Når$kilderne$tier$,$en$undersøgelse$af$journalistens$ praksis$

Save this PDF as:
 WORD  PNG  TXT  JPG

Størrelse: px
Starte visningen fra side:

Download "Når$kilderne$tier$,$en$undersøgelse$af$journalistens$ praksis$"

Transkript

1 Når$kilderne$tier$,$en$undersøgelse$af$journalistens$ praksis$! Gruppenummer:!6! Fag!og!semester:!Journalistik$F2015! Vejleder:!Mikkel$Prytz! Et!projekt!udarbejdet!af:! Maria$Bülow$Bach,$Pernille$Germansen,$$ Daniel$Stolzenbach$Jensen,$Mads$Kieler$og$$ Anneliese$Leithoff$Christensen$ Antal!anslag:! !!!

2 Abstract Silent political sources are a challenge for the journalistic ideal of journalism as the Fourth Estate. It seems to conflict with the self image of the journalist and conflict with the practices of the newsroom. How do the journalists handle this challenge of their ideals? How can it be affected by the practices of the newsroom? And further, how might it affect which issues will be salient on the media agenda, the public agenda, and the political agenda. This project examines the thesis statement: How do journalists handle political sources, who will not answer, and how can it affect the agenda of the media? In order to investigate this thesis statement, the project uses a qualitative method by interviewing four journalists from three different Danish newspapers. To analyze this empirical data the project implicates theory about the relationship between journalists and their sources by the Danish media theorist Nete Nørgaard Kristensen and agenda-setting theory by the American professor of journalism Maxwell McCombs and professor James W. Dearing and communication scholar Everett M. Rogers. The project concludes that the journalists use four different tactics to handle silent sources. Furthermore that journalists and their political sources enter a relationship based on the exchange of information and exposure and that both parties in this relationship seem to be able to affect the agenda of the media.

3 ! 1.2-Problemfelt-og-problemformulering-...-1! Indholdsfortegnelse- 1.-Indledning Introduktion Begrebsafklaring Metode-og-teori Vores-udgangspunkt Udvælgelse-af-interviewpersoner Forberedelse-til-interviewsituationen Interviewsituationen-og-efterrefleksioner Teoretisk-ramme ! 3.-Operationalisering-af-analyse-og-diskussion Analyse Forholdet-mellem-journalist-og-kilde !Bytteforholdet!...!15! 4.1.3!Modspil!...!18! 4.1.4!Håndtering!af!kilder,!der!ikke!svarer!...!22! !Udskydelse!af!artiklens!deadline!...!23!! !Artiklens!placering!i!avisen!...!24!! !At!være!i!besiddelse!af!dokumentation,!som!er!kritisk!for!kilden!...!25!! !At!skrive! ingen!kommentarer!i!artiklen!...!26!!! ! Ingen!kommentarer!som!afpresningsmiddel!...!29!! !Opsummering!...!29! 4.2-Det-journalistiske-narrativ !Den!stædige!journalist!...!30! 4.2.2!Forestillingen!om!den!fjerde!statsmagt!...!32! 4.2.3!Magtesløshed!og!den!journalistiske!offerrolle!...!34! 4.2.4!Opsummering!...!35! 4.3-Redaktionelle-forhold !Deadline!og!nyhedsstrøm!...!36!

4 ! 4.3.2!Journalisterne!definerer!tidsrammen!...!37! 4.3.3!Forståelsen!af!den!journalistiske!praksis!...!39! 4.3.4!Opsummering!...!41!! 5.-Diskussion Bytteforhold-og-agendaOsetting Den-redaktionelle-praksis-som-dagsordensætter Opsummering-af-diskussion Konklusion ! 7.-Litteraturliste !!!!!!!!

5 Indledning( Introduktion( Justitsministeren!har!ikke!ønsket!at!kommentere!sagen!over!for!Berlingske, Information! har!forgæves!forsøgt!at!indhente!en!kommentar,!men!uden!held.sætningersomdisseer ikkeualmindeligeidedanskedagblade,nårpolitiskesagerbliverdækketaf journalister,derforsøgeratleveoptilderesfagsideal.etidealom,atjournalistikken skalfungeresomdemokratietsvagthundogdenfjerdestatsmagt. Idenneundersøgelsevilvidykkenedijournalistenspraksisogundersøge,hvordan journalistenhåndterertavsepolitiskekilder,samtanalysereogdiskutere,hvilken betydningdetteharfordagsordenenimedierne. Problemfelt(og(problemformulering( Ifølgendeafsnitvilmotivationenbagvoresprojektogproblemformuleringblive præsenteret.førstvilvibeskrivevoresegenundrenforefterfølgendeatsepå spørgsmåletietfagligtperspektiv.afslutningsvisvilproblemformuleringenblive præsenteret. Voresmotivationfordetteprojektbaserersigpåflerekonkreteoplevelserivores artikelproduktionomsjælsmarkudrejsecenter.artiklerneblevudarbejdetiforbindelse medvoresbachelorprojekt.kontaktenmedkilderneoverraskedeospåflereområder. Særligtdenpolitiskekildegavanledningtilflerefrustreredestunder,hvorderes lukkethediforholdtilatgiveenkommentarsattevoresjournalistisketålmodighedog ærgerrighedpåenprøve. Førstogfremmeststødteoftevipåenpresseafdeling,derafvisteatgiveosadgangtilde politiskekilder.inogletilfældelykkedesdetatkommeigennemtilkildenefterflere ihærdigeforsøg,mensviiandretilfældemåttelæggerøretpåudensuccesmedatfå politikerenitale.dervistesigdogogsåatværeenmellemvej,hvorvimåttenøjesmed etmailsvarfrapolitikeren.etmailsvar,somvirkedeensmulevagt,ogsomikkegavos! 1/53

6 mulighedforatstilleopfølgendespørgsmål.ienandensituationforsøgtevioverflere dageatfåenkommentarfraenminister.vikomtætpå,daviunderstregedeoverfor pressemedarbejderen,atvivilleforsøgeatfåvoresartiklertryktietstørredansk dagblad,mentilsidstafvistededogatdeltage.disseformerforkildekontaktsattegang iflerediskussionervedrørendeforholdetmellemjournalisterogkilder.erforholdet ligevægtigt,ellererdertaleometuligemagtforhold,hvorpolitiskekilderkanpræge mediedagsordenenienbestemtretning,hvisikkedeviludtalesig?oghvadbetyderdet formediedagsorden,hvisvigtigeinformationerudelades? Dereridisseåretøgetprespåjournalistikken,bådeøkonomiskogtidsmæssigt,og samtidigogsåenprofessionaliseringafkilderne,hvorpresseafdelingerogprqafdelinger blivermereogmereudbredt.detheltcentralespørgsmål,derrejsersigforos,er:kan dissefaktorerhaveindflydelsepå,hvemderegentligsættermediedagsordenenog dermedpåvirkerdenpolitiskeogdenoffentligedagsorden?ogkanmanspekulerei,om journalisterogkilderanvenderbestemtegrebforatsættemediedagsordenen?disse spørgsmålliggertilgrundfordenfølgendeundersøgelse. MedieforskerNeteNørgaardKristensensbeskriverisinundersøgelseibogen Journalister!og!kilder!9!slinger!i!valsen?,hvordanetudvalgafjournalisterfortæller,at kildererblevetmereprofessionaliseredegennemdetsenesteårti.derudoverbeskriver hun,atdeoplever,atdetsærligterpolitikere,somagerermereprofessioneltendførhen (Kristensen,2004:172ff).Itaktmeddenstigendeprofessionaliseringmådetforventes, atpolitikereihøjeregraderopmærksommepå,hvilkesager,somerværdathavei medierneqogsærligthvilke,derikkeer.derforkanensprogligvendingsom ingen kommentarer forekommemerehyppigt,dadenkanværeentaktikikampenomat læggeenhistoriened.dettepåpegerboelkjærienartikelpåjournalisten.dk,cavling9 vinder:!vi!skal!ikke!respektere! ingen!kommentarer,!hvorhanblandtandetudtaler: (...) der!ligger!også!et!demokratisk!problem!i,!at!politikerne!kan!gøre!stort!set,!hvad!der!passer! dem!for!at!fortie!noget!eller!dysse!en!sag!ned,ogfortællervidere: Enhver!med!adgang!til!Infomedia!kan!tjekke,!hvor!mange!artikler,!der!indeholder! formuleringen! ingen!kommentarer.!i!virkeligheden!synes!jeg,!man!skal!regulere,!så!! 2/53

7 pressens!adgang!til!politikerne!bliver!styrket.!det!er!for!let!at!sige! ingen! kommentarer (journalisten.dk,2015).!! Derersynesaltsåatværeetproblemiforholdetmellemjournalisterogkilder,hvorden stigendeprofessionaliseringudfordrerjournalistikkensrolleidemokratiet.enrolle,der indebæreratstillekritiskespørgsmåltildepolitiskebeslutningstagerepåborgerens vegne.etandetaspekt,derbidragertildetændredekildeforhold,erarbejdsbyrdenog tidsrammenfordetjournalistiskearbejde.deter,somkultursociologfinnrasmussen påpegerihansbogmassemedier!og!politisk!kommunikation,blevetnemmereatslippe afstedmedenudtalelsesom ingenkommentar,daderikkeertidogressourcertilat opfølge: Arbejdsbyrden!blandt!journalister!bliver!større!og!derfor!vælger!de!de!sikre!kilder,! og!der!er!mindre!tid!til!den!enkelte!historie.!journalisten!bliver!dermed!mere! afhængig!af!information!udefra.!undersøgende!journalistik!vil!der!være!mindre!tid! til (Rasmussen,2012:108).! Derforkanmanfrygte,atdetsomprofessionelkildeogaktørkanværesmartatlukke enuvelkommenhistorienedvedattie,dajournalistenhverkenhartidellerressourcer tilatgåhårderetilkildenoghistorien.dettekansessomsærligproblematisk,da dagsordenenimedierne,ifølgeagendaqsettingteorien,ihøjgradpåvirker,hvilkeemner befolkningenharenholdningtil,oghvadderesholdninger.maxwellmccombsskriver omkonsekvensernevedagendaqsetting,påvirkermansomafsenderenbestemt holdningtilenellerflereoffentligeemner(mccombs,2005:123).derforkandet muligvisværeoplagtforpolitiskekilderatudvælge,hvilkesagermanviludtalesigi,og hvilkemanikkevil,daennegativsagkanhavekonsekvenserfortroværdigheden.dette kanudviklesigtil,atkilderneidissesammenhængestårmedmagtentilatsætte dagsordenen,hvisikkejournalistensomafsenderkanfølgeoppåhistorien,hvilketkan ligneenudfordringafbalanceniforholdetmellemdetoparter.disseoplevelserog denneudviklingijournalistensarbejdsgangvilviundersøgenærmereudfrafølgende problemformulering: Hvordan)håndterer)journalister)politiske)kilder,)som)ikke)svarer,)og)hvordan) kan)det)påvirke)dagsordenen)i)medierne? )! 3/53

8 Begrebsafklaring(( Daviivoresproblemformuleringgørbrugafudtrykket politiskekilder,findervidet relevantatpræcisere,hvaddermenesmeddette.nårviiprojektetnævnerpolitiske kilder,skaldetforstås,atderunderdettebegrebmeneshenholdsvispolitikere,både lokaleoglandspolitiske,pressemedarbejderesamtministerier.dereraltsåtaleom personer,somerendelafdetpolitiskesystemogdermedogsåpartskilderindenfor politik.deterkilder,somerendelafdenpolitiskebeslutningstagen.derudovererdet vigtigtatslåfast,atnårderskrives kilder iprojektet,dækkerdetoverbegrebet politiskekilder. ) )! 4/53

