Indhold 1. INDLEDNING...4

Størrelse: px
Starte visningen fra side:

Download "Indhold 1. INDLEDNING...4"

Transkript

1 Abstract This thesis has explored the hypothesis that emotional dysregulation may be involved in problems with non response and high dropout rates, which are characteristicofthecurrenttreatmentofposttraumatic,stressdisorder(ptsd). The empirical literature was reviewed and a significant relationship was found betweenhigherlevelsofptsdsymptomsandmoresevereemotionaldysregulation. The way individuals engage with their feelings is related to the severity of PTSD symptomsbeyondtheintensityofnegativeemotions.specifically,peoplewithptsd experience problems with differentiation and understanding of emotions. Furthermore,theyshowanegativeattitudetowardstheexperienceandexpression of certain emotions. This may strengthen the tendency to use avoidance based strategiesandtoengageinimpulsivebehavioursasresponsetotheexperienceof unpleasantfeelings. Treatmentthatinvolvesahighlevelofemotionaldistressmaycausepatientswho experienceemotionaldysregulationtobecomedissociatedandretraumatized,and it may cause the patients to end treatment prematurely. Thus, a high level of emotional dysregulation may be an indicator that the patient is unsuitable for treatments that involve exposure to stimuli or memories associated with the traumaticevent. Theresultsimplyapossiblebenefitofaddinginterventionthatstrengthensabilities in emotion regulation to the treatment of PTSD. At the moment, there is some evidencethattheuseofskilltraininginemotionregulationcanimprovetreatment outcome in exposure therapy. Another possibility is the use of mindfulness based interventions that seem to improve emotion regulation abilities. These interventionsarealreadyusedinthetreatmentandpreventionofptsd,butthere are a number of issues that needs to be addressed before the method can be recommendedforthetreatmentofseverelytraumatizedindividuals. 1

2 Indhold 1.INDLEDNING PROBLEMFORMULERING AFGRÆNSNING SPECIALETSSTRUKTUR PTSD:DIAGNOSEOGTEORI PTSD:DIAGNOSE,PRÆVALENSOGFORLØB DENKOGNITIVEFORSTÅELSEAFVEDVARENDEPTSD BEHANDLINGENAFPTSD EFFEKTUNDERSØGELSERAFPTSDBEHANDLING:SUCCESELLERFIASKO? FAKTORERASSOCIERETTILMANGLENDEEFFEKTOGFRAFALDIPTSDBEHANDLINGEN EVIDENSBASERETPSYKOTERAPIFORPTSD:ERMETODERNEEGNEDEFORALLE PATIENTER? OPSUMMERING EMOTIONSREGULERING SPECIALETSTEORETISKEUDGANGSPUNKT KOGNITIVEMOTIONSTEORI DENEMOTIONELLEPROCES REGULERINGSPROCESSER DIFFICULTIESINEMOTIONREGULATIONSCALE UDVIKLINGSPSYKOLOGISKEPERSPEKTIVERPÅEMOTIONSREGULERING OPSUMMERING LITTERATURGENNEMGANG:EMPIRISKESTUDIERAFEMOTIONEL DYSREGULERINGVEDPTSD STRATEGIOGKRITERIERFORLITTERATURSØGNING KATEGORISERINGAFLITTERATURENIFORHOLDTILSPECIALETSTEORI STUDIEROMEMOTIONSREGULERINGGENERELT EMOTIONELKLARHED EMOTIONELBEVIDSTHED STRATEGIERTILEMOTIONSREGULERING IMPULSKONTROLVEDOPLEVELSENAFNEGATIVEEMOTIONER MÅLRETTETHANDLINGVEDOPLEVELSENAFNEGATIVEEMOTIONER EMOTIONELACCEPT BEGRÆNSNINGERVEDDEHIDTIDIGEEMPIRISKESTUDIER OPSUMMERING DISKUSSION:EMOTIONELDYSREGULERINGOGPTSD EMOTIONELDYSREGULERINGSOMVEDLIGEHOLDENDEMEKANISMEIPTSD SYMPTOMATOLOGI

3 7.2KANEMOTIONELDYSREGULERINGBIDRAGETILFORSTÅELSENAFDEPTSDPATIENTER, SOMIKKEPROFITERERAFBEHANDLINGEN? KAUSALITETISAMMENHÆNGENMELLEMEMOTIONELDYSREGULERINGOGPTSD OPSUMMERING BEHANDLINGAFEMOTIONELDYSREGULERINGVEDPTSD FÆRDIGHEDSTRÆNINGOGEMOTIONSREGULERING MINDFULNESSOGEMOTIONSREGULERING EMOTIONSREGULERINGOGFOREBYGGENDEINTERVENTIONER OPSUMMERING KONKLUSION ANBEFALINGERTILFREMTIDIGFORSKNING LITTERATURLISTE

4 1.Indledning Størstedelenafallemenneskervilpåetellerfleretidspunkteridereslivopleve hændelser,derkanbetegnessompotentielttraumatiske.detdefineressom situationer,dermedføreroplevelsenafintenseemotionelleresponser,såsom frygt,hjælpeløshedogrædsel(americanpsychiatricassociation,2000). Eksempelvisvisteetdanskstudiemedetrepræsentativtudsnitafottendeklasses elever,atudafde390adspurgtehavde78%afdrengeneog87%afpigerne oplevetmindstentraumatiskhændelse(elklit,2002).udenlandske undersøgelser(f.eks.breslau,2009;creamer,burgess&mcfarlane,2001)har blandtvoksnedeltageredokumenterettilsvarendehøjetal. Itidenefterdentraumatiskehændelsevildeflestemennesker,vedpåmindelser omdentraumatiskesituation,opleveforhøjedeemotionelleogfysiologiske responser.forlangtdeflestesvedkommendeaftagerdissereaktionermedtiden, menhosenlillegruppevildeudvikledesigtildekarakteristiskesymptomer genoplevelse,undgåelseoghyperarousal derbetegnessomposttraumatic stressdisorder(ptsd)(americanpsychiatricassociation,2000). LivstidsprævalensenforPTSDidengenerellebefolkning,ivestligelande,anslås tilatvære1 2%(Davidsonetal.,1991;Helzer,Robins&McEvoy,1987). Inoglebefolkningsgrupper,somgenereltudsættesforflereogvoldsommere traumatiskehændelser,sesenmarkanthøjereforekomstafptsd.eteksempel pådette somistigendegraderblevetrelevantiendanskkontekst er soldater,derharværetiudsendtkrig.såledeshardanmarksmilitære engagementiblandtandetdettidligerejugoslavien,afghanistanogirakbetydet, atopimod30.000personer,siden1992,harværetudsendtpåmilitære operationer(lyk Jensen,Jacobsen&Heidemann,2010).Dissemissionerharide senereårændretkarakterfrafredbevarendemissionertilihøjeregradat involveredirektekamphandlinger.iennetopoffentliggjortrapportfraforsvaret undersøgesforekomstenafptsdhosengruppesoldater(n=534),somhar væretudsendttilafghanistan.toethalvtårefterhjemkomstenopfylder9,7%af deltagernekriterierneforptsddiagnosen.desudenudviser17,1%af 4

5 deltagernesymptomerpåetniveau,somerunderdediagnostiskekriterierfor PTSD,mensommåforventesatgiveanledningtilproblemeridereshverdagog sommuligvisnødvendiggørbehandling(veterancenteret,2013).andre eksemplerpågrupper,somudviserhøjforekomstafptsdinkludererflygtninge ogpersoner,somharværetudsatforovergrebellervanrøgtibarndommen (Kessler,2000;Sugayaetal.,2012). PTSDudgørsåledesetikkeubetydeligtsundheds ogtrivselsproblemsåveliden generellebefolkning,somibestemtegrupper,dererisærligrisikofor traumeeksponering. Dererudvikletenrækkepsykoterapeutiskemetoderspecifikttilbehandlingen afptsd.effektundersøgelserviser,atbehandlingenpådenenesidekan betegnessomensucces,idetstørstedelenafpatienterne,selvviarelativtkorte behandlingsforløb,kanopnåenmarkantbedringiderestilstand.pådenanden sideerderenbetydeligandelafpatienterne,somikkeprofitererafbehandling. Noglestudierfindersåledes,atopimod50%afpatienterne,efterendt behandling,fortsatopfyldertilkriterierneforptsddiagnosen(bradleyetal., 2005).Ligeledessesofteproblemermedethøjtfrafaldblandtpatienterne (Schottenbaueretal.,2008). Depatienter,somikkeprofitererfrabehandlingenertypiskde,somerhårdest belastet,hvilketkommertiludtrykiformafsværereptsdsymptomeroghøjere forekomstafkomorbidepsykiskelidelser.deterblevetforeslåetatdisse patientererkarakteriseretvedensærligsårbarhed,somgørdemuegnedetil behandlingmeddehidtidigeempiriskfunderedemetoder(cloitreetal.,2002; vanderkolketal.,2005;zlotnicketal.,1997). PTSDpatienterudvisergenereltmereintenseemotionellereaktioner,hvilket kommertiludtrykpåsåveldetfysiologiske,somdetsubjektiveniveau(litzetal., 2000;Orsilloetal.,2004).Samtidigharderdesenereårværetenstigende anerkendelseaf,atindividetsmådeatforholdesigtil,ogreagerepå,sine emotionerharenbetydning,somrækkerudoverintensitetenafden umiddelbarerespons. 5

6 Begrebetemotionsregulering somudgørensamlebetegnelseforenrække processerogegenskaber,derharbetydningfor,hvordanemotioneroplevesog håndteres harsåledesopnåetstorudbredelseindenforkliniskpsykologi.disse egenskaberharbetydninginormaludviklingen,hvordeblandtandet understøtterprocesserindenforopmærksomhed,problemløsningog interpersoneltsamspil(cole,martin&dennis,2004).vanskelighedermed emotionsregulering,ogsåbetegnetemotioneldysregulering,beskrivessomen transdiagnostiskrisikofaktor,dergenereltdisponererforudviklingenaf psykiskelidelser(berkingetal.,2008).ligeledesindgåremotioneldysregulering somendelafkonceptualiseringenafspecifikkepsykiskelidelsersåsom borderlinepersonlighedsforstyrrelse(fonagy,gergerly&jurist,2003;linehan, 1993),selvskadendeadfærd(Gratz,2007;Klonsky,2007)ogangstlidelser (Cisleretal.,2010). VedPTSDudgørdetintenseemotionelleubehagensærligtudfordringfor regulering.maladaptiveforsøgpåreguleringafemotioneltubehag,somblandt andetundgåelseafsituationer,tankerelleremotioner,samtmisbrugafstoffer elleralkohol,kanværemedtilatudvikleogvedligeholdelidelsen.problemer medatregulereemotionerkandesudenhavevidtrækkendekonsekvenser,som strækkersigudoverdet,derbeskrivesiptsddiagnoseniformafdysregulering iadfærd,interpersonellerelationerogselvoplevelse(vanderkolk,1996). Formåletmeddettespecialeteratundersøge,hvilkeempiriskeindicierderer for,atemotioneldysreguleringbidragertildeproblemersomsesvedptsd. Detteerpåfleremåderrelevantiforholdtilforståelsenaflidelsen.Delskandet bidragetilforståelsenaf,hvorfornoglemenneskereftertraumeeksponeringer meresårbareoverforatudvikleptsdendandre.samtidigkandetgiveen alternativforståelseafptsdsymptomatologien,ogfungeresomenmulig forklaringpå,hvorfornoglepatienterikkeeregnedetilatindgåibehandling meddegenereltanbefaledepsykoterapeutiskemetoder. Endeligkandethaveimplikationerforudviklingenafalternativeinterventioner, somihøjeregradkanhjælpedemestsårbareptsdpatienter. 6

7 2.Problemformulering Formåletmedspecialeteratundersøge,hvilkenbetydningemotionel dysreguleringhariforbindelsemedptsd.jegønskerviaenundersøgelseafden empiriskeforskningpåområdetatdiskutere,hvorvidtemotioneldysregulering udgørenbegrænsning,somkanværemedtilatdifferentieredepatienter,som ikkeprofitererfradegenereltanbefaledebehandlingsmetoderfradenøvrige patientgruppe.desudenviljegdiskutere,hvilkeimplikationerdetteharforptsd behandlingen. Problemformuleringenlydersomfølger: a)indenforhvilkeområderknyttettilemotionsreguleringudviserptsdpatienter anormaliter? b)hvordankanbegrebetemotioneldysreguleringbidragetilatforbedre forståelsenogbehandlingenafdeptsdpatienter,somikkerespondererpåde genereltanbefaledebehandlingsmetoder 2.1Afgrænsning Specialettagerudgangspunktikognitivteoretiskforståelseaf emotionsregulering. Isærteorierfradetdererblevetbetegnetsomdentredjebølgeindenforkognitiv adfærdsterapiharinspirerettilspecialetstilgang.herfremhævesemotioners generellefunktionellebetydningidenmenneskeligetilværelse.teorierne fokusererpå,hvordanindividerforholdersigtiltanker,følelserogandreprivate oplevelsersnarereendpåkarakterenafdisseoplevelser.såledesbeskrives processersomacceptogoplevelsesorienteretundgåelsesomvigtigeelementeri denpsykiskefunktion. DisseteorierliggertilgrundforasessmentværktøjetDifficultiesinEmotion RegulationScale(DERS)(Gratz&Roemer,2004),somidageretafdehyppigst 7

8 anvendtemålforemotionsregulering,ogsomispecialetfungerersomen overordnetrammeforundersøgelsen. Samtidighardetværetnødvendigtatfravælgeandreteoretisketilgange.Der eksistererenomfattendepsykodynamisklitteratur,sombeskæftigersigmed affektregulering(f.eks.fonagy,gergerly&jurist,2003;schore,1994).begrebet harvisseoverlapmeddet,deranvendesidettespecialet,menfokusererihøjere gradpåbetydningenaftilknytningsprocessersamtbegrebetmentalisering. Dennetraditionvilispecialetkunbliveberørtkortfattetiafsnittetomden udviklingspsykologiskeforståelseafemotionsregulering. Ligeledeseksistererderenmængdeforskningvedrørendedetneuralegrundlag forsåvelemotionsreguleringsomptsd.uansetrelevansenafdenneforskninger derispecialetikkeblevetpladstilatinkluderedennetilgang. Ispecialetanvendesprimærtdentekniskebetegnelse emotion,mensdetmere almeneord følelse indimellembenyttessynonymt.enkeltestederrefereres derdesudentil affekt,sombetegnerenmereoverordnetkategori,hvor oplevelsensskelnesiforholdtilomdenerkarakteriseretvedubehagog velbehag. 2.2Specialetsstruktur Foratbesvaredestilledespørgsmål,følgerspecialetfølgendestruktur: Ikapitel3præsenteresdediagnostiskekriterierforPTSDsamtenkognitiv teoretiskforståelseaf,hvorforsymptomernefornoglemenneskerfåren vedblivendekarakter. Herefterfølger,ikapitel4,enredegørelseforstudiervedrørendebehandlingaf PTSD.Detundersøges,omdererbestemtefaktorer,somkandifferentiere mellemdepatienter,somprofitererafbehandlingen,ogdesomikkegør. Detundersøgesligeledes,omderernoglefællestrækveddegenereltanbefalede terapeutiskemetoder,somkangøredemuegnedetilbehandlingafvisse 8

9 patienter.somenmuligforklaringpåhvorfornoglepatienterikkeprofitereraf behandlingenforeslåsdet,atderesproblemerinkludereremotionel dysregulering. Somgrundlagfordenvidereundersøgelsebehandlerkapitel5begrebet emotionsregulering.derredegøresfordenteoretiskeforståelseafsåvelde emotionellesomderegulerendekomponenter.ligeledespræsenteresbegrebets anvendelseindenforhenholdsviskliniskogudviklingspsykologi. Kapitel6udgørenlitteraturgennemgangafdeempiriskestudiervedrørende sammenhængenmellemptsdogemotionsregulering.detundersøges,omderer specifikkeegenskaberknyttettilemotionsregulering,somisærliggrader associerettilptsd.ligeledesundersøgesdet,omdesværestbelastedeptsd patienter,isærliggrad,udvisertegnpåemotioneldysregulering,ogtilsidst drøftesbegrænsningerveddenhidtidigeforskningpåområdet. Disseresultaterdannergrundlagforkapitel7,hvordetdiskuteres,hvilken betydningemotioneldysreguleringspillervedptsd.derargumenteresforat anvendelseafbegrebetemotioneldysreguleringgivermulighedforenudvidet konceptualiseringafdeproblemer,somoplevesvedptsd.detkanfungeresom enforklaringpå,hvorfornoglepatienterikkeeregnedetilbehandlingmedde hidtidigtanbefaledemetoder.ligeledesdrøfteskausalitetenirelationenmellem PTSDogemotioneldysregulering. Resultaterneharsåledesenrækkekliniskeimplikationer,somdiskuteresi kapitel8.herforeslåsenrækkeinterventioner,somspecifiktkanstyrkeevnen tilemotionsregulering,ogsomderforervelegnedetilbehandlingenafde sværestbelastedepatienter. Ikapitel9rundesspecialetafmedenopsamlendekonklusion,samten perspektiveringmedforslagtilfremtidigeforskningpåområdet. 9

