrexat (MTX) dæmper sygdomsaktiviteten ved leddegigt, psoriasisgigt

Læs mere

- Led- og senebehandling nu og i fremtiden

- Led- og senebehandling nu og i fremtiden Stamceller DeL 2 - Led- og senebehandling nu og i fremtiden [ Lise C. Berg 1 og Thomas G. Koch 2 ] 1 Cand. med. vet., ph.d., adjunkt, Institut for Basal Husdyr- og Veterinærvidenskab, KU LIFE 2 Cand. med.

Læs mere

Juvenil Spondylartrit/Enthesitis-relateret artrit (GIGT) (SPA-ERA)

Juvenil Spondylartrit/Enthesitis-relateret artrit (GIGT) (SPA-ERA) www.printo.it/pediatric-rheumatology/dk/intro Juvenil Spondylartrit/Enthesitis-relateret artrit (GIGT) (SPA-ERA) Version af 2016 1. HVAD ER JUVENIL SPONDYLARTRIT/ENTHESITIS-RELATERET ARTRIT (GIGT) (SPA-ERA)?

Læs mere

Spændingshovedpine. Instruks. Formål: Beskrivelse af diagnose, udredning og behandling. Forkortelser: NSAID (non-steroide antiinflammatoriske midler)

Spændingshovedpine. Instruks. Formål: Beskrivelse af diagnose, udredning og behandling. Forkortelser: NSAID (non-steroide antiinflammatoriske midler) Spændingshovedpine Instruks Senest revideret d. 15.03.2016 Forfattere: Shabnam Ezzatian og Lars Bendtsen Referenter: Flemming Bach og Helge Kasch Godkender Lars Bendtsen, redaktionsgruppe F Formål: Beskrivelse

Læs mere

Gigtfeber og post-streptokok reaktiv artritis

Gigtfeber og post-streptokok reaktiv artritis www.printo.it/pediatric-rheumatology/dk/intro Gigtfeber og post-streptokok reaktiv artritis Version af 2016 2. DIAGNOSE OG BEHANDLING 2.1 Hvordan diagnosticeres sygdommen? Der findes ikke nogen specifik

Læs mere

Styrk dit immunforsvar. - med kost og træning

Styrk dit immunforsvar. - med kost og træning Styrk dit immunforsvar - med kost og træning Immunforsvaret Immunforsvarets vigtigste opgave er at beskytte mod infektioner og fremmede stoffer som f.eks.: Bakterier Svampe Parasitter Virus Cancerceller

Læs mere

Reeksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Reeksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering Studienummer: 1 Reeksamen 2016 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 2. semester Eksamensdato:

Læs mere

Autoimmunitet. Umahro Cadogan Sundhedsrevolutionær-uddannelsen

Autoimmunitet. Umahro Cadogan Sundhedsrevolutionær-uddannelsen Autoimmunitet Umahro Cadogan Sundhedsrevolutionær-uddannelsen 1 Hvad er autoimmunitet? Når immunforsvaret (fejlagtigt) angriber kroppen, fordi det tror væv i kroppen er blevet fjenden Auto = selv Immunitet

Læs mere

Analyser/metoder til undersøgelse af immundefekter

Analyser/metoder til undersøgelse af immundefekter Analyser/metoder til undersøgelse af immundefekter Læge J. Magnus Bernth Jensen Klinisk Immunologisk afdeling Hvilke analyser til hvilke patienter??? Hvilke patienter bør undersøges? Infektioner er almindelige

Læs mere

Behandlingsvejledning med dyre lægemidler til behandling af kroniske inflammatoriske tarmsygdomme

Behandlingsvejledning med dyre lægemidler til behandling af kroniske inflammatoriske tarmsygdomme Behandlingsvejledning med dyre lægemidler til behandling af kroniske inflammatoriske tarmsygdomme Fagudvalg under Rådet for Anvendelse af Dyr Sygehusmedicin, RADS, er interne, rådgivende arbejdsgrupper,