9 Metode(og(teori( Vores(udgangspunkt( Vibevægerosindenforenkompleksproblemstilling,hvormangekomponenterspiller indpåbådejournalistenspraksissåvelsompådenherskendemediedagsorden.vores interviewpersonersfortællingom,hvordandeoplevergivnesituationer,bliverpåvirket afmangefaktorer,åbenlysesåvelsomskjulte.detkanværeforholdetmellemkilderog journalister,pressetfraredaktører,økonomi,detjournalistiskeselvbilledemedmere. Vivælgerderfordetkvalitativeinterviewsomvoresmetode,fordiviikkeønskeren kvantificeringafvoresproblemstilling,menderimodendybereforståelseaf kompleksitetenidenne. IvoresundersøgelseanvendervidetoforskereMargarethaJärvinenogNannaMikQ Meyersinteraktionistiskemetodetilinterviewmedudgangspunktideresbog Kvalitative!metoder!i!et!interaktionistisk!perspektiv.Detinteraktionistiskeperspektiv indebærerenkontruktivistiskqinteraktionistisktilgangtilinterview.etinterviewkan, ifølgejärvinenogmikqmeyer,ikkeblotreducerestilensituation,hvorenperson videregiverinformationentilenandenperson,menerderimodetsocialtmødemellem topersonersforudsætningerogholdninger.dermedbliverinterviewetsslutmaterialeet resultatafengensidigdialog(järvinen,2005:29).viserpåinterviewets hvordan som enforudsætningforinterviewet hvad.vitagerderforinterviewsituationensbetydning forproduktetmedivoresovervejelser. VedbrugafdenkonstruktivistiskQinteraktionistiskeinterviewmetodeskriverviosindi enkonstruktivistisktilgang,somsiger,atsocialefænomenerogderesbetydninger kontinuerligtbliverskabtgennemsocialeaktører(bryman,2012:33).foratforståde socialefænomener,deropståridialogenmeddeudvalgteinterviewpersoner,bliverdet interaktionistiskeperspektivbrugtsomteoriianalysen.vorestilgangvilaltsåminde omenfænomenologisktilgang,menistedetforatseinterviewpersonensometstatisk analyseobjekt,somkendetegnerfænomenologien,servianalyseobjektetsomen flydendestørrelse,deropståridensocialekontekstogdialog.teorienvilaltsåblive brugttilatforklareoganalysereempirienfordermedatkunnenåfremtilenforklaring! 5/53

10 på,hvaddetbetyderfordenjournalistiskepraksisogdagsordenenimedierne,at politiskekilderikkesvarer. Udvælgelse(af(interviewpersoner( Iforbindelsemedvoresundersøgelseharviinterviewetfirejournalister.Disse interviewsdannerdetempiriskegrundlagforvoresprojekt.defirejournalisterer følgende: RuneWolfhagen,DagbladetInformation JulieElmhøj,DagbladetInformation NikolajHeltoft,Politiken AndersBæksgaard,BerlingskeTidende ViudvalgtevoresinterviewpersonervedatforetageensøgningpåInfomediamedet tidsintervaloverdesenestetolvmåneder.søgningenomhandledeartikler,hvordetblev ekspliciteret,atenpolitiskkildeikkestilledeoptilenkommentar.detteblevgjortmed henblikpåatfindekandidater,dervillekendetiloghaveenforholdsvisfriskerindring omenkonkretsituation,hvorenkildeikkeharønsketatudtalesig. Denneudvælgelsesprocesvarihøjgradprægetaftidsrammenforprojektet,ogafhvor mangesvarvifiktilbage.påforhåndhavdevisatetmaksimaltantalkilderpå,som beløbsigpåseksinterviewpersoner,daomfangetafprojektetogdetstidsrammesatte nogleheltnaturligebegrænsningerfor,hvormegetempiriderkunneindsamles,udenat analysenvillebliveoverfladisk.vikontaktedeialt14redaktørerogjournalisterforat forhøreos,omdevillestilleoptiletforskningsinterview.viendtemedathave interviewaftalermedialtfirejournalisterfratredagblade,somgernevilledeltage.de resterende10personerentensvaredeikkeellergavudtrykfor,atdeikkevilledeltage.! 6/53

11 Enafdeovenståendejournalister,AndersBæksgaard,siddertildagligpåBerlingske TidendesChristiansborgQredaktion.Vieropmærksommepå,atjournalisterpå Christiansborgharnogleandreforudsætningerforatkontaktepolitiskekilder.Visynes alligevel,atdeterrelevantathavehammed,daviiartikelsøgningenfandtudaf,athan påsammemådesomdeøvrigejournalisteroplevede,atkilderikkesvarede.derfor besluttedeviosfor,atandersbæksgaardikkeskulleudelukkes,fordivoresfokusfor undersøgelsenvardenenkeltejournalistspraksis. Forberedelse(til(interviewsituationen( ( ( ( DaviharvalgteninteraktionistisktilgangtilvoreskvalitativeempiriQindsamling,hvor Interviewet!kan!begrebsliggøres!som!et!socialt!møde,!en!samtale!imellem!dialogparter! (...) (Staunæs&SøndergaardiJärvenin&MikQMeyer,2005:54)erdetvigtigt,atvi forholderostil,hvadvoresrollesominterviewereer.vierendelafdetsocialemødeog dermedmedskabendeiproduktionenafviden.imødetmedinterviewpersonerne optrædervisomforskere,menjournalistenserosmåskemeresom journaliststuderendeendforskere.detkanresultereietuligeforhold,hvordekanse sigselvståienbelærenderolle.detvarderforsærligtvigtigtforos,atinterviewetblev startetopvedatetablereenrammeogensituation,hvorinterviewpersonenkunnetale fritom,hvordanvedkommendearbejderipraksisogsamtidigtkunnereflekterederom. Dettevalgblevtagetforatundgåenmereoverordnetidealistisksamtaleom,hvordan manbørgøresomjournalist,hvilketikkevilleværebrugbartforvoresundersøgelse,da viønskeratbelysejournalistensarbejdsgangipraksis.samtidigtvardetvigtigtforosat holdeosåbneoverforandreoplevelserafsituationen,hvorkilderikkesvarer,endden, viselverfaredeivoresartikelproduktion.foratskabepladstilrefleksionogdialogom emnet,besluttedevi,atinterviewguidensspørgsmålikkeskullegennemgåsslavisk.vi stræbtederforefteratværeåbneoverforinputs,samtatbrugeinterviewguidensomen guidelinetilemner,derkunneværerelevanteiforholdtilrefleksionerom problemstillingen. Voresinterviewguide(Bilag5)blevudarbejdetmedudgangspunktinedenstående punkter.denneopbygningkanifølgejärvinenogmikqmeyerdanneenramme,der appellerertil,atinterviewpersonernedeltagersom medforskere ogikkeblotfremstår! 7/53

12 somanalyseredeobjekteriinterviewet.dettekangiveenmerenuanceretogdermed merepræcisempiriifølgedeninteraktionistisketilgangtilinterview(staunæs& SøndergaardiJärvinen&MikQMeyer,2005:67).Opbygningenersomfølger: 1. Åbningdermarkererinteresseikonkreterfaringerogoplevelser 2. Invitationtilkonkretefortællinger 3. Fortællingeroggradvismererefleksion (Ibid.). Meddetførstepunktfokuseredevipåatstarteinterviewetvedatsætteenklarramme for,hvadvoresinteressevar,samtinterviewetsformål.dettegjordeviforatskabeet fællesudgangspunktforenåbendialog. Iforholdtilandetpunktønskedeviatåbneinterviewetopvedatfåinterviewpersonen tilatfortælleomenkonkretsituation,hvoriproblemstillingenomkilder,derikke ønskeratdeltageiinterviews,harværetgældende.dorthestaunæsogdortemarie SøndergaardanbefaleriKvalitative!metoder!i!et!interaktionistisk!perspektiv,atmangår indidenkonkretebeskrivelseindendenrefleksiveappel,dadetkanværemedtilat skabeenfællesforståelsefordetindhold,somrefleksionernetagerudgangspunkti. Dermedbliverdetnemmereforinterviewpersonerneatreflektereogvise modsætninger,ambivalensogundren(ibid.).pådenmådehavdeviogsåmulighedfor atspørgeindtilkonkretehandlemønstre,fremforattaleometoverordnetidealistisk perspektiv,ogfjerneosfraeneventuelbelæringom,at sådanbørdetvære.dette lederoveritredjepunktiinterviewguiden,hvorvimedudgangspunktiforskellige emnerkunnegålængereindinarrativet,sominterviewpersonenbyggedeop,og dermedskabemulighedforvidererefleksioner. Interviewsituationen(og(efterrefleksioner(( Defireinterviewsblevaftaltmeddeenkelteinterviewpersonerovermail.Interviewene fandtstedpåinterviewpersonernesrespektivearbejdspladser.detteblevgjortforat gøredetsånemtforinterviewpersonernesommuligtatstilleoptilinterviewogforat skabeentrygramme.alleinterviewsblevoptagetmeddiktafonforathaveenså! 8/53

13 korrektgengivelseafdialogensommuligt,ogdermedhaveetgodtudgangspunktforen fællesanalyseiprojektgruppen.samtidigkunnevisominterviewerekoncentrereosom dialogenfremforatskulleskriveiagttagelserogudsagnnedundervejsiinterviewet.til hvertinterviewblevderudvalgttointerviewere.detteblevgjortmedhenblikpå,atden eneinterviewerstyredeinterviewet,ogatdenandenindtogensupplerenderolle,som bødindmedspørgsmål,nårdetvarrelevant,ellerhvisdenandenintervieweroverså vigtigepointeriinterviewpersonensudsagn. Invitationentilatfortælleomkonkreteerfaringermedpolitiskekilder,derikkesvarer, lykkedesitreinterviews.entenhavdeinterviewpersonernereflekteretover problemstillingenindenmødet,oghvisdetteikkevartilfældet,havdevipåforhånd fundetartiklerskrevetafvedkommende,hvorpolitiskekilderikkehavdesvaret.dette blevbrugttilatfåsporetinterviewpersonenindpåemnet.ietenkelttilfældelykkedes detdogikke.iinterviewetmednikolajheltoftfrapolitikenblevderikkeetablereten fællesrammeomdialogenpågrundaftidspres.heltofthavdetravlt,dahanskulle skyndesigvidereefterinterviewet.hvisvihavdehaftstørreerfaringmeddet interaktionistiskeinterview,havdevisandsynligvisforeslåetetandettidspunktfor interviewetfremforatgennemføredetlidtforhastedeinterview.atderikkevartidtil ordentligrefleksionogskabelseafenfællesforståelsemedvirkedetil,atdetblevet mereoverordnetinterview,somtogudgangspunktiidealetfremforendyberegående dialogomhanspraksis.dermedindtognikolajheltoftdesværrekundelvistrollensom medforsker iinterviewet,idetathankunnoglegangetaltekonkretomegenpraksis. Andregangesynteshanattageforbeholdogholdesigtiljournalistensideal.Mendet skaldognævnes,atderstadigvariagttagelserogfortællingeromdendagligepraksis, somvarbrugbareforproblemstillingen. BådeinterviewetmedJulieElmhøjogRuneWolfhagenfungeredesomennaturlig samtale,hvorvihavdefølelsenaf,atsamtalenflødfrit,ogatbeggeinterviewpersoner syntesatreflektereoverspørgsmåleneundervejs.dettemedvirkedetil,atdeikkeholdt sigtilforudformuleredesandhederogidealer,menistedetfungeredesom medforskere.medjulieelmhøjkandettemuligvisskyldes,atvisominterviewereikke erlangtfrahendeiforholdtilbådealderoguddannelse,dahunkommerfraroskilde Universitet.Dettemedvirkedetil,atderhurtigtblevskabtenfællesrammefor! 9/53