10 3.PTSD:diagnoseogteori IdettekapitelviljeggennemgådediagnostiskekriterierforPTSDogredegøre forlidelsensprævalens,typiskeforløbogfordenhøjeforekomstafkomorbide lidelser.herefterpræsentererjegenkognitivmodelforvedvarendeptsd,som gennemspecialetvilindgåidiskussionen. 3.1PTSD:diagnose,prævalensogforløb ForatfåstilletPTSDdiagnosenmåenpersonhaveoplevetentraumatisk begivenhedsamtudvisesymptomerindenforhverafdetrekategorier: genoplevelse,undgåelse/emotionelfølelsesløshedoghyperarousal.tilstandenmå havevaretlængereendenmånedogmådesudenmedføreenklinisksignifikant gradaflidelseellerbegrænsningipersonensfunktionsniveau(american PsychiatricAssociation,2000).Figur1.pånæstesideviserkriterierneforPTSDi detamerikanskediagnosesystemdsm IV,somanvendesispecialet. EtvigtigtaspektvedPTSDer,atdetkunerenmegetbegrænsetandelafde,som udsættesfortraumatiskehændelser,derrentfaktiskudviklerlidelsen.som nævntiindledningenvilstørstedelenafallemenneskerførellersenereideres livopleveepisoder,derifølgediagnoselistenkvalificerersomtraumatiske. Mangemenneskersomudsættesforentraumatiskhændelseviliperioden, umiddelbartefter,oplevenogleafdetypiskeptsdsymptomer,menforlangtde flestesvedkommendevilsymptomerneaftageafsigselv.risikoenforatudvikle PTSDsomfølgeaftraumer,densåkaldtebetingendesandsynlighed,variereralt afhængigaftraumetypenmenanslåsformændatværeomkring5%,mens risikoenforkvindereromkringdobbeltsåstor(breslau,2009;davidsonetal., 2004).IinternationaleundersøgelserfastslåslivstidsprævalensenforPTSD såledestilatvære1 2%(Davidsonetal.,1991;Helzer,Robins&McEvoy,1987). Dererblevetidentificeretenrækkefaktorer,somdisponererforudviklingenaf PTSDeftertraumeeksponering.Risikofaktorer,somliggerforudfortraumet, 10

11 DSM IV TRdiagnostiskekriterierforPTSD Figur1.DiagnostiskekriterierforPTSDiDSM IV TR(AmericanPsychiatric Association(2000),danskoversættelse:Lundetal.(2008). 11

12 inkluderertidligereudsættelsefortraume,omsorgssvigtibarndommensamt forekomstafpsykiskelidelserifamilien. Destærkesteindikatorerhardogvistsigatværefaktorer,somharbetydning underogitidenefterdentraumatiskehændelse.deinkluderertraumets sværhedsgrad,mangelpåsocialstøtteoggenereltbelastedelivsomstændigheder (Brewin,Andrews&Valentine,2000). EtandetmarkantaspektvedPTSDerdenmegethøjeforekomstafkomorbide lidelser.ietamerikanskstudiemedetrepræsentativtudsnitafdengenerelle befolkninghavde84%afde,somopfyldtekriterierneforptsd,ligeledesmindst énandenpsykiatriskdiagnose,og59%afdeltagerneopfyldtekriteriernefor flereend3diagnoser.dehyppigstforekommendekomorbidediagnoservar depressionsamtalkohol ogstofmisbrug(kessleretal.,1995).komorbiditeter vedptsdsåledesiudprægetgradreglensnarereendundtagelsen. DeemotionelleprocesservedPTSD,somerafsærliginteressefordettespeciale, udgørgenereltetunderbelystaspektaflidelsen(litzetal.,1997).derersåledes uenighedomderesårsagogbetydningforlidelsensætiologi.idsm IVrubriceres PTSDunderangstlidelserne,hvilketviserdencentraleplacering,somangst indtagerisymptombilledet.deterdogvigtigtatbemærke,atpersonermed PTSDogsåopleverenrækkeandreintensenegativefølelsersåsomtristhed, vrede,skyldogskam,derbidragertillidelsen. Angstenkommerisærtiludtryk,nårpersonenudsættesforydreellerindre stimuli,dererassocierettilellerlignernogetfradentraumatiskebegivenhed (AmericanPsychiatricAssociation,2000).SamtidigerdervedPTSDenstærkt forøgetreaktivitet,hvorpersonengenereltreagerervoldsomtpåstimuli.det kommertiludtrykpåetfysiologiskeniveauiformafhyperarousal,dererblevet dokumenteretviamålingerafblandtandethjerterytme,blodtryk,galvanisk hudresponsogfacialelectromyography.ienmetaanalyseafdehidtidigestudier fandtpole(2007),atptsderassocieretmed:(a)generelforhøjetarousali hviletilstand,(b)øgetresponsvedpludseligelyde,(c)øgetresponsved standardiseredetraumerelateredesignaler,(d)øgetresponsved idiosynkratisketraumerelateredesignaler,somtypiskmåles,menspersonen genkaldersigdenoplevedetraumatiskehændelse.hyperarousalersåledesikke 12

13 kunrelaterettilpåmindelseomdentraumatiskehændelse,mensesogsåsomen generelreaktionpåintense,mendybestsetneutrale,stimuli(vanderkolk, 1996). PersonermedPTSDudviserdesudennedsatteevnertilatoplevedetfulde spektrumafemotioner(emotionelfølelsesløshed).detbeskrivesidsm IV,som resultatetafvedvarendeforsøgpåathåndteredetubehag,somerforbundet medgenoplevelsesogarousalsymptomernegennembrugaf undgåelsesbaseredestrategier.iadfærdenafspejlesdetvedundgåelseafalt,der minderomtraumet,mensdetpåetpsykiskplanafspejlesvedforsøgpåat undertrykkeerindringer,emotionerogtanker.vedvarendeforsøgpåemotionel undgåelsemedfører,atpersonenkommertilatleveientilstandafglædesløshed, somkunindimellemafbrydesafoverdrevnereaktionerpåtraumatiske påmindelser(vanderkolk,1996). 3.2DenkognitiveforståelseafvedvarendePTSD Kognitivadfærdsterapihar,somviskalseinæstekapitel,endominerenderollei forholdtilbehandlingenafptsd.deterderforrelevantatforståhvilken forståelseafptsd,derliggerbagteorien. ModernekognitiveadfærdsterapeutisketilgangetilPTSDerkarakteriseretved atkombinereelementerfradentidligeindlæringspsykologimedsenere kognitiveteorier. Iindlæringsteorienforklaresangstsymptomerne,påsammemådesomved andreangstlidelser,somresultatafklassiskebetingning.dentraumatiske situationudgørenubetingetstimulus,somhosofferetudløserenubetinget responsiformafangstogfrygt.forskelligeneutralestimuli,dervartilstedei situationen(betingedestimuli)bliverligeledesassocieretmeddennereaktionog vilderfor,nårpersonenseneremøderdem,udløseangst(betingetrespons).når personenopleverangst,vilhanværetilbøjeligtilatflygtefrasituationen,hvilket bringerangstentilophør.hervedhindresudslukningafdebetingederesponser, ogderskerennegativforstærkningafflugtogundgåelsesadfærd,somkommer 13

14 tilatindtageenmeredominerendeplaceringiadfærdsrepertoiret.opfattelsenaf atundgåelsehindrerbearbejdningafdentraumatiskeoplevelseogderveder medtilatvedligeholdesymptomerneudgørfortsathjørnestenenimoderne eksponeringsterapi(f.eks.resick&schnicke,1996). Nyerekognitiveteorierfremhæverbetydningenafinformationsbearbejdningog beskriver,hvordanptsdadskillersigfradeøvrigeangstlidelser.detinvolverer blandtandetatptsdinkludereandreintense,negativeemotionerendangst. IfølgeFoaogKozak(1986)udviklesdersomfølgeaftraumetenfrygtstrukturi hukommelsen.frygtstrukturenbeståraf:(1)informationomdefrygtedestimuli (f.eks.stedetogdeinvolveredepersoner),(2)informationomfysiskeog adfærdsmæssigereaktioner(f.eks.hjertebanken,flugt),samt(3)informationom defrygtedestimuliogreaktionernesmening(f.eks. Dentypestedererfarlige eller Hjertebankenerensbetydendemed,atjegerbange ).Imødemednoget derminderomdentraumatiskehændelse,aktiveresfrygtstrukturen,ogudløser fysiologiskarousal(f.eks.øgetblodtrykoghjerterytme),genkaldesaf frygtrelateredeerindringer(f.eks.påtrængendeerindringerellerflashbacks), intensefølelseraffrygtogangst,ogadfærdsresponser(f.eks.undgåelse,flugt ellervagtsomhed).deterblevetforeslået,atfrygtstrukturernevedptsd konstanterlettereaktiveret,hvilketfarverfortolkningenafflertydige situationer,deroplevessompotentieltfarlig(chemtobetal.,1988). IfølgeEhlersogClarks(2000)hyppigtciteredeteoriudviklesvedvarendePTSD, hvispersonenharbearbejdetdentraumatiskehændelseogdetefterfølgende forløbpåenmåde,somresultererienfortsatoplevelseafatværeifare.negative tolkningeraftraumetkanresultereibasaleantagelsersom: Verdener gennemgåendeetfarligtsted,eller Detkommerheltsikkertilatskeigen.De kognitivevurderingererherprægetafekstremovergeneraliseringafrisikoen foratbliveudsatforhændelserligden,derforårsagedetraumet.truslenkan ligeledesværerettemodnogetindremedtankersom Jegburdehaveforhindret det,eller Jegerikkeistandtilathåndterenoget.Ofteerderhertaleom urealistiskeopfattelseraf,hvilkenbetydningpersonenselvspilledeiden traumatiskesituation,hvoradfærdsmæssigeogfysiologiskereaktionertolkes somudtrykforpersonliginkompetence. 14

15 Ligeledeskanderværenegativefortolkningerafomverdenensreaktionpå hændelsen( Dereringen,somkanlidemiglængere )elleraftraumets konsekvenser( Jegerbliveraldrigraskigen eller FordijegharPTSD,erjeg ikkelængereistandtilatarbejde ).Dissenegativetolkningerkanresulterei tilbagetrækningfraaktiviteterogsocialerelationer,ogdekansåledeskommetil atfungeresomenformforselvopfyldendeprofetier. Somnævnttidligerevillangtdeflestemennesker,derudsættesforen traumatiskhændelse,kommesigudenatudvikleptsd.detskyldes,ifølge kognitiveteorier,atderesurealistiskeantagelseriperiodeneftertraumetbliver modificeretgennemgentagenbearbejdningafdentraumatiskeerindring.det skervedatopleveogværeikontaktmedtraumerelateredetankerogemotioner, vedattaleomoplevelsenmedandremenneskersamtvedeksponeringfor påmindelseromtraumet.hervedafkræftesogkorrigeresurealistiskeantagelser (Riggs,Cahil&Foa,2008).Vedmanglendeaktiveringafdentraumatiskerindring hindresmodificeringafdeurealistiskeognegativevurderinger.hvispersonen foreksempelundgårallestederogsituationer,somerassocierettiltraumet, begrænsesmulighedenforatfåafkræftetantagelsenomdefrygtede konsekvenser.derforbeskrivesundgåelse,ogsåidekognitiveteorier,somden primærevedligeholdendemekanismeiptsd.empiriskestudierharbekræftet, atgradenafnegativekognitivevurderingerafénselvogverdenudgørengod indikatorfor,hvorvidtderudviklesvedvarendeptsdeftertraumeeksponering (Ehring,Ehlers&Glucksman,2008;Lancaster,Rodrieguez&Weston,2011). Etandetelement,somgårigenikognitiveteorieromPTSD,vedrørerdenmåde, dentraumatiskeerindringerindkodetihukommelsen.detantages,atden traumatiskeerindringvedptsderkarakteriseretvedatværedårligtudfoldetog utilstrækkeligtintegreretmedandreforudgåendeogefterfølgende autobiografiskeerindringer.detteforårsagerpådenenside,atdentraumatiske erindringkuniringegradertilgængeligforintentionelgenkaldelse,mensdenpå denandensideisinpåtrængendeformoplevessomvirkeligheden,derudspiller signuogher(ehlers&clark,2000).debetingedeassociationermellemstimuli ogresponsharfordettraumerelateredematerialeensærligstyrke,ogdekan derforlettereaktiveres.genoplevelseafdentraumatiskehændelsekansåledes udløsesafenlangrækkestimuliogsituationer,somofteikkeharentydelig 15

16 semantiskrelationtildentraumatiskehændelse.dissekaninkludereydre signalersomeksempelvislugte,lyde,mønstreilysindfaldet,menogsåindefra kommendesignalersomemotionelletilstande,bestemtekropsligepositurer ellerbevægelser,somerligdem,dervartilstedefør,underellerefterden traumatiskehændelse. DenkognitivetilgangtilPTSDudgørispecialetengrundlæggendeforståelsefor deprocesser,somermedtilatudvikleogvedligeholdesymptomerne.denvil såledesløbendeindgåiundersøgelsenogdiskussionen. 3.3Opsummering PTSDdiagnosenberorpåsymptomerindenfordetrekategoriergenoplevelse, undgåelse/emotionelfølelsesløshedoghyperarousal.eftertraumeeksponering vilmangemenneskeroplevenogleafdissesymptomer,mensdetkuneretmeget begrænsetudsnit,somviludviklevedvarendeptsd. PTSDmedførerengenereltøgetintensitetiemotionelleresponserblandtandet iformafangst,vrede,skyldogtristhed.samtidigmedførerlidelsenennedsat evnetilatoplevedetfuldespektrumafemotioner. KognitivadfærdsterapieridagdominerendeiPTSDbehandlingen.Ikognitive teorieropfattesvedvarendeptsdsymptomer,somresultatafpersonens urealistiske,negativeantagelserafsigselvogverden.detresultererien kontinuerligoplevelseafatværeunderlagtalvorligfare.undgåelseafindreog ydrestimulihindrermodificeringafdisseantagelserogudgørderforden primærevedligeholdendefaktorilidelsen. NæstekapitelomhandlerbehandlingenafPTSDogdeproblemer,somerknyttet hertiliformafmanglendebehandlingsresponsoghøjefrafaldsrater. 16

17 4.BehandlingenafPTSD IdennedelafspecialetviljegredegøreforeffektenafPTSDbehandlingenog undersøge,hvilkefaktorer,knyttettilhenholdsvispatienten,traumetog behandlingsmetoden,somharbetydningforbehandlingsudfaldet. Herefterviljegdiskutere,hvorforsåstorenandelafpatienternetilsyneladende ikkeeregnedetilatindgåibehandlingmeddemetoder,somgenereltanbefalesi litteraturen.tilsidstviljegargumenterefor,atemotioneldysreguleringudgør enfaktor,somharbetydningforudfaldetvedbehandlingafptsd. 4.1EffektundersøgelserafPTSDbehandling:Succesellerfiasko? DeflestereviewsafpsykoterapeutiskbehandlingvedPTSD(f.eks.Bison,2009; Ponniah&Hollon,2009)konkludererattraumespecifikkeinterventioneriform afkognitivadfærdsterapi,eksponeringsterapisamteyemovement DesensitizationandReprocessing(EMDR)hardenbedstdokumenteredeeffekt, ogatderdesudenikkeerforskelpåeffektenafdissemetoder.andre(benishet al.,2007)harkritiseretdennekonklusionogfinderideresmetaanalyseikke tilstrækkeligtbelægfor,atkognitivadfærdsterapi,eksponeringsterapieller EMDRfungerermereeffektivtendandremetoder,såsompsykodynamiskterapi, hypnoterapiellerstøttendeterapi. Påsammemådeerderuenighedomkring,hvoreffektivbehandlingenafPTSD egentliger.bradleyogkolleger(2005)fandtideresmetaanalyseaf26 behandlingsstudier,at56%afde,derpåbegyndtebehandlingen,og67%afde, dergennemførteden,efterfølgendeikkelængereopfyldtekriterierneforptsd diagnosen.forfatternetolkerdetsomensucces,atensåstorandelaf patienternekanopnåmarkantbedringgennemrelativtkortvarige behandlingsforløb.samtidigpåpegerde,atdererennegativrelationmellem antallet,dergennemførerbehandlingen,ogbehandlingseffekten,måltsom forskellenisymptomniveauførogefterbehandlingen.detvilsige,atjofærre deltageredergennemførerbehandlingen,jostørreserbehandlingseffektenudtil 17