Læs mere

Polycytæmia Vera og Sekundær Polycytæmi

Polycytæmia Vera og Sekundær Polycytæmi Polycytæmia Vera og Sekundær Polycytæmi Patientinformation Regionshospitalet Silkeborg Diagnostisk Center Hæmatologisk Ambulatorium Polycytæmia Vera og Sekundær Polycytæmi Polycytæmia betyder mange celler

Læs mere

Caseuge 1.1: Anatomi og fysiologi

Caseuge 1.1: Anatomi og fysiologi Modulplan for modul 1.1, Introduktion til basalfagene, 2017 Vigtigt: Modulplanens læringsmål angiver pensum. I tillæg til læringsmålene for forelæsninger, studiesal, kliniske øvelser og kliniske ophold,

Læs mere

Salazopyrin. Patientvejledning. Regionshospitalet Silkeborg. Diagnostisk Center Reumatologisk Ambulatorium

Salazopyrin. Patientvejledning. Regionshospitalet Silkeborg. Diagnostisk Center Reumatologisk Ambulatorium Salazopyrin Patientvejledning Regionshospitalet Silkeborg Diagnostisk Center Reumatologisk Ambulatorium Salazopyrin Entabs (SAZP) VIRKNING Salazopyrin Entabs (SAZP) anvendes bl.a. til behandling af leddegigt

Læs mere

Ny viden om hvordan depressionsmedicin bindes i hjernens nerveceller

Ny viden om hvordan depressionsmedicin bindes i hjernens nerveceller Ny viden om hvordan depressionsmedicin bindes i hjernens nerveceller Med ny præcision kortlægger Århus-forskere hvordan depressionsmedicin virker. Opdagelserne giver håb om at udvikle forbedret depressionsmedicin

Læs mere

Kroniske smerter og terapeutiske fordele ved medicinsk cannabis

Kroniske smerter og terapeutiske fordele ved medicinsk cannabis Kroniske smerter og terapeutiske fordele ved medicinsk cannabis Link til artiklen: http://www.medicaljane.com/2014/06/13/chronic-pain-and-the-theraputic-benefitsof-medical-cannabis/ Hvad er kroniske smerter?..

Læs mere

Laboratoriemedicin KLINISK BIOKEMI

Laboratoriemedicin KLINISK BIOKEMI N Y H E D S B R E V NYT VEJLE AMT Laboratoriemedicin KLINISK BIOKEMI Nr. 8A August 2004 Revideret marts 2006 Til alle brugere Biokemisk diagnostik og kontrol af thyreoideasygdom Vejle Amts specialister

Læs mere

Pandoras æske eller vejen til forebyggelse af sygdomme?

Pandoras æske eller vejen til forebyggelse af sygdomme? Genetisk hornhindediagnostik: Pandoras æske eller vejen til forebyggelse af sygdomme? Genteknologi et vigtigt værktøj til forebyggelse af hornhindesygdomme? Genetisk diagnostik og dets anvendelsesmuligheder

Læs mere

Hvad er så vigtigt ved målinger?

Hvad er så vigtigt ved målinger? Forskningsnyheder om Huntingtons Sygdom På hverdagssprog Skrevet af forskere. Til det globale HS-fællesskab Spændende opdagelse i blodceller fra patienter med Huntingtons Sygdom Mængden af huntingtinprotein

Læs mere

Multipel Endokrin Neoplasi 1 (MEN1) Patientinformation

Multipel Endokrin Neoplasi 1 (MEN1) Patientinformation Multipel Endokrin Neoplasi 1 (MEN1) Patientinformation MEN1 er en arvelig sygdom, hvor der påvises en eller flere knuder (tumorer) i hormonproducerende kirtler. MEN1 er en sjælden lidelse, som rammer mænd

Læs mere

Signalmekanismer i immunforsvaret. Umahro Cadogan Sundhedsrevolutionær-uddannelsen

Signalmekanismer i immunforsvaret. Umahro Cadogan Sundhedsrevolutionær-uddannelsen Signalmekanismer i immunforsvaret Umahro Cadogan Sundhedsrevolutionær-uddannelsen 1 Nano Faktor kappa Beta Forkortet NFkB Er et intracellulært signal der får celler til at aflæse gener der koder for inflammation