14 interviewet,ogatsamtalendermedblevnaturlig.dogmåmanisådannesituationer tageforbeholdfor,atdernemtkanopståimplicitteogusagteaspekterafdialogen.dette sesogsåiinterviewetmedrunewolfhagen,hvorinterviewerensom journaliststuderendegikmedpåpræmissenom,atmansomjournalisterhjælpeløsi situationer,hvorkilderikkesvarer: Det!kunne!godt!være,!at!der!var!en!bestemt!måde,! man!snakkede!om!de!her!ting!på?!i!forhold!til,!når!man!står!og!er!lidt!hjælpeløs,!når!man! mangler!et!svar (Bilag1,l.148Q149).Detkanbetyde,atvisominterviewereikke udfordrerpræmissenogdermedikkefåretstørreudbytteafinterviewsituationen. DenfællesforståelsesrammekomogsåtiludtrykiinterviewetmedAndersBæksgaard, derligesomjulieelmhøjeruddannetpåroskildeuniversitet.dervaraltsåenfælles forståelse,hvilketgjorde,atderhurtigtblevetableretenrammeforsamtaleog refleksion. DetointerviewsmedhenholdsvisAndersBæksgaardogJulieElmhøjerforetagetugen efterinterviewenemedrunewolfhagenognikolajheltoft.vihavdedermednogle anderledesrefleksionerognyviden,hvilketmuligvisogsåkanhavebetydet,atvisom interviewerevarbedrerustetfagligtogerfaringsmæssigttildetosidsteinterviews. Teoretisk(ramme( Ifølgendeafsnitvildenteoretiskeramme,vibevægerosindenfor,blivepræsenteret. Overordnetsetvilviianalysenafvoresempiribenytteteoriomhandlendejournalister, kilderogderesindbyrdesforhold,samtteoriomkringagendaqsettingogden journalistiskepraksis. Detskalnævnes,atdeninteraktionistiskeinterviewmetode,somerblevetpræsentereti afsnittetvores!udgangspunkt,ogsåbliveranvendtsomanalyseredskabiafsnittetdet! journalistiske!narrativ. TilatbelyseforholdetmellemjournalisterogkilderanvenderviNeteNørgaard Kristensensteoriomkringjournalisterogkildersamtderesindbyrdesforhold,der præsenteresihendesværk!journalister!og!kilder!!slinger!i!valsen?.detteværk! 10/53

15 udspringerafkristensensph.d.qafhandling,hvorhunblandtandetudføreren omfattendekvantitativundersøgelseafdisseforhold(kristensen,2004:15).kristensen belyserblandtandetforholdetmellemjournalistogkilde,mediestrategierog medialiseringenafjournalistenskilder.kristensenpræsenterervidereflereteoretiske pointer,somerrelevantetilbesvarelsenafvoresopstilledeproblemformulering. Kristensenbeskriverblandtandet,at (...)!en!professionalisering!blandt!kilderne!kan! derfor!have!forstærket!kildernes!rolle!!både!som!omdrejningspunkt!for!og!som!ophav!til! mediernes!dagsorden (Ibid.,11).ViderebeskriverKristensen,atmediedagsordenenhar indflydelsepådenoffentligedagsorden,ogatjournalisterogkilderderforaktivtprøver atdomineredenne.samtidigtpåvirkeremnernepådagsordenenogsåsamspillet mellemjournalistogkilde,dadagsordenentildelermagtogpositionideresindbyrdes samspil(ibid.,21). Foratforståforholdetmellemjournalisterogpolitiskekildererdetinteressantatse nærmerepåagendaqsettingteori.viharvalgtatbrugeteoretikernejamesw.dearingog EverettM.Rogers agendaqsettingqteori,davisynes,atdengiverengodindføringi agendaqsetting.agendaqsettinghandlerommagtentilatpåvirkedagsordenen. Synlighedenafetgiventemnedemonstrererenaktørsmagtoverdagsordenen(Dearing ogrogers,1996:2).ydermeretrækkervipåteoretikerenmaxwellmccombsagendaq settingqteori,dergiverosenmeredetaljeretogopdateretindføringiagendaqsetting. Dagsordenteorierneopererermedtretyperagendaer:Denpolitiske,denoffentligeog mediernesdagsorden(ibid.,5),ogsommccombsbeskriverdet,influererpolitiske, mediernesogoffentlighedensinteresseroutputtetafmediedagsordenen: Agenda9 setting!theory!is!about!the!transfer!of!salience!from!one!agenda!to!another (McCombs 2014:133). McCombsopererermedtoniveauerafagendaQsetting,hvor firstqlevelagendaqsetting førstogfremmesthandleromhvilkeemner,dergenerelterrepræsenteretogsynligepå dagsordenen(mccombs2014:97).underdetteniveaufindesbegrebet objectsalience, sombeskriverproduktionenafetemnessynlighed,detvilsige,hvilkebilleder offentlighedenskalforholdesigtil.sagtpåenandenmådebeskriverniveauet,hvad!der skaltænkespå(ibid.). SecondQlevelagendaQsetting handlerderimodom,hvordanet emnebliverbeskrevetogitalesat.pådetandetniveausesderderforpå theattribute! 11/53

16 salience,derbedstkanbeskrivessomendefineretogtonetsynlighed,detvilsige hvordanetemnepådagsordenentagerform(ibid.,102).atnogleinformationernårud tiloffentlighedenviamediedagsordenen,ogandreikkegør,harderforstorbetydning for,hvadborgerneforholdersigtil,oghvordandeforholdersigtildet.vivilunderdette andetniveaubenytteosafbegreberne priming ogdet intermedialeforhold.priming beskriverhvordanetemneoverlængeretidopfattespådagsordenensamt journalistensinteresseiatunderbygge,ellerprime,sintroværdighedoverforborgerne, nårhanellerhuniartiklenudtrykkersinvedholdenhediforholdtilatfåfatikildens svar(ibid.,99).samtidigtbelyserdetintermedialeforhold,hvordanjournalisterføler sigpressedetilatbringehistorierforatfølgemedrestenafmediedagsordenen(ibid., 131).DetoniveauerharNeteNørgaardKristensenoversatmeddedanskebetegnelser dagsordensætningensførsteniveau og dagsordensætningensandetniveau! (Kristensen2004:22),somvivilbenytteosaffremadrettet. DerudoveranvendervienteoriafprofessorijournalistikTimothyE.Cook.Cooksteori om,atmediernefungerersomensocialinstitution,brugerviiafsnittetomden redaktionellepraksissamtideleafdiskussionen.teorienerbeskrevetibogen Governing!with!the!Newsogtagerudgangspunktienanalyseafdeamerikanskemedier. Vierklarover,atdetikkeermuligtatlaveendirektesammenligningafdeamerikanske ogdanskemedier,alligevelmenervi,atvikanbrugehansteori,dadeterengod forklaringsrammetilatforstånogletendenserindenformediernesvirke.cook beskrivermediernesomensamletinstitution,derarbejderensartet(cook,1998:64). Detkommerblandtandettiludtrykved,atmedierneserhinandenoverskulderen,når dethandleromhvilkeemner,derkommerpådagsordenen(cook,1998:81).deter altsårelevantatanvendecook,dahansteorikangiveenforklaringsrammeforpraksis pånyhedsredaktionerne. ) )! 12/53

17 Operationalisering(af(analyse(og(diskussion( Idetteafsnitfølgerenbeskrivelseaf,hvordanrapportensanalyseogdiskussioner byggetop.opbygningenafanalyseogdiskussionerudarbejdetmedudgangspunkti voresempiriforpåbedstmuligvisatbesvarevoresproblemformulering. Analysenogdiskussionenbyggesoppåbaggrundaffireudvalgtetemaer,som udspringerafempirien,ogsomskalhjælpetilatbesvarevoresundren.temaerne,vi harudvalgt,er: Forholdet!mellem!journalist!og!kilde Det!journalistiske!narrativ De!redaktionelle!forhold Påvirkning!af!mediedagsordenen!! Underallefiretemaervildenudvalgteteoriløbendebliveanvendt.Teoriener præsenteretiforegåendeafsnitteoretisk!ramme,ogderudoveranvendesmetodisk teoriominteraktionisme,somerpræsenteretiafsnittetvores!udgangspunkt. Ilæsningenafvoresempiriharviundervejshaftdenopstilledeproblemformuleringi mente,hvilketharfungeretsometpejlemærkefor,hvordananalysenogdiskussionen erblevetoperationaliseret.defiretemaermedfører,atrapportenbevægersigpåflere niveauer.førstviljournalistenspraksisværedetcentraleomdrejningspunktiafsnittet Forholdet!mellem!journalist!og!kilde.Hervilrelationenmellemjournalistogkildeværei fokus.vihar,udfravoresempiri,opstilletenrækkegreb,sominterviewpersonerne bruger,nårpolitiskekilderikkesvarer.dissekonkretegrebsynesteoretiskuudforsket, ogviharderforvalgtatopstillekategorierfordegreb,somvoresempiriviser,at journalisternebenytter. Andetpunktianalysen,Det!journalistiske!narrativ,!omhandlerinterviewpersonernes narrativeriinterviewsituationen.vibevægerosaltsåidennedelnærmereindpåvores interviewpersonersselvforståelsesomudøvendejournalister,samthvordande positionerersigiforholdtildereskilder.herefterundersøgerviidettredje analysepunkt,de!redaktionelle!forhold,deforhold,somjournalistenarbejderunder,og! 13/53

18 hvordandissepåvirkerinterviewpersonernesfærdigeproduktogarbejdsgang, herunderhåndteringenafkilder,derikkesvarer.analyseresultaterfradetreførste punkterbliverafslutningsvisdiskuteretipåvirkning!af!mediedagsordenen!hvor resultaternebliversammenholdtmedagendaqsettingteori.vidiskutereraltså,hvad journalistenshåndteringafkilder,derikkesvarer,betyderfordagsordenenimedierne. ) )! 14/53

19 Analyse( Forholdet(mellem(journalist(og(kilde( Idetteafsnitvilinterviewpersonernesjournalistiskepraksisogderesindbyrdesforhold meddereskilderværedetcentralegenstandsfeltforanalyse.afsnittetvilbelyse forholdetmellemjournalistogkildemedfokuspådegreb,somdehverisæranvender nårkilderikkesvarer. Bytteforholdet(( Ivoresinterviewsfremgårflereeksemplerpå,atvoresinterviewpersonerserforholdet mellemdemogdereskildersomnoget,derkanligneetforhandlingsforhold.dette forhandlingsforholdgårudpå,atmansomjournalistogkildeharetgensidigt afhængighedsforhold,hvormanhverisærharnoget,somdenandenerinteressereti (Kristensen2004:71).DettekommerblandtandettiludtrykiinterviewetmedJulie Elmhøj.Hunbeskriverenkonkretsituation,hvorhunindgikienforhandlingmeden kilde: Deres![RadikaleVenstres,red.]!pressemand!henvendte!sig!til!os,!eller!til!mig,!for! om!jeg!ville!skrive!den!historie.!normalt!skal!man!jo!være!sådan!lidt!påpasselig,!når! pressepersoner!henvender!sig,!men!det!var!egentlig!en!ret!god!historie,!og!meget! fair,!at!de!ville!sige! nu!åbner!vi!op!for!flygtninge,!så!den!skrev!vi!så (Bilag4,l.27Q 31).! Elmhøjertydeligvisbevidstomkringenforhandlingssituation,hvorhunreflekterer over,athunaktivterblevetkontaktetafenpressemedarbejderfraetpolitiskparti. Alligevelbeskriverhun,hvordanhunvurderedehistorienogtilsidstgodkendteden. Altsåtrådtehunindienforhandlingmedsinkildevedatgivekildeneksponeringi forventningom,atkildenvilgivehendeinformationtilbage.elmhøjbeskriver,hvordan hungavkilden (...)så!meget!god!presse (Ibid.,l.41Q42).Dogskulledetvisesig,at forhandlingenudvikledesigienuventetretningforelmhøj.historienblevnemlig trukkettilbageafpartiet,ogelmhøjstodderefteriensituation,hvorhunvarblevet! 15/53