18 atvære.detbetydermuligvis,atdepatienter,somikkeumiddelbartfårdet bedre,harentendenstilatfrafaldebehandlingen. Schottenbauerogkolleger(2008)sætterideresreviewspørgsmålstegnved, hvorvidtbehandlingenafptsderudtrykforensucces,idetstudierneviser megetstorevariationeribehandlingseffekten.deresgennemgangsommed bredereselektionskriterierinkluderer55behandlingsstudierafkognitiv adfærdsterapiogemdrdemonstrer,atheltoptil50%afdeltagerneikke respondererpåbehandlingen,ogatfrafaldsraternesvingermellem0og54%. Detfårforfatternetilatkonkludere,atdenuværendeempiriskunderbyggede metoderikkeeregnedetilbehandlingafalleptsdpatienter. Altafhængigtafhvordanmanserpådet,kanbehandlingenafPTSDbetegnes somentenensuccesellerenfiasko.pådenenesideerman,medenrække traumespecifikkeinterventioner,istandtilselvvedrelativkorte behandlingsforløbatopnåenmarkantsymptombedringforstørstedelenaf patienterne.pådenandensideerderenstorpatientgruppe,somikke umiddelbartprofitererafbehandlingen.daptsddiagnosendækkeroveren megetheterogenpatientgruppe,derblandtandetvariereriforholdtil traumehistorikogkomorbidepsykiatriskelidelser,erdetikkeoverraskende,at dererstoreforskellei,hvordanbehandlingenvirkerfordenenkelte.detvil væreafstorbetydningatkunnedifferentieremellempatienter,dereregnedetil traumespecifikkebehandlingsformer,ogdesomikkeer.foratkunnegøredeter detværdatundersøge,hvorvidtdererfaktorer,somspecifiktkanassocierestil depatienter,somentenfrafalderbehandlingen,ellersomikkeprofitererheraf. 4.2FaktorerassocierettilmanglendeeffektogfrafaldiPTSD behandlingen Enrækkeforskelligefaktorererblevetforeslåetsomforklaringpå,hvorfornogle patienterafbryderellerikkeprofitererafbehandlingen.undersøgelserne,som gengivesherbeskæftigersigmeddetraumespecifikketerapeutiskemetoder, somgenereltanbefalesilitteraturentilbehandlingafptsd. Detmestkonsistentefunder,atsværhedsgradenafPTSDsymptomer,måltved struktureredekliniskeinterviewsførbehandling,hængersammenmed 18

19 behandlingenseffekt,såledesatdepatienter,meddesværestesymptomer,har dårligereeffektafbehandlingen(vanemmeriketal.,2011;karatziasetal., 2007;vanMinnenetal.,2002;vanMinnen&Hagenaars,2002). Forekomstenafkomorbidepsykiskelidelserharinoglestudierligeledesvistsig athavebetydningforbehandlingseffekten.patientermedptsdogborderline ellerandrepersonlighedsforstyrrelserharsåledesmindresandsynlighedforat opnåetgodtfunktionsniveauefterbehandlingen,mendetskyldesmuligvis,atde havdeethøjereptsdsymptomniveautilatbegyndemed(feenyetal.,2002; Hembreetal.,2004).Forbesogkolleger(2003)fandt,atforekomstenaf depressionvarassocierettilsignifikantringerebehandlingseffektuafhængigtaf sværhedsgradenafptsdsymptomerindenbehandlingen.andrestudierharikke fundeteneffektafhverkenkomorbiddepressionellerangstlidelse(ehlersetal., 2005;Rizvietal.,2008;vanMinnenetal.,2002).Flerestudierindikereratbrug afbenzodiazepin(vanminnenetal.,2002)ogalkoholmisbrug(perconte& Griger,1991;Forbesetal.,2003)erassocierettildårligerebehandlingseffekt. Studier,somharundersøgtbetydningenafpersonfaktorer,finderingen sammenhængmellempersonlighedstrækogbehandlingenseffekt(vanemriket al.,2011;vanminnenetal.,2002).endeligerderikkefundetnogenklar sammenhængmellemtypenaftraumeogbehandlingseffekt.hvorhembreog kolleger(2004)fandt,atisærbarndomstraumervarassocierettilvedvarende PTSDsymptomerefterbehandling,harflereandrestudierikkekunnetbekræfte betydningenaftraumetstidspunkt(ehlersetal.,2005;taylor2003;vanminnen etal.,2002).idetbestemtetyperaftraumer,foreksempellængevarende traumeroginterpersonelletraumertidligtilivet,erassocieretmedsværere PTSDsymptomer,vildesamtidigværeforbundettilendårligere behandlingseffekt. Iforholdtilfrafaldfrabehandlingentegnerdersigetlignendemønster,hvor sværeresymptomergenerelterassocierettilenhøjerefrafaldsrate(zayfertet al.,2005).specifiktersymptomernehyperarousal(zayfertetal.,2005),højt angstniveau(vanminnen&hagenaars,2002)ogundgåelsesadfærd(bradetal., 2001;Bryantetal.,2007;Zayfertetal.,2005),samtenkognitivstil 19

20 karakteriseretvedkatastrofeprægedetolkningerogtanker(bryantetal.,2007) associerettilhøjerefrafaldsrate. Forekomstenafdepressionkunneietstudie(Zayfertetal.,2005)forudsige,om patientenvillegennemførebehandlingen,mensvanminnenogkolleger(van Minnenetal.,2002)ideresstudieikkefandtdennesammenhæng.Borderline personlighedsforstyrrelseerietenkeltstudie(zayfertetal.,2005)blevet associerettilhøjerefrafaldsrate.endeligermisbrugafalkohol(difedeetal., 2007;vanMinnenetal.,2002)ogbenzodiazepin(vanMinnenetal.,2002) associerettilhøjerefrafaldsrate.afundersøgtepersonfaktorererlaverealder (Rizvietal.,2008),dårligesocialekompetencer(Zayfertetal.,2005),lavIQ (Rizvietal.,2008)oglavtuddannelsesniveau(Bradyetal.,2001;Rizvietal., 2008)associerettilhøjerefrafaldsrate. Somdetfremgår,erderenrækkefaktorer,somkanknyttestil behandlingseffektenogfrafaldsratenvedptsd.demestkonsistentefunder,at højeresymptomniveauerknyttettilbådehøjerefrafaldsrateogdårligere behandlingsudfald.detsammeserudtilatværetilfældetformisbrugafalkohol ellerbenzodiazepin.etsymptombilledeprægetafhøjtniveauafhyperarousal, angstellerundgåelseharmuligvisensærlignegativbetydningiforholdtil frafaldsraten.komorbidelidelsersompersonlighedsforstyrrelseogdepression kanformentligforværrebehandlingsudfaldet,menresultaterneerikkeentydige. Medhensyntilpersonlighedstræk,kognitiveevnersocioøkonomiskeforhold, samtkarakterenaftraumeterresultaternemereusikre. Viersåledesiensituation,hvorenbetydeligandelafde,sombehandlesfor PTSD,ikkehargavnafdebehandlingsformer,somumiddelbarthardenbedst dokumenteredeeffekt.somviharsetdrejerdetsigomdedårligstfungerende patienter,hvilketkommertiludtrykvedethøjeresymptomniveau,tendensertil misbrugogenmuligforekomstafandrepsykiatriskelidelser. Iforlængelseheraferdetværdatoverveje,omdererbestemteelementeride genereltanbefaledebehandlingsmetoder,somisærliggradgørdetsværtfor dennedelafpatientgruppenatindgåiogprofiterefrabehandlingen. 20

21 4.3EvidensbaseretpsykoterapiforPTSD:Ermetoderneegnede forallepatienter? Sombeskrevetovenforerderilitteraturen,ihvertfaldtilnærmelsesvis,enighed om,attraumefokuseredeterapiformerhardenbedstdokumenterede behandlingseffekt.disseopdelesofteitooverordnedegrupperinger:kognitiv adfærdsterapiogeyemovementdesensitizationandreprocessing(emdr). Yderligerekankognitivadfærdsterapeutisketerapierinddelesefter,hvorvidtde primærtfokusererpåeksponeringellerpåkognitivomstrukturering.fællesfor metoderneer,atdeinkludererpsykoedukationsamtteknikkertil angsthåndteringsåsomåndedrætsøvelser. Irealitetenhardeflesteeffektstudierdrejetsigombehandlingsformer,som inkludererelementerafeksponeringsterapi.idenkognitivegruppedrejerdet sigprimærtomprolongedexposure(pe)(foa&rothbaum,1998)ogcognitive ProcessingTherapy(CPT)(Resick&Schnicke,1996).VedPEindgårsåvel forestilletsominvivoeksponering,menscptinkludererforestilleteksponering iformafskriveopgaver.vedemdr(shapiro,1989)indgårpatientenligeledesi forestilleteksponering,samtidigmedathanguidestilatudføresaccadiske øjenbevægelserellerfokuserepåandenudefrakommendestimuli(shapiro, 1994).Derersåettvivlom,hvilkemekanismerderliggerbag behandlingseffektenvedemdr.såledeskonkludererenmetaanalysepå området,atderikkeerbelægfor,atdesamtidigeøjenbevægelsermedføreren bedrebehandlingseffektendeksponeringsprocedurenalene(davidson&parker, 2001). Deterapiformer,somhardenbedstdokumenteredeeffekt,harpåtrodsafderes individuelleforskellealtsåbrugenafeksponering,idenellerdenandenform,til fælles.dererblevetudtryktbekymringfor,ateksponeringsterapi,ikraftafden emotionelleintensitetsomøvelserneindebærer,ikkeeregnetfordemest sårbarepatienter,idetdeiværstefaldvilkunnemedføreretraumatisering, dissociationogresultereifrafaldfrabehandlingen(cloitreetal.,2002;pitmanet al.,1991;scott&stradling,1997;tarrieretal.,1999). 21

22 Generelterdetenmangelvedeffektstudierne,atdeikkerapportererom, hvorvidtderiptsdbehandlingenforekommersymptomforværring(bisson, 2007).Detvidesderforikke,omdeteretreeltproblem,derkanknyttestil eksponeringsterapi. Etinterviewstudiemed65deltagereharundersøgtårsagentil,atpatienter frafaldervedeksponeringsterapi.sombegrundelseangav6%,atdehavdefået detbedreefterassessmentogikkelængerebehøvedebehandling.11%angav, atdeblevsuicidaleelleroplevededissociativetilstande,12%atdevarien andenbehandling,27%havdelogistiskeproblemer,17%nægtedeatdeltagei forestilleteksponeringog26%angavikkenogenbegrundelse(zayfert&black, 2000).Fornogleafdissepatienterserdetudtil,atbehandlingenharværetfor voldsomtil,atdekunneprofitereafden. Deterblevetforeslået,atbehandlingenafdehårdestbelastedepatientermed PTSDvanskeliggøresaf,atdeopleverforhøjetemotionelreaktiviteti kombinationmeddårligeevnertilemotionsregulering(cloitreetal.,2002;van derkolk,1996;zlotnicketal.,1997).somviskalseinæstekapitel,involverer emotioneldysreguleringvanskelighedermedatforstå,opleveogudtrykke følelser,samttendenstilathåndterefølelserviaproblematiskestrategier. Patientermedenstorgradafemotioneldysreguleringopleveremotionersom overvældendeogukontrollerbare.devilderforhavesværerevedattolerere angstogandrenegativeemotioner,someksponeringfortraumerelateretstimuli indebærer.iterapienhardeenlavtærskelforatblivedissocieretogøgetrisiko forsymptomforværring,ligesomdeogsåvilværetilbøjeligetilatanvende problematiskestrategiertilathåndtereemotioneltubehag.idettetilfældekan detblandtandetinvolvere,atbehandlingenafbrydes,elleretstigendebrugaf alkohologstoffertilatbegrænsedetubehagdeoplever.itillægtilethøjtangst niveaukanvredesudbrud,irritationogiperioderdepressivefølelserkomplicere behandlingen(zlotnicketal.,1997). Emotioneldysreguleringudgørsåledesenmuligmekanisme,derkanværemed tilatskelnedepatienter,somharglædeaftraumefokuserede behandlingsformer,fradesomikkehar.detkandesudenhavebetydningfor anvendelsenafalternativertildenuværendebehandlingsformeriformaf interventioner,somforbedrerpatientensevnertilatregulereemotioner.detser 22

23 udtilateksponering,idetilfældehvorpatienteneristandtilsuccesfuldtat indgåimetoden,udgørensærligeffektivbehandlingafptsd.deterderfor ønskværdigtatgøreflerepatienteristandtilatindgåibehandlingsformer,som involverereksponering.atforbedrepatientensevnertilemotionsreguleringkan muligvisbidragehertil. 4.4Opsummering BehandlingenafPTSDerpådenenesidekarakteriseretved,atmanselvved relativtkortebehandlingsforløberistandtilathjælpeenstordelafpatienterne. Pådenandensideopfylderopimodhalvdelenafpatienterne,efterendt behandling,fortsatkriterierneforptsd,ligesomderogsåerbetydelige problemermedhøjefrafaldsrater.depatienter,somikkeprofitererfra behandlingen,kanikraftafsværereptsdsymptomer,højereforekomstaf komorbidelidelseroglaveresocioøkonomiskstatuskarakteriseressomde sværestbelastede. Deterapeutiskemetoder,somgenereltanbefalesilitteraturenomPTSD behandling,har,omendiforskelligtomfang,brugenafeksponeringtilfælles. Dererblevetforeslået,atdesværestbelastedepatientererkendetegnetvedet højtniveauafemotioneldysregulering,somgør,atdeikkeeristandtilat tolereredetemotionelleubehag,somerknyttettileksponeringsterapi. Ispecialetviljegundersøgedetteoretiskeogempiriskegrundlagfordenne hypotese.inæstekapitelfølgerderforenredegørelseforbegrebet emotionsregulering,somdannergrundlagfordenvidereanalyseogdiskussion. 23

24 5.Emotionsregulering Begrebetemotionsreguleringhardesenereårværetgenstandforenstigende anvendelseindenforflereforskelligegreneafdenpsykologiskevidenskab(gross &Thompson,2007).Oprindeligterbegrebetknyttettiludviklingspsykologien, hvorinteressenhardrejetsigomdekomplekseprocesser,hvorvedemotionerer relateredetilkognition,adfærdogisidsteendetilindividetsudviklingsprocesser (Cole,Martin&Dennis,2004).Idaganvendesemotionsreguleringistigende gradsomensamlebetegnelseforenrækkeegenskaber,derercentralefor individetsfunktion,ogsomhvisdeerforstyrredekanværemedvirkendetil udviklingenafpsykiskelidelser(berking&wupperman,2012).endelforskning pegerpå,atvanskelighedermedemotionsreguleringkanopfattessomen generelrisikofaktor,derdisponererforudviklingenafpsykopatologi. Prospektivestudier(f.eks.Kim&Cicchetti,2010;McLaughlinetal.,2011)tyder såledespå,atvanskelighedermedemotionsreguleringeksistererforudfor udviklingenafbestemtepsykiskelidelserogaltsåikkeerforårsagetafselve lidelsen.ligeledeserdertegnpåatterapeutiskeinterventioner,somstyrker evnentilemotionsreguleringgenereltkanforbedrerbehandlingsresultatetved kognitivadfærdsterapi(berkingetal.,2008).samtidigmedatmangelfuldeevner tilemotionsreguleringbeskrivessomentransdiagnostiskrisikofaktor,anvendes begrebetiteoretiskekonceptualiseringerafspecifikkepsykiskelidelser.blandt andeterborderlinepersonlighedsforstyrrelse(fonagyetal.,2002;linehan, 1993),selvskadendeadfærd(Gratz,2007);stofmisbrug(Cheethametal.,2010), spiseforstyrrelser(burnsetal.,2012)ptsd(tulletal.,2007)ogforskellige angstlidelser(cisleretal.,2010)blevetbeskrevetsomtilstande,derpåforskellig visinvolvereremotioneldysregulering.detharmedførtudviklingenaf diagnosespecifikkebehandlingsprogrammermedsærligtfokuspåatstyrke patientensevnertilatregulereemotioner. Indenforneuropsykologienharderligeledesværetinteresseforstudierafde neuraleprocesser,somerinvolveredevedemotionsregulering(sebeer& Lombardo,2007forenoversigt).Interessenharherdrejetsigomatkortlægge denormalestrukturerogprocesser,somerinvolveretvedemotionsregulering, 24