Læs mere

www.printo.it/pediatric-rheumatology/dk/intro

www.printo.it/pediatric-rheumatology/dk/intro www.printo.it/pediatric-rheumatology/dk/intro Behcets Sygdom Version af 2016 2. DIAGNOSE OG BEHANDLING 2.1 Hvordan stilles diagnosen? Diagnosen er primært klinisk. Det kan tage mellem 1 til 5 år før et

Læs mere

STØTTEVÆV. amorf. BINDEVÆV fibrillært kollagent løst. organiseret: elastisk. fedtvæv. cellulært bindevæv: (fx tarmkrøs)

STØTTEVÆV. amorf. BINDEVÆV fibrillært kollagent løst. organiseret: elastisk. fedtvæv. cellulært bindevæv: (fx tarmkrøs) STØTTEVÆV få celler meget grundsubstans spredt beliggende formet (fibriller) amorf bindevæv amorf grundsubstans er blød + fibriller bruskvæv amorf grundsubstans er relativt fast + fibriller benvæv (knoglevæv)

Læs mere

Nedsat blødning. Ingen påviselig effekt på mortalitet. Fibrin concentrate

Nedsat blødning. Ingen påviselig effekt på mortalitet. Fibrin concentrate Fibrin concentrate / Tranexamic Acid / Protrombin complex-concentrate / rfviia When do we use these drugs? What can we do when patients are treated with the new anticoagulant drugs? FFP Frosset/optøet

Læs mere

Behandling af brystkræft efter operation

Behandling af brystkræft efter operation information DBCG 2010-d,t Behandling af brystkræft efter operation Du har nu overstået operationen for brystkræft. Selvom hele svulsten er fjernet ved operationen, er der i nogle tilfælde risiko for, at

Læs mere

Genetiske Aspekter af HCM hos Kat. - en introduktion til forskningsprojektet

Genetiske Aspekter af HCM hos Kat. - en introduktion til forskningsprojektet Genetiske Aspekter af HCM hos Kat - en introduktion til forskningsprojektet Cand. scient. Mia Nyberg, ph.d. stud. mnje@life.ku.dk IMHS, Det Biovidenskabelige Fakultet, Københavns Universitet, Klinisk Biokemisk

Læs mere

Eksamen i. Cellebiologi (kandidatdelen): Cellebiologi - Cellers struktur og funktion - Membranbiokemi - Cellulær signaltransduktion

Eksamen i. Cellebiologi (kandidatdelen): Cellebiologi - Cellers struktur og funktion - Membranbiokemi - Cellulær signaltransduktion Eksamen i Cellebiologi (kandidatdelen): Cellebiologi - Cellers struktur og funktion - Membranbiokemi - Cellulær signaltransduktion Opgavesættet består af 5 sider inklusive denne forside. Sættet består

Læs mere

Interventionel Onkologi Patientinformation

Interventionel Onkologi Patientinformation Interventionel Onkologi Patientinformation Interventionel Radiologi: Dit alternativ til åben kirurgi www.dfir.dk Dansk Forening for Interventionel Radiologi www.cirse.org Cardiovascular and Interventional

Læs mere

Bilag A Ordforklaringer

Bilag A Ordforklaringer Bilag A Aldersstandardisere Justere talmateriale, så kræftudvik- 16, 17, 18 lingen kan sammenlignes uanset forskelle i aldersfordelingen, f.eks. mellem to lande. Allel De to "ens" genkopier i alle celler

Læs mere

Fodertilskud til støtte af en sund ledfunktion hos hunde og katte

Fodertilskud til støtte af en sund ledfunktion hos hunde og katte Fodertilskud til støtte af en sund ledfunktion hos hunde og katte Healthy pets are happy pets Collagen II I et led beklædes knogleoverfladerne af brusk, således at det ikke er knogler, men brusk der glider

Læs mere