20 citeretiflerestoremedierogderformåtteskriveennyhistorieom,atdetpolitiske forslagvartrukkettilbage(ibid.,37q41). HeropstårproblemetforElmhøj,dahendespolitiskekildeikkeønskeratstilleoptil interviewtildennyeogkritiskeartikelmedundskyldningenom,athunerblevetsyg. DettesætterforhandlingssituationenpåenprøveogfrustrererElmhøj. ( )!der!ville!hun!pludselig!ikke!være!med,!fordi!at!nu!var!hun!blevet!syg.!og!det! blev!jeg!selvfølgelig!ret!irriteret!over,!fordi!for!to!dage!siden!havde!hun!overhovedet! ikke!været!syg.!selvfølgelig!må!en!politiker!godt!være!syg,!men!hvis!det!er!et! interview!på!fem9ti!minutter!over!telefonen,!så!skal!man!være!virkelig!syg!for!ikke! at!stille!op,!synes!jeg.!især!når!man!lige!har!fået!presse!på!det!andet (Ibid.,44Q49).! IElmhøjstilfældekandettolkessomom,atderskeretbrudpåforhandlingernemellem journalistogkilde.elmhøjfremhæver,athunhargivet god!presse (Ibid.,l.41Q42)til sinkildeogderforogsåforventer,atkildenvilstilleoptilinterview,ogpådenmåde indgåidenforhandlingsaftale,somparterneindgikibegyndelsen.elmhøjsoplevelseer interessant,hvismankiggerpåkristensensbegreberomforhandlingsspilog bytteforhold.førstogfremmestbeskriverkristensenmedhenvisningtillektoripolitisk kommunikationaerondavis,hvordanrelationenmellemjournalisterogkilderstyresaf udbudogefterspørgsel,oghvordandetoparterarbejderudfraegneinteresser (Kristensen,2004:71).Journalistensogkildensrollerbeskrivesbeggesomgatekeepere, hvorjournalistenkontrollererkildenseksponeringogadgangtiloffentligheden,mens kildenkontrollerer,hvilkeninformationjournalistenhartilrådighed(ibid.).ielmhøjs tilfældeharhungivetsinpolitiskekildeadgangtiloffentligheden,menproblematikken opstår,dahendespolitiskekildeefterfølgendeikkeønskeratdeleinformationmed hendeiformafatudtalesigomudviklingenisagen.derskeretbrudiforhandlingerne, sommankanforklareudfra byttemodellen,somkristensenpræsenterer(ibid.,71f). Hunskriver,atbyttemodellenbaserersigpå,atjournalistenogkildenbeggeharnoget, en vare,somdenandenpartharinteressei,ogderforindgårdeietbytteforholdmed henblikpåatindfrisineegneønsker(ibid.,71).varernekandoghaveforskelligværdi alteftermedieogpolitikerogkandermedskabeenkonfliktibytteforholdet,ligesom detsesielmhøjstilfælde.elmhøjføler,athungivergodpresseogstoreksponeringtil! 16/53

21 sinkilde,hvilketerhendesvare,menfårikkeenvareafsammeværdiigen,dakilden ikkeønskeratoptrædeidenefterfølgendehistoriemedinformationeromsagen.i situationenstårelmhøjmedentavskilde,hvorhunbenytterforskelligegrebforatfå sinkildeitale.dissegrebbliverbelystsenereianalysen. Værdienafdensåkaldtevarekommerligeledestiludtrykhosenandenafvores interviewpersoner,runewolfhagen.hanbeskriverpåsammemåde,hvordanhan oplever,athansvareikkeerafsammeværdi,somdenkilderneliggerindemed: Vi![DagbladetInformation,red.]!er!rigtig!tit!i!opposition!eller!har!nogle!kritiske! historier,!når!vi!henvender!os,!så!selvfølgelig!så!tror!jeg,!når!man!sidder!derinde,!og! så!ringer!der!en!journalist!fra!information,!så!tænker!man![pressemedarbejdere forpolitiskekilder,red.]:! Nå,!ned!i!bunken.!Fordi!at,!for!det!første,!så!er!der!ikke! særlig!mange!læsere,!det!er!ikke!en!særlig!stor!avis,!og!for!det!andet!er!det!sikkert! ikke!en!særlig!spændende!historie!for!os.!så!lad!os!hellere!bruge!vores!energi!på! noget,!der!får!os!til!at!se!bedre!ud (Bilag1,l.271Q276). Wolfhagenoplever,athansvare,somereksponeringiDagbladetInformationog dermedadgangtiloffentligheden,oftevurderessomværendeaflavereværdi.han oplever,athanskilderikkeønskeratindgåietbytteforhold,hvorderesinformation byttesforeksponeringidagbladetinformation,somifølgehambetragtessomenlilleog kritiskavis. HosJulieElmhøjtyderdetpå,athunerbevidstomkringdenneforhandlingssituation, hvorderopståretbytteforhold.elmhøjfortælleromenkonkretsituation,hvorhun oplevedeatjustitsministerenvarsværtatfåitale.ielmhøjsforklaring,sesdet,hvordan journalistensvareafhængerafmulighedenforeksponeringimediet: (...)!der!var!hun![mettefrederiksen,red.]!rigtig!svær!at!få!til!at!udtale!sig,! ihvertfald!til!os,!og!så!står!hun!jo!sådan!i!tv2!og!dr!og!sådan!noget,!som!hun!godt! vil,!men!så!fordi!vi!er!en!avis,!og!en!mindre!avis,!så!kan!hun!godt!være!svær!at!få!fat! i (Bilag4,l.375Q378).!! 17/53

22 ElmhøjsbeskrivelsekanforståsudfraKristensensbegreberomkringbytteforhold,da hunoplever,athendesavisharmindreværdisammenlignetmedtv. Dererogsåeksemplerpå,atdetikkekunerjournalisten,derskalhavevurderetsin vareafkilden.bytteforholdetgårogsådenandenvejrundt,hvilketbæksgaard beskriverienandensituation: De!lægger!det!frem:! Har!I!set!det!her?,!men!der!skal!vi!spotte!deres!politiske!spin.! Vi!skal!ligesom!prøve!at!filtrere!det.!Analysere!det!og!nogle!gange!oplever!vi,!at!der! er!en!meget!god!historie.!den!skriver!vi.!andre!gange!oplever!vi,!hvor!vi!tænker:! Arg,!den!er!lidt!for!letkøbt (Bilag3,l.428Q431).! Dennebeskrivelseillustrerer,hvordanjournalistenogsåvurdererdehistorier,somde fårindfrapolitiskekilder.bæksgaardvurderer,omkildenshistorieharhøjnokværdii forholdtildeneksponering,somhankangivekildenisinavis. Samletsettegnerdersigetbilledeaf,atinterviewpersonerneindgårietbytteforhold meddereskilder,hvorderhandlesmedinformationforeksponeringogomvendt. Bytteforholdeterdogafkompliceretkarakterogstyresafkonstantevurderinger mellemjournalistogkilde,derheletidenforhandlerindbyrdesmedderesvarer.dette viser,atnårenjournalistmøderentavskilde,afhængerbytteforholdetafdenværdi journalistensvarehar.detoparterkanogsåmodarbejdehinandenidetteforhold, hvilketvilblivebelystinedenståendeafsnit. Modspil( Dennedelafanalysenvilrettefokusmodsituationer,hvorjournalisterogkilder modarbejderhinanden.dethandlerblandtandetomsituationer,hvorkildentier,og journalistenikkelykkesmedatfåetbytteforholdopogstå,samtsituationerhvor journalistenikketagerimodkildensinformation. Flereafvoresinterviewpersonerbeskriver,hvordandeopleverkildensomen modspiller,dermodarbejderdemideresarbejdsproces.dettestårikontrasttildet tidligerebeskrevnebytteforhold,hvordereksistererenvisafhængigheddetoparter imellem(kristensen2004:49f).! 18/53

23 Interviewpersonernebeskriverforskelligetaktikkerfrakildernesside,hvordeføler,at kildernemodarbejderderesarbejdsgang.julieelmhøjfortæller,hvordanhunhar oplevet,attavsekilderkanpåvirke,hvormegetenhistoriekommertilatfyldepå mediernesdagsorden: Jamen,!det!er!jo!helt!sikkert,!at!hvis!sagen!er!dårlig,!så!er!det!nogle!gange!nemmere! at!tie!den!ihjel,!så!bliver!det!jo!også!en!kortere!artikel!fra!mig.!altså!tit!så!kan!de!jo! godt!lukke!sagen!halvt!ned!ved!ikke!at!ville!udtale!sig!(...)information!kørte!jo!alle! de!her!nsa9artikler,!som!jo!blev!spredt,!altså!så!alle!de!store!medier!i!hele!verden! tog!de!her!artikler.!men!der!var!overhovedet!ikke!nogen!danske!politikere,!der!ville! kommentere!på!det,!så!på!den!måde!så!bliver!sådan!en!sag!jo!bare!tiet!ihjel.!så!på! den!måde!er!det!jo!smart!for!dem!at!gøre!det.!det!er!da!helt!klart!deres!incitament! til!at!gøre!det (Bilag4,l.305Q313).! Elmhøjsbeskrivelseillustrerer,hvordankildenkanageremodspillerogikkehar interessei,atenhistorieblivertil.denneoplevelsekantolkesudfrakristensensteori, hvorhunpåpeger,atderherskeretmagtspilomkontrollenovermediernesdagsorden, derpåvirkesafinteresser,derikkeudelukkendeerjournalistiske.journalisternes adgangtilkildernesinformation,erdermeddelvistafhængigafkampenommediernes dagsorden(kristensen2004:70).elmhøjsoplevelseindikerer,atkilderneiden pågældendesaghavdeandreinteresserformediedagsordenenendatudbredehistorier omkringnsaqskandalen.mankandiskutere,omkildernebevidstforsøgteatholde historierneudeafmediedagsordenenved,atsagenbliver tiet!ihjel.dennediskussion vilbliveudfoldetsenereirapporteniafsnittetpåvirkning!af!mediedagsordenen.!! AndersBæksgaardbeskriverogså,hvordanhanopleveretmodspilhoskilderne.Han mener,atdeterenbevidsttaktikfrakildernesside: Det!er!en!utrolig!effektiv!pressestrategi.!Altså!rigtig!mange!kritiske!artikler!kan! forstummes,!hvis!man!nægter!at!kommentere!alene!af!den!grund,!at!det!sender!et! signal!til!læserne,!seerne!og!lytterne,!at!der!er!ikke!noget!i!den!her!historie!(...)jeg! forstår!det!som,!at!når!politikere!tier,!så!er!det!en!del!af!en!effektiv!pressestrategi! fra!deres!side!af (Bilag3,l.299Q301,307Q308).!! 19/53