25 samtatundersøgehvorvidtderfindesanormaliteter,somkanknyttestil forskelligekliniskepopulationer. Påtrodsafdenstigendeanvendelse,afemotionsreguleringsompsykologisk konstrukt,herskerderfortsatuenighedomkringkonceptualiseringenaf begrebet. Formåletmeddetteafsniteratafklarehvilketeoretiskeantagelser,derdanner grundlagforforståelsenafspecialetscentralefænomener.jegvilsåledes redegøreforminforståelseafsåvelemotionsomemotionsregulering.ligeledes viljegredegøreforhvordanevnertilemotionsreguleringudvikles,oghvordan forstyrrelseriudviklingenudgørenrisikoforpsykiskelidelser,herunderptsd. TeoriernevilløbendebliverelaterettilPTSD,ogjegvilargumentereforatdeer velegnetsomgrundlagfordensenereanalyseogdiskussionafemotionel dysreguleringvedptsd. 5.1Specialetsteoretiskeudgangspunkt Påtrodsafatderdesenereårharværetenstorvækstiantalletafstudier,som undersøgeremotionsreguleringerderfortsatikkeenighedom,hvadbegrebet egentligindebærer.forskelligeteoriererblevetfremsat,mendererikke konsensusomendefinitionafhverkenemotionellerregulering(bloch,moran& Kring,2010).Detharbetydetatforskelligestudierharanvendtskiftende konceptualiseringerogoperationaliseringer.deninkonsistentebrugaf forskelligedefinitionerogmetodisketilgangeergentagnegangeblevetkritiseret forathæmmedevidenskabeligefremskridtpåområdet,ogforatunderminere værdienafemotionsreguleringsomvidenskabeligtkonstrukt(cole,martin& Dennis,2004;Gross&Thompson,2007,Thompson,1994). Etafdecentraletvivlsspørgsmåldrejersigom,hvorvidtdetidetheletageter muligt,atadskilleemotionsgenereringfraemotionsregulering.noglefremhæver atemotionelleprocesseraltiderunderlagtenformforregulering,ogatdet derforermeningsløstatopereremedtoadskiltebegreber(campos,frankel& 25

26 Camara,2004).Ikontrasthertiloperererdeflesteeksperimentellestudierpå områdetmedento faktortilgang,hvorudfoldelsenafengivenemotionel tilstandogreguleringenheraf,studeressomadskilteprocesser. Denmanglendeklarhedomkringafgrænsningenafbegrebetharligeledes medførtentendenstilatfænomenersomblandtandetbekymring, katastrofetanker,ruminationoghæmningafemotionelleudtryk,dertidligere udgjordeselvstændigeforskningsområder,nustuderesunderbetegnelsen emotionsregulering.såledeskandet,iøjeblikket,synessomomaltinger emotionsregulering(berking&wuppermann,2012). Idettespecialeanvendesenforståelseafemotionsregulering,somharrødderi enkognitivadfærdsterapeutisktradition.detdrejersigsærliggradomde teorier,dernoglegangebetegnessomdentredjebølgeindenforkognitiv adfærdsterapi(hayes,2004).inkluderetidennebetegnelseer behandlingsprogrammersommindfulness BasedCognitivetherapy(Segal, Williams&Teasdale,2002),AcceptanceandCommitmentTherapy(Hayes, Strosahl&Williams,1999)ogDialektiskAdfærdsterapi(Linehan,1993). Modsattidligereversionerafkognitivadfærdsterapiudvidesfokushertilat inkludereemner,somførhenvarforbeholdtandreteoriretninger,herunder eksistentielleemner,spiritualitetogpersonligeværdier.etandetkendetegner brugenafmindfulnessbaseredeinterventioner.imodsætningtilvedtraditionel kognitivadfærdsterapiermåletherikke,atændreindholdetitankerogmentale repræsentationer,menatændredenmåde,somindividetforholdersigtilog opleverdisseprocesser.detgårigenitankegangenomemotionsregulering,der netopvægterbetydningenafindividetsforståelseafogmådeatforholdesigtil sinefølelser.pålinjemedlinehan(1993)viljegispecialetlæggevægtpåat forståemotionsreguleringsometmangefacetteretfænomen,dervedrører aspektervedindividetskognition,fysiologi,adfærdogsubjektiveoplevelse. Dettebetyderatemotionerkanpåvirkesogreguleresviaenlangrække forskelligeprocesser. 26

27 5.2Kognitivemotionsteori Hvismanlæserdenvidenskabeligelitteraturomemotioner,erdetpåfaldende hvorforskelligtdeenkelteteoretikereharkonceptualiseretetfænomen,somde selvmåantagesatvære,enddasærdeles,fænomenologiskbekendtemed (Lambie&Marcel,2002).Ordetemotionharsåledesikkeenpræcisfælles betydning,ogkonceptualiseresforskelligtaltefterhvilketteoretisktradition,der tagesudgangspunkti. Gennemdetmesteafhistorienerfølelserblevetbetragtetsomirrationelle,hvis ikkeperdefinition,såviaderesforstyrrendeindflydelsepådømmekraftenog deresoftekatastrofaleindvirkningiindividetsliv(sesolomon,2002foren historiskgennemgangaffilosofiskeogpsykologiskeperspektiverpåemotion). Dettesynspunkteridagblevetfortrængtafteorier,derfremhæveremotioners centralebetydningforindividetsgenerellefunktionogtrivsel(f.eks.damasio, 1994;Frijda,2007;Lazarus,1991;Solomon,2007).Emotionerkanbetegnessom funktionelleidenforstand,atdeerinvolveretidenøjeblikkeligeog kontinuerligeatvurderingafdesituationer,somindividetbefindersigi (Lazarus,1991).Herunderstøtterdebeslutningstagen(Bechara,2004;Damasio, 1994)ogforberederindividettilhandling(Frijda,2007).Emotionerersom mekanismegenereltfunktionelle,mensfunktionalitetenafdeenkelteemotioner varierer(frijda,1994).emotionerharisåvelvidenskabensomidagligsproget,i dag,fåetensåpositivplacering,atmanenddatalerom følelsernesintelligens (Goleman,1995). Nårfølelserofteoplevessomproblematiskeforindividet,erdetikkepågrundaf tilstedeværelsenafbestemteemotionerisigselv.hvorvidtengivenemotionel responserproblematiskafhængerikkeafselvedenskarakter,mankan udelukkendevurderesisammenhængmeddenkontekst,hvordenudspillersig (Gross&Thompson,2007).Mangeklinisketilstandeersåledeskarakteriseret vednormaltforekommendefølelser,dererforvedvarende,forekstremeeller upassendeiforholdtildengivnekontekst(beer&lombardo,2007).denne opfattelseer,somvisenereskalse,vigtigforforståelsenafemotionsregulering. 27

28 Ikognitivemotionsteoriunderstregessammenhængenmellemkognitive processerogemotioner.dererblevetforeslåetflereforskelligemodellerfor, hvadderudgørdetkognitiveelementiemotioner,mendenoverordnedepointe er,atkarakterenafenemotioneloplevelseikkebestemmesafsituationens karakterisigselv,menafindividetsvurderingellertolkningheraf.vurderinger skeriforholdtildet,somervigtigtforindividet.detvilsigemotiver,behov,mål, værdier,ogmereellermindrevedvarendedispositioneriforholdtilat foretrækkebestemteaspekterafverden(frijda,2007).kognitivevurderinger kanforegåintentioneltogbevidst,menofteerdetikketilfældet.iallelivets øjeblikkeerviinvolveretiikke refleksive,ikke voluntæreogikke artikulerede vurderinger.detkansammenlignesmedkinæstetiskevurderinger,somsjældent ervoluntæreellergenstandforbevidstopmærksomhed,mensomudgøret essentieltaspektvedvoreskontinuerligetilstedeværelseiverden(solomon, 2002). Itidligereemotionsteorier(f.eks.Ekman,1992;Izard,1977;Tomkins,1962)har derdesudenværettendenstil,atopfatteemotionersomikke reducerbare, medfødtemekanismer.disseteoretikeretaleromeksistensenafetbegrænset antalbasaleemotioner,somkankarakteriseresvedderesensartethediden forstand,atdefølgerprototypiskemønstreforhvilkesituationerderudløser dem,deefterfølgendeneurofysiologiskeprocesser,densubjektiveoplevelseog deekspressivekomponenter.emotioneropfatteshersometrelativtstatisk fænomen,somentenerder,ellerikkeerder. Ikognitivemotionsteoritegnesetmerekomplekstbilledeafdeemotionelle processer.emotioneropfatteshersombeståendeafmultiplekomponenter,der ikkenødvendigvishængersammeniensartedemønstre,mensomudviklersig dynamiskovertid(kuppens,stouten&mesquita,2009).emotionelleprocesser udspillersigienkontinuerligstrøm,derkanværekarakteriseretvedstørreeller mindregradafbevidsthed.engivenemotionkanpåvirkeikkeblotadfærd,men enddahelevoresorienteringiverdenogbegivenhederivoresliv,udenatvier bevidstehverkenomselveemotionen,ellerdensindvirkning(desouza,2004). Nårdekognitiveteoriergørindividetsvurderingtilencentralfaktoriden emotionelleproces,understregesdetsamtidig,atdererindividuelleforskellei disseprocesser.selvnogetså,relativtsimpeltsomatsættenavnpåeller 28

29 identificereenfølelseinvolvererfortolkningsmekanismer(solomon,2005).altså eroplevelsenafemotionunderlagtindividuelleogkulturelleforskelleiden forstand,atdenerinfiltreretafvoreserfaringerogindividuelleteorierom emotioner(kuppens,stouten&mesquita,2009).emotionerersåledesudtryk for,hvadverdenbetyderforindividet,somenbestemtperson,påetbestemt stediverden;deudgørhansellerhendesindividuellereaktionerpådetgivne øjeblik(frijda,2007). Sombeskrevetikapitel3fremhæverkognitiveteorieromPTSD,hvordan negativekognitivevurderingerforårsagerdenurealistiskoplevelseaf,atvære underlagtoverhængendefare.emotionerneharidennetilstandmistetderes funktionellebetydning.foratværeeffektivesignaleromverden,måemotioner såledesværesensitiveoverfordeydreomstændigheder:demåaktiveresnår denydreverdenkræverdet,menligesåvigtigtmådeslåfraigen,nårdeydre omstændighederforandres(williams,2010).vedptsdkanderikke slukkes forfølelserne,somvedvarendebekræfteroplevelsenaf,atdererfarepåfærde.i kraftfølelsernesheltcentraleplaceringidensubjektiveoplevelse,harde topprioritetforvurderingafhvad,somerpresserendeognødvendigtiengiven situation(frijda,2007).vedoplevelsenafangstvildenumiddelbare handleimpulsofteinvolvererflugtogundgåelse.ureguleredeemotioner bidragersåledestil,atundgåelsekommertilatspilleensådominerenderollei denpsykiskefunktionhospersonermedptsd. Påbaggrundafovenståendekanemotionerkarakteriseressomdynamiskeog mangefacetteredefænomener,derharenheltgrundlæggende,ogsom udgangspunktpositiv,funktionidenmenneskeligetilværelse.idetfølgendeskal visehvilkefænomener,derudgøremotioner,oghvordandeudfoldersigi kontinuerlige,temporaleprocesser. 29

30 5.3Denemotionelleproces GrossogThompson(2007)harudvikletenmodel,deranskueliggørhvordan emotioneropstårogudfoldersigsomkontinuerligecykliskeprocesser(figur2.). Ifølgemodellengeneresemotionerviafiretrin.(1)Enpsykologiskrelevant situationsomudløserdenemotionelleproces.dettekanværeydre begivenheder,ellerindreoplevelsersåsomforestillinger,tankerellerkropslige fornemmelser.(2)situationen,ellerderelevantedeleheraf,blivergenstandfor individetsopmærksomhed,og(3)derfinderenkognitivvurderingsted.den individuellevurdering,somskeriforholdtilindividetsmål,ogdekravsom situationenindebærer,dannergrundlagforkvalitetenogintensitetenaf(4)den emotionellerespons.responseninvolvererforandringerikognition,fysiologi,og adfærd,samtidensubjektiveoplevelse,deridagligsprogetbetegnes atføle (GrossogThompson,2007). Figur2.Denemotionelleproces(Gross&Thompson,2007). SombeskrevettidligereerdeemotionelleresponservedPTSDfarvetafnegative fortolkningsprocesser.problemetforstærkesyderligereafbiasi opmærksomhedsfunktionen,hvorpersonermedptsdertilbøjeligtilatfokusere pånegativeellerskræmmendeaspekterafsituationen(fanietal.,2012). Foroverblikketsskyldkandetværebrugbartatordnedeenkelteelementeri forholdtilderestemporaleplaceringidenemotionelleproces.emotionerbliver daogsåtypiskbeskrevetsombeståendeaftoadskilteelementer:enudløsende situationogselvedenemotionellerespons.disseelementerkansåvære yderligereopdelt,somdetertilfældetigrossogthompsonsmodel. 30

31 Endvidereerdetvigtigtatbemærke,atemotionerihøjgradpåvirkerde situationerhvordeudspillersig.emotionellesignaler,somisærkommertil udtrykgennemtale,ansigtsudtrykogkropssprog,erencentral informationskilde,somkanændreandremenneskersmådeatreagereog forholdesigisituationen.nåreksempelvisetbarnsgrådmedførertrøstfradets forældre,ellerenberusetpersonsvredesudbrudfårdeomkringståendetilatøge afstanden,kanvibeskriveemotionersomregulerende(cole,martin&dennis, 2004).Idenforstandkanemotioneropfattessometsystem,hvorbådekontekst ogresponserintegrerede(linehan,bohus&lynch,2007).engivenemotionel responskanikkeentydigtopfattessomeffektenafensituation,idetdetoudgør forbundneelementer,somgensidigtpåvirkerhinanden.påsammemåde opfattesdehandlemønstre,somerassocieretmedenbestemtemotion,somen delafselveemotionenogikkesomresultatetheraf.emotionererreaktioneri organismenssamledesystem,hvordeniøjeblikketudfoldendeemotionelle procesintegrererhelesystemetiforholdtilenbestemtinteresse(linehan, 1993).Vedgensidigpåvirkningkandeenkelteelementerfastholdeengiven emotionelproces.eksempelviskanfølelsenafatværekedafdetindebæreen handletendenstilatisoleresigsocialt,ogfokuserepånegativeaspekterved tilværelsen.dettekanyderligereforstærkedetristefølelser.emotionen,som ellersvilleudfoldesigoveretkortvarigtogafgrænsettidsrum,kanpådenne mådeantageformafenlængerevarendesindstilstand. Vedatopfatteralleaspekteridenemotionelleprocessomdeleietsamlet system,bliverdetklarthvordanpåvirkningafetenkeltelement,kanforandre heleprocessen.derforkanemotionerpåvirkesogreguleresgennem modifikationafmangeforskelligeprocesser,indenforenrækkedomænerogpå forskelligetidspunkteriforløbet.tilgangengiversåledesetgodtgrundlagforat forstådeegenskaber,somharbetydningforemotionsreguleringogomvendtfor demangler,somkanværeinvolveretvedemotioneldysregulering. 31

32 5.4Reguleringsprocesser Emotioneropstårogvirkerikontinuerligecykliskeprocesser,somikke nødvendigvisfølgerfastlagteforløb,mensompåvirkerorganismenssamlede funktion.emotionerneharenfremtrædendeplaceringidensubjektiveoplevelse ogendominerendebetydningvedbeslutningstagen,handlingog kommunikation.mensamtidigkonkurrereremotionermedandreresponser, somidenpågældendesituationkantrædeiforgrunden(gross&thompson, 2007).Deterenvigtigpointeiforholdtilemotionsregulering,dadetindebærer mulighedenforatmodificereengivenemotionelproces.enhyppigtanvendt definitionafbegrebetlyder: Emotionregulationreferstotheprocessesbywhichindividualsinfluencewhich emotionstheyhave,whentheyhavethem,andhowtheyexperienceandexpressthese emotions.emotionregulatoryprocessesmaybeautomaticorcontrolled,consciousor unconscious,andmayhavetheireffectsatoneormorepointsintheemotiongenerative process. (Gross,1998s.275). MedGrossogThompsonsmodel(figur3.s.31)kanforskelligeformerfor emotionsreguleringkarakteriseresiforholdderestemporaleplaceringiden emotionelleproces.modellenviserfemtidsafgrænsedeområderhvorregulering kanfindested,oghvorhvertområdekanknyttestiltypiske reguleringsstrategier.detmestudbredteersandsynligvisatanvendemange forskelligemetodertilemotionsregulering,fordeltoveralledissedomæner, hvorimodproblemerofteopstårvedensidiganvendelseafbestemteformerfor regulering.såledeserpsykiskelidelser,somblandetandetptsd,ofte karakteriseretvedufleksibelbrugafenbegrænsetmængdeforskellige strategier. 32

33 Figur3.Procesmodelforemotionsregulering(Gross&Thompson,2007). Udvælgelseafsituationrefererertiltilnærmelseellerundgåelseafsteder, personerogaktiviteter,medhenblikpåatbegrænseellerøgebestemte emotionelleresponser.sombeskrevetudgørfravalgafsituationer,somminder omdentraumatiskeerindringetafdeprimæreproblemervedptsd. Modifikationafsituationbeståriatændreraspektervedensituationogderved densemotionellebetydning.detkanblandandetkommetiludtrykved sikkerhedsadfærd.fokuseringafopmærksomhedpåbestemteaspekterien situation,kanværemedtilatøgeellerbegrænsebestemteemotionelle responser.somnævnterpersonermedptsdtilbøjeligetilatfokuserepå truendeaspektervedensituation,hvilketskyldesatdeerpåvagtoverfor potentiellefarer.kognitivforandringrefererertilstrategier,derinvolverer genfortolkningafdenumiddelbarevurderingen,medhenblikpåatændreden emotionelleoplevelse.personermedptsder,idetdereskognitiveskemaerer karakteriseretvedenrigid,negativopfattelseafdemselvogverden, sandsynligvisikkeisærlighøjgradistandtilatanvendedennetypestrategier. Endelighandlerhenvisermoduleringafresponstilændringellerhæmningaf fysiologiske,adfærdsmæssigeellerekspressiveresponser,somerknyttettilde enkelteemotioner.vedptsdkandetkommetiludtryksomforsøgpåat undertrykkeoplevelsenellerudtrykketafbestemtefølelser. 33

34 GrossogThompsonsmodeldemonstrerer,medfokuspådetemporaleaspekter, enmådeatforståemotionsreguleringpå.dengivermulighedfor,atanalysereog karakteriserebestemteproblemområder,somkanværemedvirkendetil udviklingogvedligeholdelseafpsykiskelidelser.deresteorispecificererdog ikkehvilkeprocesserogegenskaber,somtypiskudgøremotionsregulering. Derforinddragerjegidetfølgendeafsnitendnuenteori,somkanværemedtil, atanskueliggøredette. 5.5DifficultiesinEmotionRegulationScale Jeganvenderispecialetenmodelforemotionsregulering,somerudvikletafKim L.Gratz&LizabethRoemer(2004).DenerknyttettilderesDifficultiesin EmotionRegulationScale(DERS),someretassessment skema,dergennem36 itemsvurdererindividetsselvrapporteredeevnertilemotionsregulering.ders eridagetafdemestanvendtemåliforskningomemotionsregulering,hvilket ogsåertilfældetistudier,somundersøgerbegrebetirelationtilptsd. Teorienhardenfordelatdengiverenbredbeskrivelseafhvilkeegenskaber,der kanværeinvolveretvedemotionsregulering.teorientagerudgangspunktien funktionalistiskforståelseafemotioner,ogtrækkerpåadfærdsteori, mindfulnessogdialektiskadfærdsterapi.dervedsamlerdenmangeafde teoretiskepointer,somspecialetbyggerpå. Ioverensstemmelsemedenfunktionalistiskemotionsteori,opfattes emotionsreguleringikkekunsometspørgsmålomatkontrollerefølelser,men mereoverordnetsomenrækkeegenskaber,derpåvirkerhvordanindividet opleverogforholdersigtilsineemotionelleprocesser.såledeskanmangleri forholdtilatopleveogdifferentieredenfuldevifteafemotionerogrespondere spontantværeligesåproblematisksommangelfuldeevnertilatmodulere negativeemotioner.ifølgemodellenkanderskelnesmellemseksadskilte dimensioner,somharbetydningforemotionsregulering:(1)emotionelklarhed, (2)emotionelbevidsthed,(3)adgangtileffektivestrategiertilemotionsregulering, (4)impulskontrolvedoplevelsenafnegativeemotioner,(5)evnentilathandle 34

35 målrettetvedoplevelsenafnegativeemotioner,og(6)emotionelaccept. Vanskelighederindenforet,ellerflereafdisseområderindikererproblemermed emotioneldysregulering(gratz&roemer,2004s.52). Jegvilhergennemgådeseksdimensioner,somdannergrundlagfor undersøgelseninæstekapitel. Emotionelklarhedinvolvereratkunneskelnemellemdeforskelligeemotioner, ogforståderessammenhængmedengivensituation.noglemenneskeroplever deresemotionersomklartafgrænsede,ogkantydeligtskelnemellemenlang rækkepositiveognegativeemotioner.andreharenmereudifferentieret oplevelse,hvoremotionerprimærtadskillesiforholdtil,omdemedførerubehag ellervelbehag(barretetal.,2001).jomeredifferentieretogintegrereten personensvidenomemotionerer,jobedrevilvedkommendeværeistandtil,at profiterefraemotionernesinformationsværdi(stegge&terwogt,2007).en personmedethøjtniveauafemotionelklarhedharvedaktiveringafengiven emotionadgangtiletvældafinformationer,herunderomemotionensårsag,om deforventedekropsligereaktionerogekspressiveudtryk,samtommulige handlinger,derkanforstærkeellerreduceredenemotionelleoplevelse. Eteksperimenteltstudieharvistatindividermedbedreevnertilatdifferentiere emotionerofteregørbrugafemotionsregulering(barretetal.,2001).detserud til,atenvisforståelsefor,ogafgrænsningmellemdeenkelteemotionerudgøret vigtigtgrundlagforidetheletage,atforsøgepåatregulereemotioner. Sombeskrevetikapitel3opleverpersonermedPTSDoftebegrænsningeri deresevnetilatoplevedetfuldespektrumafemotioner,hvilketidiagnoselisten opfattessomresultatetafvedvarendeemotionelundgåelse(american PsychiatricAssociation,2000).Inoglestudieranvendesdetrelateredebegreb alexithymi,somrefererertilvanskelighedermedatopleve,forståogudtrykke emotioner,samtentendenstileneksternorienteretkognitivstil(sifneos,1973). IndividermedPTSDudviser,sammenlignetmedandrepsykiatriskepatienter,et højtniveauafalexithymi(frewenetal.,2008). Emotionelbevidsthederevnentilbevidst,atmonitorereogevaluereegne emotionelleprocesser.emotionsregulering,ihvertfaldibegrebetseksplicitte form,kræverenvisgradafbevidsthedom,atenssubjektiveoplevelseogadfærd grundlæggendehængersammenmedskiftendeemotionelleprocesser.indenfor 35

36 mindfulness baseredeteoriretningerfremhævesvigtighedenafbevidstatkunne retteopmærksomhedenmodprivateoplevelser,herunderemotionelle processer.atindtageetdecentreretperspektivgørindividetistandtilatopleve attankerogfølelserermentalefænomener,ogikkeudtrykforendirekte afspejlingafvirkeligheden(teasdale,1999).denneoplevelsesmæssigedistance gørdetmuligtatforholdesigundersøgendetildeemotionelleprocesseroggøre demtilgenstandforregulering. Strategiertilemotionsreguleringkaninvolveremangeforskelligehandlingerog processer,somudelukkendehardettilfælles,atdepådeneneellerandenmåde påvirkerindividetsfølelser.fænomenersomgenfortolkning,distraktion, undgåelse,hæmningafemotionelleudtrykogruminationkanbeskrivessom emotionsreguleringsstrategier.noglestrategierbetegnestypisksom maladaptiveogprototypiskeforudviklingogvedligeholdelseafbestemte psykiskelidelser.eksempelvisbeskrivesdet,hvordanpersonermeddepression ertilbøjeligetilkontinuerligtatspekulererogbekymresigomderessituation. Dennevedvarenderuminationtjenerumiddelbartsometforsøgpåatløsede oplevedeproblemer,menkanistedetværemedvirkendetilatvedligeholdede depressivesindstilstand(nolen Hoeksema,1991). StephenC.Hayesoghanskolleger(Hayesetal.,1996)harudvikletbegrebet oplevelsesorienteretundgåelse,somrefererertiluvillighedtilatværeikontakt medbestemteprivateoplevelser,såsomkropsligefornemmelser,tanker, emotioner,erindringerelleradfærdsmæssigedispositioner.undgåelse involvererforsøgpåatændrekarakterenellerfrekvensenafdisseoplevelser, ellerdenkontekst,somudløserdem.ifølgehayeseroplevelsesorienteret undgåelseproblematisk,idetdetinvolvereratuundgåeligeoggrundlæggende deleafdenmenneskeligeeksistensbenægtes(walser&hayes,2008).ligeledes hindrerundgåelse,somalleredebeskrevet,processeringaftraumerelaterede erindringer,ogmodifikationafurealistiskekognitiveantagelser. Desudenharforsøgpåaktivtatundgåogkontrollereemotionerofteden paradoksaleffekt,atdetrentfaktiskforstærkeroplevelsenafdet,somforsøges undgået.eksperimentellestudierhardemonstreret,athæmningafemotionelle udtrykformindskeroplevelsenafpositiveemotioner,hvorimoddetøgerden 36

37 oplevedestyrkeafnegativeemotioner,ogmedførerøgetfysiologiskarousal (Butler&Gross,2004;Gross&John,2002).Ligeledeserstorgradafhæmningaf emotionelleudtrykassocierettiletgenereltnedsatniveauafpositiveoplevelser ogdårligereinterpersonellerelationer(gross&john,2002). Påsammemådekanforsøgpåatladeværemedattænkebestemtetanker forstærkeintensitetenafnetopdet,derforsøgesundgået(wegneretal.,1987). Endeligermangeafdestrategier,somerforbundetmedoplevelsesorienteret undgåelseisigselvproblematiske.detgælderblandtandetmisbrugafstoffer elleralkohol,aggressivehandlingerogrisikobetonetseksueladfærd.tendensen tiloplevelsesorienteretundgåelsekanbetegnessometafdeprimæreproblemer vedptsd,idetdetermedvirkendetilatvedligeholdetilstanden(walser& Hayes,2008). Selvomnoglestrategierofteerforbundetmedproblemer,erdetikkemuligt definitivtatbeskrivebestemtestrategiersomhenholdsvisgodeellerdårlige. Hvorvidtbestemteemotionsreguleringsstrategierkanopfattessomadaptive, afhængeraltidafdenkontekst,somindividetindgåri,ogdetmåvurderesi forholdtil,omdeunderstøtterdeaktuellemål,samtdekravsomengiven situationindebærer(thompson,1994).såledeskandetnoglegangevære hensigtsmæssigtatundgåbestemtesituationer,sommanpåforhåndvedvil medføreovervældendeemotioner.fremforatværeetspørgsmålomatmestre bestemtestrategierogafståfraatbenytteandre,beståreffektiv emotionsreguleringifleksibelbrugafforskelligestrategier,derkantilpassestil dengivnekontekst.manglendefleksibilitetellerstereotypbrugafbestemte strategierkanværemedvirkendetiludviklingogvedligeholdelseafpsykiske lidelser.forattagehøjdeforreguleringsstrategierneskontekstafhængigenatur, vurdererderspersonenssubjektiveoplevelseafathaveeffektive reguleringsstrategiertilrådighedogikke,hvorvidtbestemtetyperafstrategier anvendes(gratz&roemer,2004). Impulskontrolvedoplevelseafnegativeemotionerindebæreratkunnehæmme denumiddelbarehandleimpuls,uansetkarakterenafdenaktuelleemotionelle oplevelse.evnertilatreguleredenemotionelleoplevelseogreaktioneraf afgørendebetydning,eftersombristidenneevneførertilkaosiadfærden,isæri 37

38 målrettetadfærdogandenprosocialadfærd.moduleringafemotionelarousal hjælperindividettilatmodstådepåtrængendehandleimpulsersomstærke emotionermedfører,såledesathan,ellerhuneristandtilatundladeathandle uhensigtsmæssigt(linehan,1993).selvskadendeadfærd,overspisning,alkohol ogstofmisbrugereksemplerpåhandlinger,derumiddelbartkanværeeffektive emotionsreguleringsstrategier,mensompålængeresigtkanhavenegative konsekvenserforindividet.emotionsreguleringdrejersig,idenneforståelse,i ligesåhøjgradomatkontrollereadfærd,somatkontrollereemotionerisigselv (Gratz&Roemer,2004).Imodsætningtilathandleimpulsivtindebærer velfungerendeemotionsreguleringatindivideteristandtilathandlemålrettet vedoplevelsenafnegativeemotioner.detvilsigeatkunnehandlei overensstemmelsemedpersonligemålogværdier,uansetsindsstemningenien givensituation(linehan,1993). Emotionelacceptrefererertildenpersonligeattitudeiforholdtilatopleveog udtrykkeemotioner.mindfulness baseredeteorierfremhæverudviklingenafen accepterendeindstillingiforholdtilskiftendesubjektiveoplevelser,herunder emotioner,sometcentraltmåibehandlingen.modsætningentilemotionel acceptkankommetiludtryksomenmodviljemod,ellerfrygtfor,atopleve bestemtetyperafemotioner. Manglendeemotionelacceptkandesudenmedføreproblematiskesekundære emotionelleresponser,deropstårsomreaktionpåenoprindeligemotionel respons(greenberg&safran,1987).derkaneksempelvisværetaleom skamfuldeemotioneriforbindelsemedvrede,elleromvredevedoplevelsenaf tristhed.sekundæreemotionerbetegnessomindlærteresponser,derer påvirketafkulturellenormer,samtattitudeniopvækstmiljøetiforholdtil oplevelseogudtrykafdeenkelteemotioner.sekundæreemotionererofte dysfunktionelleidenforstandatdeslørerdenemotionelleoplevelse,oggørdet vanskeligtatforstå,hvorformanopleverbestemteemotionellereaktioner (Linehan,1993). DehidtidigestudiermedDifficultiesinEmotionRegulationScalehar demonstreretgodinternkorrelationmellemfaktorerne,hvilketopfattessomet 38