24 Somdetfremgårafcitaterne,opleverbådeBæksgaardogElmhøj,hvordankilderne brugerentaktik,hvordebevidsttier,ietforsøgpåatpåvirkeetemnessynlighedpå mediernesdagsorden.detteudfordrerjournalistensarbejdsprocesogkomplicerer relationentilkilden,somellersoftebeskrivessometgensidigtafhængighedsforhold, hvorbeggeparterharinteresseienudveksling(kristensen,2004:71). Interviewpersonernesoplevelserkanogsåtolkesudframediestrategier,som KristensenpræsenterervedattrækkepåforskerneRichardEricsson,PatriciaBaranek ogjanetchan(ibid.,159).hererenafmediestrategierne aflukning iformaf hemmeligholdelse eller censur,derbeskrivessomatmodarbejdejournalisten.netop aflukninger,hvadelmhøjogbæksgaardbeskriverideresoplevelser,hvordereskilder modarbejderdemvedattieoglukkenedforkommunikationen. Interviewpersonerneberetterogsåomenandentaktikfrakilderne,derkomplicerer denindbyrdesrelationogudfordrerdenjournalistiskearbejdsproces.dennetaktik minderomdenførnævnte,menadskillersigalligevel,dakildentilenvisgradlukker ned.elmhøjbeskriverensituation,hvorhendeskollegaoplevede,atkildenviaskriftlige svarpermailformåedeatundgåatudtalesigomdetgivneemne,ogdermedikkebidrog tildenmediedagsorden,journalistenforsøgteatsætte: For!et!par!måneder!siden( )!trykte!min!kollega!lasse!hele!sin! mailkorrespondance!med!trine!bramsen,!fordi!at!han!bliver!ved!med!at!ville!have! svar!på!et!spørgsmål,!som!hun!bare!bliver!ved!med!ikke!at!svare!på.!og!det!udstiller! ret!godt,!hvordan!man!nogle!gange!overhovedet!ikke!kan!få!en!politiker!til!at!svare,! på!det!man!spørger!om,!selvom!man!bliver!ved!på!sytten!måder.!det,!synes!jeg,!er!et! kæmpe!problem (Bilag4,232Q238).! Dennebetragtningsynesinteressant,hvismanigenkiggerpåbegrebetaflukning,som beskrevettidligere.kildenformåratglideafpåspørgsmålviamailsvarogkanpåden mådemodarbejdejournalisten,derfårsværtvedatkommeigennemmedsin dagsorden.skriftligesvarpermailkanpådenmådegivekildenmagttilatagere modspillerogtrækkesvaretienretning,dergavnerdemselv.! 20/53

25 Bæksgaardbeskriverogsåenoplevelse,hvorhanforsøgteatindhenteinformationhos Socialministeriet,menblevmødtafskriftligkommunikation,dertrakhans arbejdsprocesud: Det!har!taget!dem![Socialministeriet,red.]tre!uger!at!henvise!mig!til! Statsforvaltningen!på!nogle!spørgsmål.!Ikke!aktindsigter,!bare!rent!faglige! spørgsmål:! Hvordan!skal!jeg!forstå!dit,!hvordan!skal!jeg!forstå!dat.!Og!den!form!for! kontrolleret!kommunikation!over!mail,!altså!isolere!det!til!skriftlig!kommunikation,! det!kan!jo!i!den!grad!være!med!til!at!punktere!meget!af!det!arbejde,!vi!laver (Bilag 3,l.750Q755).! Bæksgaardoplevermodstand,dakommunikationenforegårskriftligt,ogpådenmåde formårkildenatpåvirke,hvilkeninformation,derblivertilgængeligforjournalisten. Detteerinteressantidetperspektiv,atKristensenbeskriver,hvordankildernetilpasser sigmediernesbetingelser.kilderneudviklermediekompetencer,sådekanståstærkere iinterviewsituationen,oggåindietmereaktivtogprofessioneltforholdmedmedierne (Kristensen2004:160f).DetteillustreresibådeElmhøjsogBæksgaardsoplevelser, hvorkilderneaktivtforsøgeratbeherskemedierneslogikvedatdominere interviewsituationen,hvilketmailsvargivermulighedfor.ibæksgaardstilfældeerdet interessant,hvorvidthanskildersagereneretudtrykfor,atdehartilpassetsig medierneslogik,ogbevidsttrækkerhistorienudoggørdenuaktuelformediernes dagsorden. NetopKristensenspointe,omatkilderneudviklerderesmediekompetencer,kan inddragesiforholdtil,hvordandetopartermodarbejderhinanden.vores interviewpersonergavogsåudtrykfor,atkilderneaktivtopsøgerdemmedhistorier, derkantolkessometforsøgpåatpåvirkedagsordenen,hvilketvidereillustrerer professionaliseringenafkilderne,somkristensenbeskriver(ibid.,193f).bæksgaard beretterom,hvordanhanopsøgesafpolitiskekilder,dertilbyderhamhistorier: ( )!vi!analyserer,!hvad!lægger!de!på!bordet!her,!og!kan!der!være!noget!rundt!om,! som!er!en!bedre!historie,!end!det!de!mener,!at!vinklen!skal!være.!de!lægger!det!frem:! Har!I!set!det!her?,!men!der!skal!vi!spotte!deres!politiske!spin.!Vi!skal!prøve!ligesom! at!filtrere!det.!analysere!det!og!nogle!gange!oplever!vi,!at!der!er!en!meget!god!! 21/53

26 historie.!den!skriver!vi.!andre!gange!oplever!vi,!hvor!vi!tænker:! Arg,!den!er!lidt!for! let!købt.!at!konservative!vil!ud!og!forære!os!en!historie,!hvor!de!vil!skyde!på,!at! regeringen!eller!lars!løkke!rasmussen,!som!er!deres!konkurrent,!ikke!gør!det!godt! nok!for!boligejerne,!når!de!ikke!selv!har!finansiering!til!at!fikse!det!problem,!de! kritiserer!de!andre!for!ikke!at!gøre.!sådanne!motivanalyser!foretager!vi!i!stor!stil (Bilag3,l.426Q436).! Bæksgaardbeskriver,hvordanhananalysererhistorier,somkildernesendertilhans avisihåbomeksponering.hanfremhævervigtighedenafatfindefremtilhistoriens egentligemotiv,såkilderneikkefårubegrænsetadgangtileksponering.dette illustrerer,atmagtforholdetgårbeggevejeog,atjournalisterneogsåmodarbejder kildenideresindbyrdesrelation. Samletsettegnerdersigetbilledeaf,attrodsdetgensidigeafhængighedsforholdog samspilmellemjournalistogkilde,såmodarbejderdetoparterogsåhinanden.det kommertiludtrykidegrebdetoparteranvenderietforsøgpåatpositioneresigi magtforholdet,nårkilderheltellerdelvistikkesvarer,ellernårjournalistenikketager imoddeinformationstilbud,somkildenkommermed. Ifølgendeafsnitforetagervienkategoriseringafdegreb,journalisternebruger,når kilderafviseratindgåietbytteforhold. Håndtering(af(kilder,(der(ikke(svarer( Forholdetmellempolitiskekilderogjournalisterbeskrivesafinterviewpersonernesom situationsbetingetogbærerprægafetbytteforhold,dereksistererpåbaggrundaf,at parternehverisærfårtilgodesetderesinteresser.menhvordanhåndterervores interviewpersonersådepolitiskekilder,somikkesvarerpåhenvendelserellerikkevil udtalesigomenkonkretsag?dettevarhovedemnetivoresinterviewsmed interviewpersonerne,hvorvibaddemfortælleomkonkretehændelser,derkunne beskrive,hvordandeipraksisreageredepåsådannesituationer. Empirienviser,atkontaktenmelleminterviewpersonenogkildenikkeophører,selvom kildenafviseratkommenterepådenkonkretesag.tværtimoderdettilfældet,at interviewpersonerneadforskelligevejeforsøgeratfåkildenovertalttilatudtalesig! 22/53

27 alligevel.deeksempler,sominterviewpersonernenævneriforbindelsemedatfåkilden tilatmedvirkeietinterviewalligevel,tolkerviianalysensomovertalelsesgreb,der anvendesidenjournalistiskepraksis,nårkildenafviseratindfrijournalistensinteresse. Dissegreb,sombeskrivesnærmereidefølgendeafsnit,eraltsåopståetpåbaggrundaf voresempiriogerkategoriseretsomfølger: Udskydelseafartiklensdeadline Artiklensplaceringiavisen Besiddelseafinformationogdokumentation,somerkritiskforkilden Atskrive ingen!kommentar iartiklen,sombådefungerersom sanktion og redskabtilatovertalekildentilalligevelatstilleop Voresoplevelseafinterviewenevar,atselvominterviewpersonerneoftetog udgangspunktikonkretesituationer,vardetetbilledepåmåden,degenereltgårtil dereskilderpå.foreksempeltyderformuleringersom: Så!man!kan!godt!presse!dem! lidt!på!den!måde (Bilag4,l.434Q435)eller (...)jeg!kan!måske!sige,!hvordan!jeg!generelt! gør!i!forhold!til!sådan!en!situation (Bilag1,l.53Q54),på,atdetteeretudtrykfor, hvordaninterviewpersonentypiskvilreagereisituationer,hvordeharsværtatfå politiskekilderitale. Udskydelse(af(artiklens(deadline( Etafdegreb,sombenyttesafinterviewpersonerneer,atpubliceringenafartiklen udskydes,nårdenpolitiskekildeafviseratkommenterepåsagen(bilag1,l.67q73,bilag 3,l.96Q102,Bilag4,l.78Q82).Detforklaressomendelafdendagligearbejdsproces,at kildergerneviludtalesig,menikkealtidhartidpådetpågældendetidspunkt.derfor måjournalistennoglegangeventeendagellertopåatfåcitaternehjem.andregange kanudskydelsenafartiklensdeadlinedoghaveandreårsager.eksempelvisbeskriver JulieElmhøjensituation,hvorlokalpolitikerenAnnaMeeAllerslev,somerobjektforen kritiskhistorie,igenogigenundgåratstilleoptilinterview,fordihunentenersygeller ikkehartid(bilag4,l.44q53+90q95).elmhøjtolkertydeligviskildenstidsmangelog sygdomsomdårligeundskyldningerforatundgånegativeksponering.derforsignalerer Elmhøjoverforkilden,athunvilblivevedmedatudskydehistorien,indtilpolitikeren stillerop.for,somelmhøjformulererdet: (...)!på!et!eller!andet!tidspunkt!må!de!jo!have!! 23/53

28 tid (Ibid.,l.82Q83).Dennemetodekantolkessometspilomtålmodighedfrabegge partersside.journalistenvurdereridetteeksempel,atkildenikkeeroprigtig,nårhun siger,athunikkehartidellerersyg.derforudskydesartiklen,ogdetblivertilenkamp om,hvemderførstgiverop.journalistenhåberpå,atkildenindser,athunførstfårro, nårhunharstilletoptilinterview.omvendthåberkilden,atjournalistenmister tålmodighedenogdropperhistorien.journalistentolkeraltsåsituationenogkildens motiverpåenmåde,dergør,athunholderfasti,atartiklenskalskrives. DetlykkedesElmhøjisidsteendeatfåpolitikerenitale,ifølgeElmhøjvardetteet udtrykfor,atpolitikerekunnese,atelmhøjikkevillegiveop: (...)hun!kunne!godt!se,!at! jeg!bare!blev!ved (Ibid.,l.94Q95).Herhargrebetaltsåvistsigsometredskabtilatfåen kildeitale,påtrodsaf,athuniudgangspunktethavdeafvistatbliveintervieweti forbindelsemedartiklen. Artiklens(placering(i(avisen( AndersBæksgaardfortællerometandetgreb,somhanbrugertilatfåenkildeitale.I forbindelsemedenforsideartikel,derhandledeompolitietsoverarbejdeitidenefter angrebetpåkrudttøndenikøbenhavn,afslogjustitsministermettefrederiksenat kommenterepåsagen.idialogenmedministerenspresseansvarligeforsøgte Bæksgaardatlæggeprespåsinkildevedbrugeartiklensfremtrædendeplaceringi avisensometargumentfor,atministerenskulleudtalesig: Så!lægger!man!pres!på,!ved!for!eksempel!at!bruge!artiklens!placering!som!et!pres! ved!at!sige,! det!er!altså!en!forside,!og!der!kommer!den!og!den!kritik,!og!det!vil!se! dumt!ud,!hvis!hun!ikke!svarer (Bilag3,l.61Q64).! Artiklensplacering,idettetilfældepåforsiden,bliverafBæksgaardbetragtetsomet overtalelsesmiddel,somskalfådenpresseansvarligetilatændreholdningtil,hvorvidt ministerenbehøveratudtalesigellerej.dettekunnehængesammenmed,atkildenhar eninteresseiatfremståpåenbestemtmåde,fordimedierneerden (...)vigtigste! kommunikationskanal!i!forhold!til!vælgerne,!offentligheden (Kristensen,2004:146).En negativeksponeringpåforsidenogandrefremtrædendestederiavisenkunnedermed væreensbetydendemedflerelæsere,dermåtteundresigover,hvorfor Justitsministerenikkeviltagestilling.! 24/53

29 At(være(i(besiddelse(af(dokumentation,(som(er(kritisk(for(kilden( Entredjetaktikforjournalisteneratværeibesiddelseafinformationeller dokumentation,somkanhavekonsekvenserforkilden.detfortællerbådenikolaj HeltoftogAndersBæksgaard.Bæksgaardbeskriverdetsomen (...)utrolig!effektiv! pressestrategi (Bilag3,l.299),nårkilderafviseratudtalesigomenkritisksag.Påden mådemenerhan,atvedatkildernetier,forsøgerdeatfåsagernetilatfremståsom uvigtige(ibid.,l.299q302).herergrebethosinterviewpersonerneatværeibesiddelse afsoliddokumentation,ogdervedpåviseatsagenikkebørnegligeres,menbørnåudtil offentligheden.derforerdetikritiskesager,hvordetkanhavekonsekvenserforden kritiseredekilde,essentieltforbæksgaardathaveinformation,derudelukkerkildens mulighedforatlukkenedforsager,førdenårudtiloffentligheden.somdeter beskrevetiafsnittetmodspil,kandetskegennemaflukningsstrategier,detværesig censurellerhemmeligholdelse(kristensen,2004:159).hvishemmeligholdelseikke længerekanopnås,fordijournalistenalleredehardenødvendigebeviser,kanhaneller hunpressepåfor,atkildenfølersignødsagettilatudtalesig. BæksgaardnævnerLarsLøkkeRasmussenogGGGIQsagensometeksempelpå,hvordan enkildeprøveratlæggeensagnedvedikkeatudtalesig.førstdaflereogflere informationerhavdefundetvejtilmediernesdagsordenudenomløkke,varsagen så! stor,!at!den!var!han!nødt!til!at!kommentere!på (Bilag3,l.305Q307). Heltoftmener,atnydokumentationerennødvendighed,hvismanvilhaveenkildetilat kommenterepådensammesagfleregange: Politikerne!kan!i!nogle!sager!forsøge!at!sige,!at!nu!har!jeg!sagt!det,!som!jeg!vil!sige! om!den!her!sag.!altså,!og!så!er!det!selvfølgelig!min!opgave,!i!det!omfang!jeg!gerne! vil!have!dem!på!igen,!at!bringe!dem!noget!substantielt!på!bordet,!som!gør!det!svært! for!dem!at!ikke!at!udtale!sig (Bilag2,l.283Q286).! Vilmanudviklehistorien,måmanaltsåfindefremtilyderligereinformationer,som ændrersagsforholdeneiensådangrad,atkildenikkelængerekunkanhenvisetil tidligereudsagn,menbliverpressettilattagestillingpåny.detcentraleerher,ifølge detojournalister,spørgsmåletom,hvormegetjournalistenved.heltoftbeskriverdet somsubstantielviden,detvilsigekonkretvidenellerdokumentation,someressentiel! 25/53

30 forhistorienogkilden.kanartiklenskrivesudenkildensinddragelse,fordijournalisten alleredeeribesiddelseafdeninformation,somdannergrundlagforhistorien,ændres balancenmellemjournalistensomgatekeeperforeksponeringogkildengatekeeperfor information,sombeskrevetiafsnittetbytteforhold.journalisteneraltsåikkelængere afhængigafkildenisammeomfang,somhvisdetvarkilden,dervarleverandøraf denneinformation.værdienafjournalistensvarestigeraltsåitaktmedjournalistens uafhængighedafkildensvare. At(skrive( ingen)kommentarer (i(artiklen( Denmåskemestsynligemåde,journalisterhåndtererkilder,somikkesvarer,på,erved atskriveiartiklen,atvedkommendeikkeharønsketatudtalesig.foreksempelsiger NikolajHeltoft,at: I!de!situationer,!(...)hvor!jeg!har!forsøgt!!i!god!tid!!så!vil!jeg!så!skrive,!at!det!har! jeg,!og!jeg!vil!skrive,!at!de!trods!gentagne!henvendelser!for!eksempel!ikke!ønsker!at! stille!op.!altså,!og!det!må!man!jo!sige!er!den!sanktion!i!citationstegn,!som!jeg!har!i! det!fald,!at!en!kilde!bare!nægter!at!stille!op (Bilag2,l.48Q52).! Hanbeskriverdetaltsåsomensanktioneringafkilden,nårhansomjournalistskriver, atkildenikkeharvilletytresigpåtrodsaf gentagne!henvendelser frajournalistens side.dettekaneventuelthængesammenmed,atjournalistenserdetsomnegativ eksponering;atdetstillerkildenietdårligtlys,nårvedrørendeikkeharvilletsvarepå denkritik,derbliverrettetmodhamellerhende.samtidigopleverjulieelmhøjpået tidspunkt,atogsådenpolitiskekilde,herannameeallerslev,ikkeerinteresseretiatfå ensådanomtaleogderforendermedatsvarepåelmhøjsspørgsmål(bilag4,l.428q 434).DenneafpresningvilvikommenærmereindpåiafsnittetIngen!kommentarer! som!afpresningsmiddel. Iflertalletafvoresinterviewsbliverdetdogtydeligt,atdetatskrive Det!har!ikke!været! muligt!at!få!en!kommentar (Bilag1,l.75)bliversetsomdensidsteudvej(Bilag1,l.98Q 105,Bilag3,l.190).Deopfatterdetselvsometnederlagoget (...)træls,!problematisk! og!irriterende forløb(bilag1,l.70),ellermedandreord,atdetihvertfaldaltider (...) federe!at!få!en!kommentar!end!at!få!ingen!kommentar (Bilag4,l.106Q107).! 26/53

Bilag. Resume. Side 1 af 12

Bilag. Resume. Side 1 af 12 Bilag Resume I denne opgave, lægges der fokus på unge og ensomhed gennem sociale medier. Vi har i denne opgave valgt at benytte Facebook som det sociale medie vi ligger fokus på, da det er det største

Læs mere

Indhold 1. INDLEDNING...4

Indhold 1. INDLEDNING...4 Abstract This thesis has explored the hypothesis that emotional dysregulation may be involved in problems with non response and high dropout rates, which are characteristicofthecurrenttreatmentofposttraumatic,stressdisorder(ptsd).

Læs mere

Tea Party - skabelsen af en magtfaktor

Tea Party - skabelsen af en magtfaktor Tea Party - skabelsen af en magtfaktor Skrevet af: Camilla Louise Grandt, Caroline Elmquist-Clausen, Johannes S. Schultz-Lorentzen og Lars Asbjørn Holst Projekttitel: Tea Party skabelsen af en politisk

Læs mere

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen

Øjnene, der ser. - sanseintegration eller ADHD. Professionshøjskolen UCC, Psykomotorikuddannelsen Øjnene, der ser - sanseintegration eller ADHD Professionshøjskolen UCC, Psykomotorikuddannelsen Professionsbachelorprojekt i afspændingspædagogik og psykomotorik af: Anne Marie Thureby Horn Sfp o623 Vejleder:

Læs mere

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen

The X Factor. Målgruppe. Læringsmål. Introduktion til læreren klasse & ungdomsuddannelser Engelskundervisningen The X Factor Målgruppe 7-10 klasse & ungdomsuddannelser Engelskundervisningen Læringsmål Eleven kan give sammenhængende fremstillinger på basis af indhentede informationer Eleven har viden om at søge og

Læs mere

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com.

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com. 052430_EngelskC 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau C www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Vejleder:*Christine*Revsbech!! Anslag:*180.289*

Vejleder:*Christine*Revsbech!! Anslag:*180.289* Christoffer*Granhøj*Hansen* *48909** Lea*Poulsen* *46969** Fie*Frøling*Ipsen* *50212** Cristina*Nyangai*Siiger*E*49433* BA*Pædagogik*og*Uddannelsesstudier Roskilde*Universitet Vejleder:*Christine*Revsbech

Læs mere

Forskningsprojekt og akademisk formidling - 13. Formulering af forskningsspørgsmål

Forskningsprojekt og akademisk formidling - 13. Formulering af forskningsspørgsmål + Forskningsprojekt og akademisk formidling - 13 Formulering af forskningsspørgsmål + Læringsmål Formulere det gode forskningsspørgsmål Forstå hvordan det hænger sammen med problemformulering og formålserklæring/motivation

Læs mere

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen. og

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen.  og 052431_EngelskD 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau D www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation

Læs mere

Børn under et nyt paradigme? Børnekultur som begreb og virkelige greb

Børn under et nyt paradigme? Børnekultur som begreb og virkelige greb MalmöHögskola Kulturochsamhälle(K3) Kultur ochmedieproduktion2008 Børn under et nyt paradigme? Børnekultur som begreb og virkelige greb AfLouiseLidangKrøyer Englishtitle: Kidsunderanewparadigm? Conceptsandpracticesofchildren

Læs mere

Eksempel på eksamensspørgsmål til caseeksamen

Eksempel på eksamensspørgsmål til caseeksamen Eksempel på eksamensspørgsmål til caseeksamen Engelsk niveau E, TIVOLI 2004/2005: in a British traveller s magazine. Make an advertisement presenting Tivoli as an amusement park. In your advertisement,

Læs mere

Roskilde Universitet Jeanette Lindholm PHD-.student

Roskilde Universitet Jeanette Lindholm PHD-.student Roskilde Universitet Jeanette Lindholm PHD-.student jeaneli@ruc.dk Recognition of Prior Learning in Health Educations JEANETTE LINDHOLM PHD-STUDENT Research question How do RPL students experience themselves

Læs mere

Essential Skills for New Managers

Essential Skills for New Managers Essential Skills for New Managers Poynter Institute 7.-12. december 2014 1 Overskrifterne for kurset var: How to establish your credibility as a leader, even if you are new in your role. How to provide

Læs mere

Gusset Plate Connections in Tension

Gusset Plate Connections in Tension Gusset Plate Connections in Tension Jakob Schmidt Olsen BSc Thesis Department of Civil Engineering 2014 DTU Civil Engineering June 2014 i Preface This project is a BSc project credited 20 ECTS points written

Læs mere

Den uddannede har viden om: Den uddannede kan:

Den uddannede har viden om: Den uddannede kan: Den uddannede har viden om: Den uddannede kan: Den uddannede kan: Den studerende har udviklingsbaseret viden om og forståelse for Den studerende kan Den studerende kan Den studerende har udviklingsbaseret

Læs mere

Kriterie for at bestå: Deltagelse i undervisningstiden, udarbejdelse af e-magasin, deltagelse i fælles fremlægning.