39 målfor,atdeerknyttettildetsammeoverordnedekonstrukt(gratz&roemer, 2004;Neumannetal.,2010).Desudenharmodellenvistsigatkunneforudsige enrækkefænomenersomifølgeteorienerknyttettilemotioneldysregulering. Såledesharhøjscore,derafspejleremotioneldysregulering,signifikantkunnet forudsigesymptomniveauetvedgeneraliseretangst(salters Pedneaultetal., 2006)ogPTSD(McDermontetal.,2009),samthvorvidtpersonenharværet udsatforemotionelmishandlingibarndommen(soenkeetal.,2010).dogerdet værdatbemærke,atderertvivlomhvorvidtfaktorenemotionelbevidsthed målerdetsammeoverordnedekonstrukt,daresultaterneherermereusikre (Bardeen,Fergus&Orcut,2012). Dererfleregrundetil,atGratzogRomersmodeleranvendeligidettespeciale. Delssamlerdenenrækkeprocesser,somindenfordenanvendteteoriramme, kanbetegnessomcentraleforindividetsevnetilemotionsregulering.delser DifficultiesinEmotionRegulationScaleetafdemestanvendteværktøjerved studierafemotionsreguleringiforbindelsemedptsd.modellendannerderfor etgodtudgangspunktforatundersøgeindenforhvilkeområderknyttettil emotionsreguleringindividermedptsdudviserproblemer. Indenvigårvideretillitteraturgennemgangenviljegredegøreforden udviklingspsykologiskeforståelseafemotionsregulering,somudgøretvigtigt grundlagfordensenerediskussion. 5.6Udviklingspsykologiskeperspektiverpåemotionsregulering Iudviklingspsykologisketeorierbeskrivesudviklingenafemotionsregulering oftesometresultatafsamspilletmellemmedfødteforskelleiemotionel reaktivitetogsocialefaktorer,hvorkvalitetenafomsorgsmiljøetspillerden primærerolle(f.eks.calkins&howse,2004;sameroff,2009;thompson& Calkins,1996).Udviklingenidetidligeleveårkanbeskrivessomenbevægelse fraeksternregulering,derforspædbarnetvaretagesafvoksne omsorgspersoner,henimodudviklingenafdekognitive,psykiskeog fysiologiskeegenskaber,sommuliggørinternregulering(calkins&hill,2007). 39

40 Reguleringafemotionerudgøretafaspekternevedindividetsselvregulering. Selvreguleringkandefineressomenformforkontrolsystem,der viaprocesser indenforfysiologi,opmærksomhed,emotioner,adfærd,kognitionog interpersonelleprocesser sikrerindividetstilpasningsdygtighed(calkins& Howse,2004).Udviklingenafselvreguleringforegårsåledespåmange forskelligeniveauerogeroftehierarkiskorganiseret,idetbasalefysiologiske processerbidragertildentidligeuviklingafdeøvrigefunktioner. Atværeistandtilatregulereemotionersikreretemotioneltarousalniveau,som understøtterindividetsoptimaleinteraktionmedsineomgivelser(thompson, 1994).Mangleriforholdtiludviklingenafdetidligeegenskabertil selvreguleringkanidenforstandfåenakkumuleretbetydning,idetdetkanfå konsekvenserformulighedenforatopnåforventedeudviklingsmål.detkan medføreøgetrisikoforforskelligeformerforfejltilpasning,ogpålængeresigt forudviklingenafpsykiskelidelser(kim&cicchetti,2010). Indenfortilknytningsteorienfindesenomfattendelitteratur,derbeskriver hvordandettidligesamspilmellembarnetogdetsomsorgspersonerdanner grundlagforudviklingenafselvregulering.kvalitetenafbarnets tilknytningsrelationopfatteshersomenindikatorfordensenereudviklingaf evnertilemotionsregulering(f.eks.fonagy,gergely&jurist,2003;schore, 1994).Idenkognitivetraditionanvendestermentilknytningsomregelikke, mendetbetyderikkenødvendigvis,atbetydningenafopvækstmiljøetvægtes mindre.imarshalinehansbiosocialeteoribeskrivesdeproblemermed emotioneldysregulering somantagesatliggebagmangeafdeøvrige symptomer,derkendetegnerpersonermedborderline personlighedsforstyrrelse somresultatetafensærligmedfødtemotionel sårbarhedikombineretmedopvækstenietinvaliderendemiljø.idet invaliderendeopvækstmiljølærerbarnetikkeatskelnemellemdeforskellige emotioner.detudviklerikkeevnertilattolerereemotioneltubehag,ogfordi detsemotionellereaktionerikkerespekteresogvalideresafomsorgspersonerne, lærerdetikkehvornårdetkanstolepåsineemotionersomvalidefortolkninger afbegivenheder(linehan,1993). Processerderudspillersigidetidligeleveår,harsåledesafgørendebetydning forudviklingafevnertilemotionsregulering,ogforeventuellefejludviklinger, 40

41 derkanudgøreenrisikoiforholdtilsenereudviklingafpsykopatologi.at emotionsreguleringberorpåentilstrækkeliggradafomsorgtidligtilivet, bekræftestildelsafstudier,derharfundetensammenhængmellem omsorgssvigtidentidligebarndomogemotioneldysregulering(f.eks.burnset al.,2012;kim&cicchetti,2010;maughan&cicchetti,2002). Iforholdtilspecialetsproblemfelthardenudviklingspsykologiskeforståelse relevansiforholdtil,atforståhvordanopvækstbetingelserog/ellerudsættelse fortraumertidligtilivetkandisponereforsenereatudvikleptsd.ifølge teoriernekanemotioneldysreguleringudgøreenafdemekanismer, hvorigennemdennedispositionkangøresiggældende. 5.7Opsummering Begrebetemotionsreguleringhardesenereåropnåetstorudbredelseindenfor klinisk ogudviklingspsykologi.detudgørensamlebetegnelseforenrække processer,somharbetydningfordenmåde,somindividerforstår,forholdersig tilogforsøgerathåndterederesemotioner.foratkunneindgåioptimalt samspilmedsineomgivelsernemåindivider,ienellerandengrad,væreistand tilatreguleresinefølelser. Begrebetmangler,påtrodsafdenstigendeanvendelse,entilstrækkeliggod definitionogafgrænsningfraandrerelateredekoncepter.idettespeciale anvendesenteoretiskforståelse,somerbaseretpåtredjegenerationafkognitiv adfærdsterapi.herfremhævesemotionernesgrundlæggendefunktionelle betydningidenmenneskeligetilværelse.emotioneropfattessåledessomen vigtigkildetilinformationomomgivelserne,derblandtandetunderstøtter beslutningstagenogsocialinteraktion.vedptsderemotionernesfunktionelle betydningimidlertidigbegrænset,idetdereskontinuerligeaktiveringbidrager tilperceptionenafatværeudsatforfare. DifficultiesinEmotionRegulationScale(DERS)eridagetafdemestanvendte assessmentredskabertilatvurdereindividuelleevnertilemotionsregulering. Medudgangspunktidesammeteorier,somanvendesispecialet,berorpåDERS 41

42 enbredforståelseafemotionsregulering.emotionsreguleringinvolverersåledes emotionelklarhed,emotionelbevidsthed,adgangtileffektive reguleringsstrategier,evnertilatkontrollereimpulseroghandlemålretteved oplevelsenafnegativeemotioner,samtemotionelaccept. Udviklingenafindividetsevnertilselvreguleringafemotionerberorpåen kombinationafmedfødtefaktorer,ogdettidligesocialesamspili opvækstmiljøet.belastendeomstændigheder,såsomomsorgssvigt,kanhave vidtrækkendekonsekvenserforudviklingenafemotionsregulering.emotionel dysreguleringkanhervedudgøreenafdemekanismerhvorigennem belastningertidligtilivetkanfungeredisponerendefordensenereudviklingaf psykiskelidelser,herunderptsd. 42

43 6.Litteraturgennemgang:Empiriskestudieraf emotioneldysreguleringvedptsd Idennedelafspecialetviljegvurderedenempiriskelitteraturvedrørende emotionsreguleringvedptsd.formåleteratundersøgeompersonermedptsd udviseremotioneldysregulering,herunderomdererspecifikkemangler,somi særliggradkanknyttestillidelsen.detvilligeledesbliveundersøgtomde sværestbelastedeptsdpatienter,dersombeskrevettidligerekunibegrænset omfangprofitererfrabehandlingen,isærliggradopleveremotionel dysregulering.tilsidstikapitletfremhæverjegnoglebegrænsningervedde hidtidigestudier. Resultaterneidettekapiteldannergrundlagforderesterendedeleafspecialet, hvorjegvildiskutere,hvilkenrolleemotioneldysreguleringharforptsd symptomatologienogforbehandlingensudfald. 6.1Strategiogkriterierforlitteratursøgning LitteratursøgningenblevudførtviaPsycinfoogPubmed,medenkombinationaf søgeordeneposttraumaticstressdisorderogemotionregulation.derblev ligeledessøgtpådealternativesøgeord:emotionalregulation/affectregulation/ emotionaldysregulation/emotionalinstability/emotionalcontrol/emotional awareness/emotionalclarity/emotionalacceptance/impulsecontrol/goal directedbehaviour. Studierfrapeerreviewedtidsskriftermedvoksne(>18år)deltagereblev inkluderetiundersøgelsen.kunstudier,derundersøgersammenhængenmellem emotionsreguleringogptsd detvilsigesominkluderermålingerafbegge fænomener indgår.ialt22studieropfyldtekriterierneforatindgåi undersøgelsen(tabel1.påside46 48viserenoversigtoverdeinkluderede studier). 43

44 6.2Kategoriseringaflitteratureniforholdtilspecialetsteori Somtidligerebeskrevetanvendesderilitteraturenomemotionsreguleringen rækkeforskelligekonceptualiseringerafbegrebet.studiernesomindgåri litteraturgennemgangenudgørikkenogenundtagelseherfra,idetde operationalisererogfokusererpåforskelligeaspektervedemotionsregulering. Endelafstudierneanvenderikkebegrebetemotionsregulering,mende undersøgtefænomenererrelaterettildenkonceptualiseringaf emotionsregulering,somanvendesispecialet.i9afstudierneanvendes DifficultiesinEmotionRegulationScale(DERS)tilassessmentaf emotionsregulering,mensderesterendebenytterandreassessmentredskaber. SomtidligerebeskreveterDERSmodellenoprindeligtudvikletforatsamle empiriskeindicerogteoretiskeantagelservedrørendeemotionsregulering. Dennebredekonceptualiseringgør,atdetharværetmuligtatorganisere studierne,ilitteraturgennemgangen,indenformodellensseksdimensioner: Emotionelklarhed,emotionelbevidsthed,strategiertilemotionsregulering, impulskontrolvedoplevelseafnegativeemotioner,evnentilmålrettethandlingved oplevelseafnegativeemotionersamtacceptafemotioner.nogleenkeltestudier angiverudelukkendeetsamletmålforemotionsregulering.dissevilblive behandletførst,hvorefterlitteraturgennemgangenvilfølgedersmodellensseks faktorer. 44

45 45

46 46

47 47

Learnings from the implementation of Epic

Learnings from the implementation of Epic Learnings from the implementation of Epic Appendix Picture from Region H (2016) A thesis report by: Oliver Metcalf-Rinaldo, oliv@itu.dk Stephan Mosko Jensen, smos@itu.dk Appendix - Table of content Appendix

Læs mere

Fejlbeskeder i SMDB. Business Rules Fejlbesked Kommentar. Validate Business Rules. Request- ValidateRequestRegist ration (Rules :1)

Fejlbeskeder i SMDB. Business Rules Fejlbesked Kommentar. Validate Business Rules. Request- ValidateRequestRegist ration (Rules :1) Fejlbeskeder i SMDB Validate Business Rules Request- ValidateRequestRegist ration (Rules :1) Business Rules Fejlbesked Kommentar the municipality must have no more than one Kontaktforløb at a time Fejl

Læs mere

MARITIME PROFESSIONALS, ASHORE AND AT SEA. Online Identitet. 29-03-2011 www.job2sea.com 1

MARITIME PROFESSIONALS, ASHORE AND AT SEA. Online Identitet. 29-03-2011 www.job2sea.com 1 Online Identitet 2011 29-03-2011 www.job2sea.com 1 Online Identity The social web, i.e. the usage of the web to support the social process, represents a space in which people have the possibility to express

Læs mere

Measuring the Impact of Bicycle Marketing Messages. Thomas Krag Mobility Advice Trafikdage i Aalborg, 27.08.2013

Measuring the Impact of Bicycle Marketing Messages. Thomas Krag Mobility Advice Trafikdage i Aalborg, 27.08.2013 Measuring the Impact of Bicycle Marketing Messages Thomas Krag Mobility Advice Trafikdage i Aalborg, 27.08.2013 The challenge Compare The pilot pictures The choice The survey technique Only one picture

Læs mere

Sustainable investments an investment in the future Søren Larsen, Head of SRI. 28. september 2016

Sustainable investments an investment in the future Søren Larsen, Head of SRI. 28. september 2016 Sustainable investments an investment in the future Søren Larsen, Head of SRI 28. september 2016 Den gode investering Veldrevne selskaber, der tager ansvar for deres omgivelser og udfordringer, er bedre

Læs mere

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen Øjnene, der ser - sanseintegration eller ADHD Professionshøjskolen UCC, Psykomotorikuddannelsen Professionsbachelorprojekt i afspændingspædagogik og psykomotorik af: Anne Marie Thureby Horn Sfp o623 Vejleder:

Læs mere

Business Rules Fejlbesked Kommentar

Business Rules Fejlbesked Kommentar Fejlbeskeder i SMDB Validate Business Request- ValidateRequestRegi stration ( :1) Business Fejlbesked Kommentar the municipality must have no more than one Kontaktforløb at a time Fejl 1: Anmodning En

Læs mere

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov.

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. På dansk/in Danish: Aarhus d. 10. januar 2013/ the 10 th of January 2013 Kære alle Chefer i MUS-regi! Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. Og

Læs mere

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com.

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com. 052430_EngelskC 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau C www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Forskning i Kvalitet og Patientsikkerhed i Sundhedsvæsnet. Hvorledes bringes samfundsmæssige udfordringer på den danske forskningsdagsorden?

Forskning i Kvalitet og Patientsikkerhed i Sundhedsvæsnet. Hvorledes bringes samfundsmæssige udfordringer på den danske forskningsdagsorden? Forskning i Kvalitet og Patientsikkerhed i Sundhedsvæsnet Hvorledes bringes samfundsmæssige udfordringer på den danske forskningsdagsorden? Har Kvalitet og Patientsikkerhed særlige muligheder? Mogens Hørder

Læs mere

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen. og

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen.  og 052431_EngelskD 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau D www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Aktivering af Survey funktionalitet

Aktivering af Survey funktionalitet Surveys i REDCap REDCap gør det muligt at eksponere ét eller flere instrumenter som et survey (spørgeskema) som derefter kan udfyldes direkte af patienten eller forsøgspersonen over internettet. Dette

Læs mere

Forslag til implementering af ResearcherID og ORCID på SCIENCE

Forslag til implementering af ResearcherID og ORCID på SCIENCE SCIENCE Forskningsdokumentation Forslag til implementering af ResearcherID og ORCID på SCIENCE SFU 12.03.14 Forslag til implementering af ResearcherID og ORCID på SCIENCE Hvad er WoS s ResearcherID? Hvad

Læs mere

Trolling Master Bornholm 2014

Trolling Master Bornholm 2014 Trolling Master Bornholm 2014 (English version further down) Den ny havn i Tejn Havn Bornholms Regionskommune er gået i gang med at udvide Tejn Havn, og det er med til at gøre det muligt, at vi kan være

Læs mere

E-sundhedskompetence - et redskab til at skabe bro mellem borgere, patienter og vores digitale sundhedstilbud

E-sundhedskompetence - et redskab til at skabe bro mellem borgere, patienter og vores digitale sundhedstilbud E-sundhedskompetence - et redskab til at skabe bro mellem borgere, patienter og vores digitale sundhedstilbud Lars Kayser Institut for Folkesundhedsvidenskab Københavns Universitet Andre Kushniruk, Richard

Læs mere

Oقâê ط ëش fi applefiàâ ق

Oقâê ط ëش fi applefiàâ ق A Oô O اéfiàشâ Oêز fi ôfiàâ ôâطapple é µâàëش ô صâطâµ éâقâêë â1, à êë ê apple àد 2, ô é ê ططشâ2, مéµشâ âfiطش 3 1 صسµسë ز éقâµمà œ, Msc, PNF Instructor 2 apple âéâ صسµëéش, /½ôœ 3 صسµسë /½ôœ appleش âشàà :

Læs mere

Skriftlig Eksamen Kombinatorik, Sandsynlighed og Randomiserede Algoritmer (DM528)

Skriftlig Eksamen Kombinatorik, Sandsynlighed og Randomiserede Algoritmer (DM528) Skriftlig Eksamen Kombinatorik, Sandsynlighed og Randomiserede Algoritmer (DM58) Institut for Matematik og Datalogi Syddansk Universitet, Odense Torsdag den 1. januar 01 kl. 9 13 Alle sædvanlige hjælpemidler

Læs mere

Ikke-parametriske tests

Ikke-parametriske tests Ikke-parametriske tests 2 Dagens menu t testen Hvordan var det nu lige det var? Wilcoxson Mann Whitney U Kruskall Wallis Friedman Kendalls og Spearmans correlation 3 t-testen Patient Drug Placebo difference

Læs mere

Bedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering Titel (forfatter)

Bedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering Titel (forfatter) Bedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering Titel (forfatter) Link til retningslinjen Resumé Formål Fagmålgruppe Anbefalinger Patientmålgruppe Implementering

Læs mere

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred Kandidatuddannelsen i Folkesundhedsvidenskab Aalborg Universitet 1. Semester projekt Gruppe nummer: 755 Vejleder: Henrik Bøggild

Læs mere

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet. ATEX direktivet Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.dk tlf: 7220 2693 Vedligeholdelse af Certifikater / tekniske dossier / overensstemmelseserklæringen.