Kriterie for at bestå: Deltagelse i undervisningstiden, udarbejdelse af e-magasin, deltagelse i fælles fremlægning. 1. E-MAGASINER (Herning) Hvem kan deltage: Studerende i Herning Kriterie for at bestå: Deltagelse i undervisningstiden, udarbejdelse af e-magasin, deltagelse i fælles fremlægning. På kurset lærer du at

Læs mere

Bilag 1: Ekspertinterview m. Karen Sjørup

Bilag 1: Ekspertinterview m. Karen Sjørup Bilag 1: Ekspertinterview m. Karen Sjørup Vi har haft en mailkorrespondance med Lektor fra Roskilde Universitet Karen Sjørup, hvoraf vi har anvendt en række citater. Denne vil fremgå i det følgende afsnit.

Læs mere

X M Y. What is mediation? Mediation analysis an introduction. Definition

X M Y. What is mediation? Mediation analysis an introduction. Definition What is mediation? an introduction Ulla Hvidtfeldt Section of Social Medicine - Investigate underlying mechanisms of an association Opening the black box - Strengthen/support the main effect hypothesis

Læs mere

Sport for the elderly

Sport for the elderly Sport for the elderly - Teenagers of the future Play the Game 2013 Aarhus, 29 October 2013 Ditte Toft Danish Institute for Sports Studies +45 3266 1037 ditte.toft@idan.dk A growing group in the population

Læs mere

Læseplan Medier og samfund

Læseplan Medier og samfund SDU Det Samfundsvidenskabelige Fakultet Master i Journalistik, Årgang 2012 3. semester Fagansvarlig og underviser: Professor Erik Albæk, Center for Journalistik. Læseplan Medier og samfund Fagindhold Medierne

Læs mere

Studieordning del 3,

Studieordning del 3, Studieordning del 3, 2014-2016 Autoteknolog, Valgfri Uddannelseselementer Academy Profession Degree in Automotive Technology Version 0.1 Revideret 19. august 2015 Side 0 af 6 Indhold Studieordningens del

Læs mere

Forventer du at afslutte uddannelsen/har du afsluttet/ denne sommer?

Forventer du at afslutte uddannelsen/har du afsluttet/ denne sommer? Kandidatuddannelsen i Informationsvidenskab - Aalborg 2 respondenter 5 spørgeskemamodtagere Svarprocent: 40% Forventer du at afslutte uddannelsen/har du afsluttet/ denne sommer? I hvilken grad har uddannelsen

Læs mere

To the reader: Information regarding this document

To the reader: Information regarding this document To the reader: Information regarding this document All text to be shown to respondents in this study is going to be in Danish. The Danish version of the text (the one, respondents are going to see) appears

Læs mere

Design til digitale kommunikationsplatforme-f2013

Design til digitale kommunikationsplatforme-f2013 E-travellbook Design til digitale kommunikationsplatforme-f2013 ITU 22.05.2013 Dreamers Lana Grunwald - svetlana.grunwald@gmail.com Iya Murash-Millo - iyam@itu.dk Hiwa Mansurbeg - hiwm@itu.dk Jørgen K.

Læs mere

A projekt about creating communication between the different users of a park. 2200N. Copenhagen. 2002.

A projekt about creating communication between the different users of a park. 2200N. Copenhagen. 2002. The Swamp A projekt about creating communication between the different users of a park. 2200N. Copenhagen. 2002. Katalogue picture The Art in the nineties was characterised by an increased consciousness

Læs mere

Managing stakeholders on major projects. - Learnings from Odense Letbane. Benthe Vestergård Communication director Odense Letbane P/S

Managing stakeholders on major projects. - Learnings from Odense Letbane. Benthe Vestergård Communication director Odense Letbane P/S Managing stakeholders on major projects - Learnings from Odense Letbane Benthe Vestergård Communication director Odense Letbane P/S Light Rail Day, Bergen 15 November 2016 Slide om Odense Nedenstående

Læs mere

Remote Sensing til estimering af nedbør og fordampning

Remote Sensing til estimering af nedbør og fordampning Remote Sensing til estimering af nedbør og fordampning Mads Olander Rasmussen Remote Sensing & GIS Expert GRAS A/S How can remote sensing assist assessment of hydrological resources? -with special focus

Læs mere

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22.

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22. Bøger på engelsk How Al-Anon Works - for Families & Friends of Alcoholics Al-Anons grundbog på engelsk, der indfører os i Al- Anon programmet. Om Al-Anons historie, om forståelse af os selv og alkoholismen.

Læs mere

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus

Developing a tool for searching and learning. - the potential of an enriched end user thesaurus Developing a tool for searching and learning - the potential of an enriched end user thesaurus The domain study Focus area The domain of EU EU as a practical oriented domain and not as a scientific domain.

Læs mere

Krydsfelter. Udfordringer og dilemmaer i socialpsykiatrisk praksis. - en udforskningsproces med henblik på vidensskabelse om samfundssystemets grænser

Krydsfelter. Udfordringer og dilemmaer i socialpsykiatrisk praksis. - en udforskningsproces med henblik på vidensskabelse om samfundssystemets grænser Krydsfelter Udfordringer og dilemmaer i socialpsykiatrisk praksis - en udforskningsproces med henblik på vidensskabelse om samfundssystemets grænser Speciale af Helle Vase Sørensen (20011856) Institut

Læs mere

Aktiv lytning - som kompetence hos ph.d.-vejledere

Aktiv lytning - som kompetence hos ph.d.-vejledere Downloaded from orbit.dtu.dk on: Oct 09, 2016 Aktiv lytning - som kompetence hos ph.d.-vejledere Godskesen, Mirjam Irene; Wichmann-Hansen, Gitte Publication date: 2012 Document Version Også kaldet Forlagets

Læs mere

Arbitration in Denmark

Arbitration in Denmark Arbitration in Denmark Steffen Pihlblad Christian Lundblad Claus Søgaard-Christensen DJØF PUBLISHING Arbitration in Denmark Eds. Grith Skovgaard Ølykke Carina Risvig Hansen Steffen Pihlblad, Christina

Læs mere

NÅR KØNSNORMERNE LARMER

NÅR KØNSNORMERNE LARMER NÅR KØNSNORMERNE LARMER - En kritisk diskursanalyse af, hvordan konstruktioner af maskulinitet influerer på unge mænds oplevelse af kærestevold Af: Amalie Frederikke Stender og Malene Laustsen Blædel Vejleder:

Læs mere

Orientering om det engelske abstract i studieretningsprojektet og den større skriftlige opgave

Orientering om det engelske abstract i studieretningsprojektet og den større skriftlige opgave Fra: http://www.emu.dk/gym/fag/en/uvm/sideomsrp.html (18/11 2009) November 2007, opdateret oktober 2009, lettere bearbejdet af JBR i november 2009 samt tilpasset til SSG s hjemmeside af MMI 2010 Orientering

Læs mere

New Nordic Food 2010-2014

New Nordic Food 2010-2014 New Nordic Food 2010-2014 Mads Randbøll Wolff Senior adviser Nordic Council of Ministers New Nordic Food The questions for today concerning New Nordic Food: - What is the goal for New Nordic Food? - How

Læs mere

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.

ATEX direktivet. Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet. ATEX direktivet Vedligeholdelse af ATEX certifikater mv. Steen Christensen stec@teknologisk.dk www.atexdirektivet.dk tlf: 7220 2693 Vedligeholdelse af Certifikater / tekniske dossier / overensstemmelseserklæringen.

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Tilmeldingerne til 2013 I dag nåede vi op på 77 tilmeldte både. Det er lidt lavere end samme tidspunkt sidste år. Til gengæld er det glædeligt,

Læs mere

Forskningsbasering: Hvad sker der når et universitet vil sætte ord og handling bag?

Forskningsbasering: Hvad sker der når et universitet vil sætte ord og handling bag? Forskningsbasering: Hvad sker der når et universitet vil sætte ord og handling bag? Mogens Hørder Syddansk Universitet Kongelige Danske Videnskabernes Selskab Forskningspolitisk årsmøde 22 marts 2011 På

Læs mere

Modtageklasser i Tønder Kommune

Modtageklasser i Tønder Kommune Modtageklasser i Tønder Kommune - et tilbud i Toftlund og Tønder til børn, der har behov for at blive bedre til dansk TOFTLUND TØNDER Hvad er en modtageklasse? En modtageklasse er en klasse med særligt

Læs mere

Trolling Master Bornholm 2016 Nyhedsbrev nr. 7

Trolling Master Bornholm 2016 Nyhedsbrev nr. 7 Trolling Master Bornholm 2016 Nyhedsbrev nr. 7 English version further down Så var det omsider fiskevejr En af dem, der kom på vandet i en af hullerne, mellem den hårde vestenvind var Lejf K. Pedersen,

Læs mere

EVENT DESCRIPTION RES-e Regions

EVENT DESCRIPTION RES-e Regions EVENT DESCRIPTION RES-e Regions Title: Visions for Solar Energy & Sustainable Energy Systems for Cities Date & location: 18 April 2007, Copenhagen Organizer: SolarCity Copenhagen and DTI Number of Participants:

Læs mere

Forslag til implementering af ResearcherID og ORCID på SCIENCE

Forslag til implementering af ResearcherID og ORCID på SCIENCE SCIENCE Forskningsdokumentation Forslag til implementering af ResearcherID og ORCID på SCIENCE SFU 12.03.14 Forslag til implementering af ResearcherID og ORCID på SCIENCE Hvad er WoS s ResearcherID? Hvad

Læs mere

Sports journalism in the sporting landscape

Sports journalism in the sporting landscape Sports journalism in the sporting landscape - Blind spots of the journalists Foto: Bjørn Giesenbauer/Flickr Play the Game 2013 Aarhus, 30 October 2013 Ditte Toft Danish Institute for Sports Studies/Play

Læs mere

Profilbeskrivelse for Marketing, Globalisering og Kommunikation Marketing, Globalization and Communication

Profilbeskrivelse for Marketing, Globalisering og Kommunikation Marketing, Globalization and Communication Profilbeskrivelse for Marketing, Globalisering og Kommunikation Marketing, Globalization and Communication Bilag til studieordningen for kandidatuddannelsen i erhvervsøkonomi (cand.merc.) Odense 2009 1

Læs mere

Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling

Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling Skoleudvikling og globale sociale udfordringer - Sundhedsfremme og uddannelse for bæredygtig udvikling Venka Simovska Katrine Dahl Madsen Lone Lindegaard Nordin Forskning i sundhedsfremmende og bæredygtig

Læs mere

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22.

How Al-Anon Works - for Families & Friends of Alcoholics. Pris: kr. 130,00 Ikke på lager i øjeblikket Vare nr. 74 Produktkode: B-22. Bøger på engelsk How Al-Anon Works - for Families & Friends of Alcoholics Al-Anons grundbog på engelsk, der indfører os i Al- Anon programmet. Om Al-Anons historie, om forståelse af os selv og alkoholismen.