Læs mere

SOFTWARE PROCESSES. Dorte, Ida, Janne, Nikolaj, Alexander og Erla

SOFTWARE PROCESSES. Dorte, Ida, Janne, Nikolaj, Alexander og Erla SOFTWARE PROCESSES Dorte, Ida, Janne, Nikolaj, Alexander og Erla Hvad er en software proces? Et struktureret sæt af AKTIVITETER, hvis mål er udvikling af software. En software proces model er en abstrakt

Læs mere

DET KONGELIGE BIBLIOTEK NATIONALBIBLIOTEK OG KØBENHAVNS UNIVERSITETS- BIBLIOTEK. Index

DET KONGELIGE BIBLIOTEK NATIONALBIBLIOTEK OG KØBENHAVNS UNIVERSITETS- BIBLIOTEK. Index DET KONGELIGE Index Download driver... 2 Find the Windows 7 version.... 2 Download the Windows Vista driver.... 4 Extract driver... 5 Windows Vista installation of a printer.... 7 Side 1 af 12 DET KONGELIGE

Læs mere

Statistik for MPH: 7

Statistik for MPH: 7 Statistik for MPH: 7 3. november 2011 www.biostat.ku.dk/~pka/mph11 Attributable risk, bestemmelse af stikprøvestørrelse (Silva: 333-365, 381-383) Per Kragh Andersen 1 Fra den 6. uges statistikundervisning:

Læs mere

Design til digitale kommunikationsplatforme-f2013

Design til digitale kommunikationsplatforme-f2013 E-travellbook Design til digitale kommunikationsplatforme-f2013 ITU 22.05.2013 Dreamers Lana Grunwald - svetlana.grunwald@gmail.com Iya Murash-Millo - iyam@itu.dk Hiwa Mansurbeg - hiwm@itu.dk Jørgen K.

Læs mere

Patientinddragelse i forskning. Lars Henrik Jensen Overlæge, ph.d., lektor

Patientinddragelse i forskning. Lars Henrik Jensen Overlæge, ph.d., lektor Patientinddragelse i forskning Lars Henrik Jensen Overlæge, ph.d., lektor BMC Health Services Research 2014, 14:89 142 studies that described a spectrum of engagement Engagement was feasible in most settings

Læs mere

GUIDE TIL BREVSKRIVNING

GUIDE TIL BREVSKRIVNING GUIDE TIL BREVSKRIVNING APPELBREVE Formålet med at skrive et appelbrev er at få modtageren til at overholde menneskerettighederne. Det er en god idé at lægge vægt på modtagerens forpligtelser over for

Læs mere

Sustainable use of pesticides on Danish golf courses

Sustainable use of pesticides on Danish golf courses Indsæt nyt billede: Sustainable use of pesticides on Danish golf courses Anita Fjelsted - Danish EPA Ministry of the Environment 27 May 2015 - STERF The Danish Environmental Protection Agency 450 employees

Læs mere

Prioritering eller ej? Hvad er Konsekvensen? Jens Winther Jensen. Lægeforeningen

Prioritering eller ej? Hvad er Konsekvensen? Jens Winther Jensen. Lægeforeningen Prioritering eller ej? Hvad er Konsekvensen? Jens Winther Jensen Søren Kierkegaard Ikke at prioritere er også en prioritering! Offentligt sundhedsvæsen Politisk ledelse Demokratisk prioritering (ideal

Læs mere

Reviews 1997 1998 1999 2002 2002 2003 2008;

Reviews 1997 1998 1999 2002 2002 2003 2008; Reviews Rinck GC, van den Bos GA, Kleijnen J et al. Methodologic issues in effectiveness research on palliative cancer care: a systematic review. J Clin Oncol 1997; 15: 1697-1707. Smeenk FW, van Haastregt

Læs mere

Trolling Master Bornholm 2015

Trolling Master Bornholm 2015 Trolling Master Bornholm 2015 (English version further down) Sæsonen er ved at komme i omdrejninger. Her er det John Eriksen fra Nexø med 95 cm og en kontrolleret vægt på 11,8 kg fanget på østkysten af

Læs mere

Om smerteoplevelse, følelser og bevidsthed hos forskellige dyrearter.

Om smerteoplevelse, følelser og bevidsthed hos forskellige dyrearter. Om smerteoplevelse, følelser og bevidsthed hos forskellige dyrearter. Björn Forkman Institut for Produktionsdyr og Heste Københavns universitet Dyreværnsloven 1. Dyr skal behandles forsvarligt og beskyttes

Læs mere

Syllabus. On-Line kursus. POSitivitiES. Learning. Applied Positive Psychology for European Schools

Syllabus. On-Line kursus. POSitivitiES. Learning. Applied Positive Psychology for European Schools PositivitiES Applied Positive Psychology for European Schools POSitivitiES Positive European Schools On-Line kursus Learning This project has been funded with support from the European Commission.This

Læs mere

Titel: Hungry - Fedtbjerget

Titel: Hungry - Fedtbjerget Titel: Hungry - Fedtbjerget Tema: fedme, kærlighed, relationer Fag: Engelsk Målgruppe: 8.-10.kl. Data om læremidlet: Tv-udsendelse: TV0000006275 25 min. DR Undervisning 29-01-2001 Denne pædagogiske vejledning

Læs mere

Ekstraordinær Generalforsamling Vilvorde Kursuscenter 27. maj 2009

Ekstraordinær Generalforsamling Vilvorde Kursuscenter 27. maj 2009 Ekstraordinær Generalforsamling Vilvorde Kursuscenter 27. maj 2009 1 Safe Harbour Statement This presentation may contain forward-looking statements, including statements about our expectations of the

Læs mere

YNKB TEMA 6. Adventure Playgrounds Copenhagen 2003

YNKB TEMA 6. Adventure Playgrounds Copenhagen 2003 YNKB TEMA 6 YNKB TEMA 6-2003 Baldersgade 70 st tv DK 2200 N tlf +45 35851037 fax +45 35851837 www.ynkb.dk ISSN 1602-2815 Adventure Playgrounds Copenhagen 2003 The idea for adventure playgrounds originated

Læs mere

Domestic violence - violence against women by men

Domestic violence - violence against women by men ICASS 22 26 august 2008 Nuuk Domestic violence - violence against women by men Mariekathrine Poppel Email: mkp@ii.uni.gl Ilisimatusarfik University of Greenland Violence: : a concern in the Arctic? Artic

Læs mere

Bedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering

Bedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering Bedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering Titel (forfatter) Link til retningslinjen Resumé Klinisk retningslinje for anvendelse af kold fugtet kontra

Læs mere

Bilag. Resume. Side 1 af 12

Bilag. Resume. Side 1 af 12 Bilag Resume I denne opgave, lægges der fokus på unge og ensomhed gennem sociale medier. Vi har i denne opgave valgt at benytte Facebook som det sociale medie vi ligger fokus på, da det er det største

Læs mere

Tilladelse til vævscenter til håndtering af humane væv og celler Authorisation of tissue establishment for the handling of human tissues and cells

Tilladelse til vævscenter til håndtering af humane væv og celler Authorisation of tissue establishment for the handling of human tissues and cells Tilladelse til vævscenter til håndtering af humane væv og celler Authorisation of tissue establishment for the handling of human tissues and cells Sundhedsstyrelsen godkender hermed, at: The Danish Health

Læs mere

Kvant Eksamen December 2010 3 timer med hjælpemidler. 1 Hvad er en continuous variable? Giv 2 illustrationer.

Kvant Eksamen December 2010 3 timer med hjælpemidler. 1 Hvad er en continuous variable? Giv 2 illustrationer. Kvant Eksamen December 2010 3 timer med hjælpemidler 1 Hvad er en continuous variable? Giv 2 illustrationer. What is a continuous variable? Give two illustrations. 2 Hvorfor kan man bedre drage konklusioner

Læs mere

NÅR KØNSNORMERNE LARMER

NÅR KØNSNORMERNE LARMER NÅR KØNSNORMERNE LARMER - En kritisk diskursanalyse af, hvordan konstruktioner af maskulinitet influerer på unge mænds oplevelse af kærestevold Af: Amalie Frederikke Stender og Malene Laustsen Blædel Vejleder:

Læs mere

Studieopgave, den lille. Side 1 af 7

Studieopgave, den lille. Side 1 af 7 11.04.08 Susanne Graversen Conny Sønderby Karin Fosdal Studieopgave, den lille. Side 1 af 7 Indholdsfortegnelse: Baggrund for valg af emne. Problemformulering. Begrebsafklaring. Metode. Analyse. Konklusion.

Læs mere

Hvad sker der med den terapeutiske relation mellem patient og sundhedsfaglig person? Projekt om internetbaseret selvhjælps-behandling

Hvad sker der med den terapeutiske relation mellem patient og sundhedsfaglig person? Projekt om internetbaseret selvhjælps-behandling Hvad sker der med den terapeutiske relation mellem patient og sundhedsfaglig person? Projekt om internetbaseret selvhjælps-behandling Morten Fenger. Projektleder: Internetbaseret selvhjælpsterapi (www.e-psykiatri.dk)

Læs mere

Rettelse nr. / Correction no

Rettelse nr. / Correction no 2. december 2016 28. årgang SØKORTRETTELSER 47 DANISH CHART CORRECTIONS 2016 Rettelse nr. / Correction no. 503-521 Kort / Chart Rettelse nr. / Correction no. Kort / Chart Rettelse nr. / Correction no.

Læs mere

Velfærdsteknologi i det nordiske samarbejde Seniorrådgiver Dennis C. Søndergård, Nordens Velfærdscenter

Velfærdsteknologi i det nordiske samarbejde Seniorrådgiver Dennis C. Søndergård, Nordens Velfærdscenter TROMSØ 2015 Velfærdsteknologi i det nordiske samarbejde Seniorrådgiver Dennis C. Søndergård, Nordens Velfærdscenter 18-06-2015 Nordic Centre for Welfare and Social Issues 1 Nordisk Ministerråd Blandt verdens

Læs mere

applies equally to HRT and tibolone this should be made clear by replacing HRT with HRT or tibolone in the tibolone SmPC.

applies equally to HRT and tibolone this should be made clear by replacing HRT with HRT or tibolone in the tibolone SmPC. Annex I English wording to be implemented SmPC The texts of the 3 rd revision of the Core SPC for HRT products, as published on the CMD(h) website, should be included in the SmPC. Where a statement in

Læs mere

Bookingmuligheder for professionelle brugere i Dansehallerne 2015-16

Bookingmuligheder for professionelle brugere i Dansehallerne 2015-16 Bookingmuligheder for professionelle brugere i Dansehallerne 2015-16 Modtager man økonomisk støtte til et danseprojekt, har en premieredato og er professionel bruger af Dansehallerne har man mulighed for

Læs mere

Childhood motor performance as predictor of physical activity and physical activity related injuries

Childhood motor performance as predictor of physical activity and physical activity related injuries Childhood motor performance as predictor of physical activity and physical activity related injuries The Childhood Health, Activity and Motor Performance School Study- DK The CHAMPS Study- DK Lisbeth Runge

Læs mere

BUTIK, KAFFEBAR ELLER CAFE. Nørrebrogade 45A, 2200 København N Sag 163791R (HT)

BUTIK, KAFFEBAR ELLER CAFE. Nørrebrogade 45A, 2200 København N Sag 163791R (HT) BUTIK, KAFFEBAR ELLER CAFE Nørrebrogade 45A, 2200 København N Sag 163791R (HT) BELIGGENHED Ejendommen er beliggende på hjørnet af Nørrebrogade/Stengade i et af Københavns mest trendy områder med kaffebarer,

Læs mere

NOTIFICATION. - An expression of care

NOTIFICATION. - An expression of care NOTIFICATION - An expression of care Professionals who work with children and young people have a special responsibility to ensure that children who show signs of failure to thrive get the wright help.

Læs mere

DONG-område Resten af landet

DONG-område Resten af landet TDC A/S regulering@tdc.dk Fremsendes alene via mail Tillægsafgørelse vedrørende fastsættelse af priser for BSA leveret via TDC s fibernet 1 Indledning traf fredag den 15. april 2011 LRAIC-prisafgørelse

Læs mere

To the reader: Information regarding this document

To the reader: Information regarding this document To the reader: Information regarding this document All text to be shown to respondents in this study is going to be in Danish. The Danish version of the text (the one, respondents are going to see) appears

Læs mere

Climate adaptation in Denmarkand a groundwater dilemma

Climate adaptation in Denmarkand a groundwater dilemma Climate adaptation in Denmarkand a groundwater dilemma Rolf Johnsen www.regionmidtjylland.dk Challenges with water Denmark 10-40% Precipitation ½-1m Sea level change 5-15 % Increase in runoff 0-2 m Groundwater

Læs mere

Shared space - mellem vision og realitet. - Lyngby Idrætsby som case

Shared space - mellem vision og realitet. - Lyngby Idrætsby som case Downloaded from orbit.dtu.dk on: Jan 27, 2017 Shared space - mellem vision og realitet. - Lyngby Idrætsby som case Brinkø, Rikke Publication date: 2015 Document Version Peer-review version Link to publication

Læs mere

Den uddannede har viden om: Den uddannede kan:

Den uddannede har viden om: Den uddannede kan: Den uddannede har viden om: Den uddannede kan: Den uddannede kan: Den studerende har udviklingsbaseret viden om og forståelse for Den studerende kan Den studerende kan Den studerende har udviklingsbaseret

Læs mere

4. Oktober 2011 EWIS

4. Oktober 2011 EWIS 4. Oktober 2011 EWIS EWIS 1.Hvad betyder EWIS 2.Historien bag bestemmelserne 3.Implementering i Part M / 145 4.Konklusion Hvad er EWIS Electrical Wiring Interconnection System Men i denne sammenhæng: Særlig

Læs mere

Hvad kan gøres? "Blandingsmisbrug"

Hvad kan gøres? Blandingsmisbrug Blandingsmisbrug Hvad kan gøres? Fred Glæde Frihed Pause Problemer Sygdom Skade Holdning Fordømmelse Accept Billigelse Tilvænning Afhængighed Abstinenser Visse farmaka kræver ved længerevarende brug større

Læs mere

Elektriske apparater forbundet til vandforsyningen Undgåelse af tilbagesugning og fejl på slangesæt

Elektriske apparater forbundet til vandforsyningen Undgåelse af tilbagesugning og fejl på slangesæt Dansk standard Rettelsesblad DS/EN 61770/Corr. Mar. 2011 1. udgave 2011-04-06 COPYRIGHT Danish Standards. NOT FOR COMMERCIAL USE OR REPRODUCTION. DS/EN 61770/Corr. Mar. 2011:2011 Elektriske apparater forbundet

Læs mere

Mindfulness. At styrke trivsel, arbejde og ledelse

Mindfulness. At styrke trivsel, arbejde og ledelse Mindfulness At styrke trivsel, arbejde og ledelse Energiregnskabet Mindfulness i forsikringsvirksomhed 100 % har fået anvendelige redskaber til håndtering af stress 93 % oplever en positiv forandring

Læs mere

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen The X Factor Målgruppe 7-10 klasse & ungdomsuddannelser Engelskundervisningen Læringsmål Eleven kan give sammenhængende fremstillinger på basis af indhentede informationer Eleven har viden om at søge og

Læs mere

Afbestillingsforsikring

Afbestillingsforsikring Afbestillingsforsikring Sygdomsafbestillingsforsikring ved akut sygdom, ulykke. Da afbestilling på grund af akut sygdom, ulykke m.m. ikke fritager deltagerne for betaling, kan det anbefales, at der tegnes

Læs mere

Eksempel på eksamensspørgsmål til caseeksamen

Eksempel på eksamensspørgsmål til caseeksamen Eksempel på eksamensspørgsmål til caseeksamen Engelsk niveau E, TIVOLI 2004/2005: in a British traveller s magazine. Make an advertisement presenting Tivoli as an amusement park. In your advertisement,

Læs mere

Medinddragelse af patienter i forskningsprocessen. Hanne Konradsen Lektor, Karolinska Institutet Stockholm

Medinddragelse af patienter i forskningsprocessen. Hanne Konradsen Lektor, Karolinska Institutet Stockholm Medinddragelse af patienter i forskningsprocessen Hanne Konradsen Lektor, Karolinska Institutet Stockholm Værdi eller politisk korrekt (formentlig krav i fremtidige fondsansøgninger) Hurtigere, effektivere,

Læs mere

Trolling Master Bornholm 2016 Nyhedsbrev nr. 6

Trolling Master Bornholm 2016 Nyhedsbrev nr. 6 Trolling Master Bornholm 2016 Nyhedsbrev nr. 6 English version further down Johnny Nielsen med 8,6 kg laks Laksen blev fanget seks sømil ud for Tejn. Det var faktisk dobbelthug, så et kig ned i køletasken

Læs mere

Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk

Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk Medborgerskabets fire dimensioner (ifølge G. Delanty, 2000) Rettigheder Pligter Deltagelse

Læs mere

BILAG 8.1.B TIL VEDTÆGTER FOR EXHIBIT 8.1.B TO THE ARTICLES OF ASSOCIATION FOR

BILAG 8.1.B TIL VEDTÆGTER FOR EXHIBIT 8.1.B TO THE ARTICLES OF ASSOCIATION FOR BILAG 8.1.B TIL VEDTÆGTER FOR ZEALAND PHARMA A/S EXHIBIT 8.1.B TO THE ARTICLES OF ASSOCIATION FOR ZEALAND PHARMA A/S INDHOLDSFORTEGNELSE/TABLE OF CONTENTS 1 FORMÅL... 3 1 PURPOSE... 3 2 TILDELING AF WARRANTS...

Læs mere

SEPA Direct Debit. Mandat Vejledning 2013.03.15. Nets Lautrupbjerg 10 DK-2750 Ballerup

SEPA Direct Debit. Mandat Vejledning 2013.03.15. Nets Lautrupbjerg 10 DK-2750 Ballerup SEPA Direct Debit Mandat Vejledning 2013.03.15 Nets Lautrupbjerg 10 DK-2750 Ballerup Indholdsfortegnelse 1. Indledning... 3 1.1 Tilknyttet dokumentation... 3 1.2 Kontakt til Nets... 3 2. Krav til SEPA

Læs mere

Dårlig litteratur sælger - Trykkekultur i 1800-tallets Storbritannien og idag. Maria Damkjær Post.doc. i Engelsk Litteratur

Dårlig litteratur sælger - Trykkekultur i 1800-tallets Storbritannien og idag. Maria Damkjær Post.doc. i Engelsk Litteratur Dårlig litteratur sælger - Trykkekultur i 1800-tallets Storbritannien og idag Maria Damkjær Post.doc. i Engelsk Litteratur Horace Engdahl i interview i Politiken Bøger, 7. december 2014: [Hos os i Norden]

Læs mere

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus Developing a tool for searching and learning - the potential of an enriched end user thesaurus The domain study Focus area The domain of EU EU as a practical oriented domain and not as a scientific domain.

Læs mere

Bilag 1: Ekspertinterview m. Karen Sjørup

Bilag 1: Ekspertinterview m. Karen Sjørup Bilag 1: Ekspertinterview m. Karen Sjørup Vi har haft en mailkorrespondance med Lektor fra Roskilde Universitet Karen Sjørup, hvoraf vi har anvendt en række citater. Denne vil fremgå i det følgende afsnit.

Læs mere

16/01/15. Forsøg med læring i bevægelse

16/01/15. Forsøg med læring i bevægelse WORKSHOP: EMBODIMENT NÅR KROPPEN ER MED I LÆREPROCESSEN Jørn Dam - Brian Olesen, Mona Petersen, Dorthe Kvetny, Lise Rasmussen Midtsjællands Gymnasium, Haslev 16/01/15 Embodiment - som pædagogisk, didaktisk

Læs mere

Bias og confounding. Søren Kold, overlæge, ph.d., klinisk lektor Aalborg Universitetshospital

Bias og confounding. Søren Kold, overlæge, ph.d., klinisk lektor Aalborg Universitetshospital Bias og confounding Søren Kold, overlæge, ph.d., klinisk lektor Aalborg Universitetshospital Bias og confounding Kritisk litteraturlæsning Introduktion Øvelse Information 5 min. Gruppearbejde 20 min. Diskussion

Læs mere

DK - Quick Text Translation. HEYYER Net Promoter System Magento extension

DK - Quick Text Translation. HEYYER Net Promoter System Magento extension DK - Quick Text Translation HEYYER Net Promoter System Magento extension Version 1.0 15-11-2013 HEYYER / Email Templates Invitation Email Template Invitation Email English Dansk Title Invitation Email

Læs mere

How consumers attributions of firm motives for engaging in CSR affects their willingness to pay

How consumers attributions of firm motives for engaging in CSR affects their willingness to pay Bachelor thesis Institute for management Author: Jesper Andersen Drescher Bscb(sustainability) Student ID: 300545 Supervisor: Mai Skjøtt Linneberg Appendix for: How consumers attributions of firm motives

Læs mere

Statistik for MPH: oktober Attributable risk, bestemmelse af stikprøvestørrelse (Silva: , )

Statistik for MPH: oktober Attributable risk, bestemmelse af stikprøvestørrelse (Silva: , ) Statistik for MPH: 7 29. oktober 2015 www.biostat.ku.dk/~pka/mph15 Attributable risk, bestemmelse af stikprøvestørrelse (Silva: 333-365, 381-383) Per Kragh Andersen 1 Fra den 6. uges statistikundervisning:

Læs mere

FAST FORRETNINGSSTED FAST FORRETNINGSSTED I DANSK PRAKSIS

FAST FORRETNINGSSTED FAST FORRETNINGSSTED I DANSK PRAKSIS FAST FORRETNINGSSTED FAST FORRETNINGSSTED I DANSK PRAKSIS SKM2012.64.SR FORRETNINGSSTED I LUXEMBOURG En dansk udbyder af internet-spil ønsker at etablere et fast forretningssted i Luxembourg: Scenarier:

Læs mere

SmartDock for Xperia ion Brugervejledning

SmartDock for Xperia ion Brugervejledning SmartDock for Xperia ion Brugervejledning Indholdsfortegnelse Indledning...3 Oversigt over SmartDock...3 Opladning med SmartDock...3 Kom godt i gang...5 LiveWare -administration...5 Opgradering af LiveWare

Læs mere

SPIRITUAL CARE FORSKNINGSMÆSSIGE UDFORDRINGER PH.D.-STIPENDIAT HANNE BESS BOELSBJERG

SPIRITUAL CARE FORSKNINGSMÆSSIGE UDFORDRINGER PH.D.-STIPENDIAT HANNE BESS BOELSBJERG SPIRITUAL CARE FORSKNINGSMÆSSIGE UDFORDRINGER PH.D.-STIPENDIAT HANNE BESS BOELSBJERG UDFORDRINGERNE Definitoriske: Hvad har vi med at gøre? Metodiske: Hvordan undersøger vi det? Etiske: Hvordan får vi

Læs mere

1. Formål og mål med indførelsen af værktøjet

1. Formål og mål med indførelsen af værktøjet 1. Formål og mål med indførelsen af værktøjet Afdæk og fastlæg, hvad der driver projektet Identificer langsigtede virksomhedsmål Fastlæg implementeringens centrale leverancer Prioriter og planlæg delmål

Læs mere

Evaluering af Master in Leadership and Innovation in Complex Systems

Evaluering af Master in Leadership and Innovation in Complex Systems Evaluering af Master in Leadership and Innovation in Complex Systems På masteruddannelsen i Leadership and Innovation in Complex Systems blev der i efteråret 2009 udbudt undervisning i følgende to moduler:

Læs mere

Tork Aftørringspapir Standard, M1. Fordel. Produktspecifikation. Beskrivelse. Farve: Hvid Type: Mini Centerfeed Rulle

Tork Aftørringspapir Standard, M1. Fordel. Produktspecifikation. Beskrivelse. Farve: Hvid Type: Mini Centerfeed Rulle Fordel Allround aftørringspapir Ideel til rengøring af glas Velegnet til håndaftørring Godkendt til kontakt med fødevarer Tork Easy Handling, emballage som er let at løfte, åbne og folde sammen, når du

Læs mere

Chengdu FASE 2 - VALGMODUL KINA INFORMATION, VEJLEDNING OG DOKUMENTER

Chengdu FASE 2 - VALGMODUL KINA INFORMATION, VEJLEDNING OG DOKUMENTER Chengdu FASE 2 - VALGMODUL KINA INFORMATION, VEJLEDNING OG DOKUMENTER FASE 2 - INFORMATION, VEJLEDNING OG DOKUMENTER INFORMATION, VEJLEDNING OG DOKUMENTER Vi behandler de indkomne ansøgninger hurtigst

Læs mere

Krisehåndtering og ledelse i forbindelse med kritiske hændelser. Rikke Høgsted Chefpsykolog Falck Healthcare Samarbejdspartner med Seahealth Denmark

Krisehåndtering og ledelse i forbindelse med kritiske hændelser. Rikke Høgsted Chefpsykolog Falck Healthcare Samarbejdspartner med Seahealth Denmark Krisehåndtering og ledelse i forbindelse med kritiske hændelser Rikke Høgsted Chefpsykolog Falck Healthcare Samarbejdspartner med Seahealth Denmark The responsibility or the legal obligation of a person

Læs mere

Aarhus Universitet Business and Social Sciences AU Herning Birk Centerpark 15, 7400 Herning Forsynings og værdikæder, optimering, kvalitet og ledelse

Aarhus Universitet Business and Social Sciences AU Herning Birk Centerpark 15, 7400 Herning Forsynings og værdikæder, optimering, kvalitet og ledelse Aarhus Universitet Business and Social Sciences AU Herning Birk Centerpark 15, 7400 Herning Fagmodulets navn Forsynings og værdikæder, optimering, kvalitet og ledelse Udbydende retning samt kursuskode

Læs mere

Sammenligning af adresser til folkeregistrering (CPR) og de autoritative adresser

Sammenligning af adresser til folkeregistrering (CPR) og de autoritative adresser Sammenligning af adresser til folkeregistrering (CPR) og de autoritative adresser Comparison of addresses used in the population register and the authentic addresses Side 1 Formål Purpose Undersøge omfanget

Læs mere

The Thesis M.Sc. In Technical IT (Civilingeniør)

The Thesis M.Sc. In Technical IT (Civilingeniør) 27. OCTOBER The Thesis M.Sc. In Technical IT (Civilingeniør) Electrical Engineering and ICT Who are we? Henrik Karstoft (hka@iha.dk) Ingeniørdocent @ASE, Leading the group in Signal Processing and Control@ASE/EICT

Læs mere

Håndhygiejne: Nye løsninger på et gammelt problem?

Håndhygiejne: Nye løsninger på et gammelt problem? Håndhygiejne: Nye løsninger på et gammelt problem? v/ Professor, overlæge dr.med. Jens Kjølseth Møller Klinisk mikrobiologisk afdeling, Sygehus Lillebælt, Vejle Sygehus Hvad ved vi om Håndhygiejne og Adfærd?

Læs mere

Profilbeskrivelse for Marketing, Globalisering og Kommunikation Marketing, Globalization and Communication

Profilbeskrivelse for Marketing, Globalisering og Kommunikation Marketing, Globalization and Communication Profilbeskrivelse for Marketing, Globalisering og Kommunikation Marketing, Globalization and Communication Bilag til studieordningen for kandidatuddannelsen i erhvervsøkonomi (cand.merc.) Odense 2009 1

Læs mere

You decide if the examination will be held in Danish or in English. Censor is Dr. Peter Westermann, BioCentrum, Technical University of Denmark.

You decide if the examination will be held in Danish or in English. Censor is Dr. Peter Westermann, BioCentrum, Technical University of Denmark. Advanced Bacteriology 2007 Questions for final exam The final exam will take place Thursday November 1 2007 in Øvelsessal II, Sølvgade 83H (Øvelsessal II is found behind Øvelsessal III where teaching took

Læs mere

Forskningsbasering: Hvad sker der når et universitet vil sætte ord og handling bag?

Forskningsbasering: Hvad sker der når et universitet vil sætte ord og handling bag? Forskningsbasering: Hvad sker der når et universitet vil sætte ord og handling bag? Mogens Hørder Syddansk Universitet Kongelige Danske Videnskabernes Selskab Forskningspolitisk årsmøde 22 marts 2011 På

Læs mere

Bilag 1 GPS dataudskrifter fra Stena Carisma ved passage af målefelt

Bilag 1 GPS dataudskrifter fra Stena Carisma ved passage af målefelt Bilag 1 GPS dataudskrifter fra Stena Carisma ved passage af målefelt Passage 1 Passage 2 Passage 3 Passage 4 Passage 5 27 Bilag 2 Engelsk beskrivelse af S4-måleren InterOcean S4 Current Meter The S4 Electromagnetic

Læs mere

EPIDEMIOLOGI MODUL 7. April Søren Friis Institut for Epidemiologisk Kræftforskning Kræftens Bekæmpelse DAGENS PROGRAM

EPIDEMIOLOGI MODUL 7. April Søren Friis Institut for Epidemiologisk Kræftforskning Kræftens Bekæmpelse DAGENS PROGRAM EPIDEMIOLOGI MODUL 7 April 2007 Søren Friis Institut for Epidemiologisk Kræftforskning Kræftens Bekæmpelse DAGENS PROGRAM Selektionsbias et par udvalgte emner Confounding by indication Immortal time bias

Læs mere

(Text with EEA relevance)

(Text with EEA relevance) 24.4.2015 EN Official Journal of the European Union L 106/79 COMMISSION IMPLEMENTING DECISION (EU) 2015/646 of 23 April 2015 pursuant to Article 3(3) of Regulation (EU) No 528/2012 of the European Parliament

Læs mere

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22.

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22. Bøger på engelsk How Al-Anon Works - for Families & Friends of Alcoholics Al-Anons grundbog på engelsk, der indfører os i Al- Anon programmet. Om Al-Anons historie, om forståelse af os selv og alkoholismen.

Læs mere

USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION

USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION P E R H E I S E L BERG I N S T I T U T F OR BYGGERI OG A N L Æ G BEREGNEDE OG FAKTISKE FORBRUG I BOLIGER Fra SBi rapport 2016:09

Læs mere

- Få mest muligt ud af opgaveskrivningen!

- Få mest muligt ud af opgaveskrivningen! - Få mest muligt ud af opgaveskrivningen! En eksamensopgave Forarbejdet Opgaveformuleringen Disposition og layout Dokumentation Selvstændighed Abstract Vurderingskriterier Alle regler står i pjecen om

Læs mere

Better driving experience guaranteed!

Better driving experience guaranteed! MAXIMUM RESPONCE Pedalbox, Dynamisk - BEDRE RESPONSE - Flere program trin MAXIMUM RESPONCE Better driving experience guaranteed! Pedalbox, Dynamisk - BEDRE RESPONSE - Flere program trin For at forbedre

Læs mere

Danskernes reaktion påde norske retningslinjer

Danskernes reaktion påde norske retningslinjer Danskernes reaktion påde norske retningslinjer Lars Merinder: psykiater, ph.d. og daglig leder i videnscenter for rusmiddelpsykiatri Lotte Sønderby: psykolog og mpa. Konstituteret formand i Dansk Fagligt

Læs mere

CDIO CONCEIVE, DESIGN, IMPLEMENT, OPERATE - ELLER - UDDANNELSE PÅ INGENIØROMRÅDET

CDIO CONCEIVE, DESIGN, IMPLEMENT, OPERATE - ELLER - UDDANNELSE PÅ INGENIØROMRÅDET 22. NOVEMBER 2012 CDIO CONCEIVE, DESIGN, IMPLEMENT, OPERATE - ELLER - UDDANNELSE PÅ INGENIØROMRÅDET JENS BENNEDSEN INGENIØRDOCENT, LEDER CDL CDL cdio Dev lab HVORFOR? Personlige og sociale kompetencer

Læs mere