Læs mere

Forskning i Kvalitet og Patientsikkerhed i Sundhedsvæsnet. Hvorledes bringes samfundsmæssige udfordringer på den danske forskningsdagsorden?

Forskning i Kvalitet og Patientsikkerhed i Sundhedsvæsnet. Hvorledes bringes samfundsmæssige udfordringer på den danske forskningsdagsorden? Forskning i Kvalitet og Patientsikkerhed i Sundhedsvæsnet Hvorledes bringes samfundsmæssige udfordringer på den danske forskningsdagsorden? Har Kvalitet og Patientsikkerhed særlige muligheder? Mogens Hørder

Læs mere

Vidensdeling. om - og med - IKT. Bo Grønlund

Vidensdeling. om - og med - IKT. Bo Grønlund Vidensdeling om - og med - IKT Denne workshop vil give indblik i, hvordan lærere på gymnasiet kan fremme og systematisere vidensdeling omkring brug af IKT i undervisningen, samt hvordan gymnasiers ledelser

Læs mere

DK - Quick Text Translation. HEYYER Net Promoter System Magento extension

DK - Quick Text Translation. HEYYER Net Promoter System Magento extension DK - Quick Text Translation HEYYER Net Promoter System Magento extension Version 1.0 15-11-2013 HEYYER / Email Templates Invitation Email Template Invitation Email English Dansk Title Invitation Email

Læs mere

COMPACT CITY OG BÆREKRAFT

COMPACT CITY OG BÆREKRAFT NORSK PLANMØTE 2010 COMPACT CITY OG BÆREKRAFT HVOR TETT VIL VI BO? JENS KVORNING PROFESSOR CENTER FOR BYPLANLÆGNING KUNSTAKADEMIETS ARKITEKTSKOLE KØBENHAVN TÆTHED FYSISK TÆTHED EN FORUDSÆTNING FOR BÆREDYGTIGHED

Læs mere

USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION

USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION USERTEC USER PRACTICES, TECHNOLOGIES AND RESIDENTIAL ENERGY CONSUMPTION P E R H E I S E L BERG I N S T I T U T F OR BYGGERI OG A N L Æ G BEREGNEDE OG FAKTISKE FORBRUG I BOLIGER Fra SBi rapport 2016:09

Læs mere

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred

HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred HÅNDTERING AF RISIKOFAKTORER FOR SYGDOM Medicinforbrug og selvvurderet helbred Kandidatuddannelsen i Folkesundhedsvidenskab Aalborg Universitet 1. Semester projekt Gruppe nummer: 755 Vejleder: Henrik Bøggild

Læs mere

Pensumkatalog. for. Tilvalgsfag i Journalistik. Forårssemesteret 2011

Pensumkatalog. for. Tilvalgsfag i Journalistik. Forårssemesteret 2011 Pensumkatalog for Tilvalgsfag i Journalistik Forårssemesteret 2011 For alle fag gælder det, at der kan forekomme ændringer inden semesterstart. 1 Indholdsfortegnelse: Journalistisk Håndværk 2 Journalistiske

Læs mere

Underleverandørnetværk og Konsortiedannelse

Underleverandørnetværk og Konsortiedannelse Underleverandørnetværk og Konsortiedannelse - vejen til attraktive eksportmarkeder og øget vækst Direktør Morten Basse Jensen, Offshoreenergy.dk - Renewables Underleverandørnetværk og konsortiedannelse,

Læs mere

The Thesis M.Sc. In Technical IT (Civilingeniør)

The Thesis M.Sc. In Technical IT (Civilingeniør) 27. OCTOBER The Thesis M.Sc. In Technical IT (Civilingeniør) Electrical Engineering and ICT Who are we? Henrik Karstoft (hka@iha.dk) Ingeniørdocent @ASE, Leading the group in Signal Processing and Control@ASE/EICT

Læs mere

Partipolitik III: Dagsordener

Partipolitik III: Dagsordener Partipolitik III: Dagsordener Erik Gahner Larsen Offentlig politik 1 / 28 Eksamen Ingen multiple choice-test Fokuser på eksamen Hav en idé klar til vejledningen I tvivl om noget? Spørg mig i pausen 2 /

Læs mere

BUTIK, KAFFEBAR ELLER CAFE. Nørrebrogade 45A, 2200 København N Sag 163791R (HT)

BUTIK, KAFFEBAR ELLER CAFE. Nørrebrogade 45A, 2200 København N Sag 163791R (HT) BUTIK, KAFFEBAR ELLER CAFE Nørrebrogade 45A, 2200 København N Sag 163791R (HT) BELIGGENHED Ejendommen er beliggende på hjørnet af Nørrebrogade/Stengade i et af Københavns mest trendy områder med kaffebarer,

Læs mere

Shared space - mellem vision og realitet. - Lyngby Idrætsby som case

Shared space - mellem vision og realitet. - Lyngby Idrætsby som case Downloaded from orbit.dtu.dk on: Jan 27, 2017 Shared space - mellem vision og realitet. - Lyngby Idrætsby som case Brinkø, Rikke Publication date: 2015 Document Version Peer-review version Link to publication

Læs mere

BILAG 1 Fra vejledningen til studieretningsprojektet, oktober 2006

BILAG 1 Fra vejledningen til studieretningsprojektet, oktober 2006 BILAG 1 Fra vejledningen til studieretningsprojektet, oktober 2006 4. Fremmedsprog 2.5 Ved opgaver, hvori et eller flere fremmedsprog indgår, skal en del af de anvendte kilder være på det/de fremmede sprog.

Læs mere

Back to basics. - systemic virtues for social work and clinical practise in future society. Jørn Nielsen, klinisk psykolog, ph.d., JN@kliniskpsyk.

Back to basics. - systemic virtues for social work and clinical practise in future society. Jørn Nielsen, klinisk psykolog, ph.d., JN@kliniskpsyk. Back to basics - systemic virtues for social work and clinical practise in future society Maturana: 100% of human existence is about love, all pain and suffering for which people search for help is of

Læs mere

Ekstraordinær Generalforsamling Vilvorde Kursuscenter 27. maj 2009

Ekstraordinær Generalforsamling Vilvorde Kursuscenter 27. maj 2009 Ekstraordinær Generalforsamling Vilvorde Kursuscenter 27. maj 2009 1 Safe Harbour Statement This presentation may contain forward-looking statements, including statements about our expectations of the

Læs mere

Bilag. Indhold. Resumé

Bilag. Indhold. Resumé Bilag Indhold Resumé... 1 Abstract... 2 Indgang og ventetid... 3 Resumé Dette projekt forklarer, hvilke værdier samfundet er udviklet igennem, og hvordan disse har haft en effekt på individet. For at gøre

Læs mere

Trolling Master Bornholm 2013

Trolling Master Bornholm 2013 Trolling Master Bornholm 2013 (English version further down) Tilmeldingen åbner om to uger Mandag den 3. december kl. 8.00 åbner tilmeldingen til Trolling Master Bornholm 2013. Vi har flere tilmeldinger

Læs mere

Nyhedsmediernes udvælgelse af enkeltsager og deres indtræden på den politiske dagsorden

Nyhedsmediernes udvælgelse af enkeltsager og deres indtræden på den politiske dagsorden Nyhedsmediernes udvælgelse af enkeltsager og deres indtræden på den politiske dagsorden Foto (fra oven til højre): TV2/Nord; NN; Scanpix; Finn Frandsen Projektet er udarbejdet af: Gruppe 22 hus 19.1, overemne:

Læs mere

Climate adaptation in Denmarkand a groundwater dilemma

Climate adaptation in Denmarkand a groundwater dilemma Climate adaptation in Denmarkand a groundwater dilemma Rolf Johnsen www.regionmidtjylland.dk Challenges with water Denmark 10-40% Precipitation ½-1m Sea level change 5-15 % Increase in runoff 0-2 m Groundwater

Læs mere

Traumer En undersøgelse af sammenhængen mellem PTSD og kroniske smerter

Traumer En undersøgelse af sammenhængen mellem PTSD og kroniske smerter Kandidatafhandling,InstitutforPsykologi,Københavnsuniversitet Traumer EnundersøgelseafsammenhængenmellemPTSDog kroniskesmerter Ethvertlevendevæsensøgerstraksfrafødslenlystenog befindersigvelvedden,somdetbedsteafalt,ogskyr

Læs mere

Leverandørdialog. R2 Group A/S. R2 Group A/S. Nøglen til at være REACH parat V. Jan Skov Nørby

Leverandørdialog. R2 Group A/S. R2 Group A/S. Nøglen til at være REACH parat V. Jan Skov Nørby Leverandørdialog Nøglen til at være REACH parat V. Jan Skov Nørby R2 Group A/S Slide 1 Leverandørdialog 30-01-2008 R2 Group A/S Handels- og distributions-virksomhed (80%) Produktion (20%) Foder og fødevarer

Læs mere

(INFORMATION TECHNOLOGY)/ (OPTICS AND ELECTRONICS)

(INFORMATION TECHNOLOGY)/ (OPTICS AND ELECTRONICS) MASTER OF SCIENCE IN ENGINEERING (INFORMATION TECHNOLOGY)/ (OPTICS AND ELECTRONICS) INGENIØRDOCENT HEAD OF PROGRAMS UNI VERSITy WHO AM I? Henrik Karstoft (hka@eng.au.dk) Ingeniørdocent @ ASE/ENG, Signal

Læs mere

Medinddragelse af patienter i forskningsprocessen. Hanne Konradsen Lektor, Karolinska Institutet Stockholm

Medinddragelse af patienter i forskningsprocessen. Hanne Konradsen Lektor, Karolinska Institutet Stockholm Medinddragelse af patienter i forskningsprocessen Hanne Konradsen Lektor, Karolinska Institutet Stockholm Værdi eller politisk korrekt (formentlig krav i fremtidige fondsansøgninger) Hurtigere, effektivere,

Læs mere

Learnings from the implementation of Epic

Learnings from the implementation of Epic Learnings from the implementation of Epic Appendix Picture from Region H (2016) A thesis report by: Oliver Metcalf-Rinaldo, oliv@itu.dk Stephan Mosko Jensen, smos@itu.dk Appendix - Table of content Appendix

Læs mere

A Strategic Partnership between Aarhus University, Nykredit & PwC. - Focusing on Small and Medium-sized Enterprises

A Strategic Partnership between Aarhus University, Nykredit & PwC. - Focusing on Small and Medium-sized Enterprises A Strategic Partnership between Aarhus University, Nykredit & PwC - Focusing on Small and Medium-sized Enterprises 04-12-2013 1 Why Danmark vinder bronze i innovation, men sakker bagud i forhold til vores

Læs mere

Titel: Barry s Bespoke Bakery

Titel: Barry s Bespoke Bakery Titel: Tema: Kærlighed, kager, relationer Fag: Engelsk Målgruppe: 8.-10.kl. Data om læremidlet: Tv-udsendelse: SVT2, 03-08-2014, 10 min. Denne pædagogiske vejledning indeholder ideer til arbejdet med tema

Læs mere

Aktivering af Survey funktionalitet

Aktivering af Survey funktionalitet Surveys i REDCap REDCap gør det muligt at eksponere ét eller flere instrumenter som et survey (spørgeskema) som derefter kan udfyldes direkte af patienten eller forsøgspersonen over internettet. Dette

Læs mere

EU vedtager et nyt program, som med 55 millioner EUR skal give børn større sikkerhed på internettet

EU vedtager et nyt program, som med 55 millioner EUR skal give børn større sikkerhed på internettet IP/8/899 Bruxelles, den 9 december 8 EU vedtager et nyt program, som med millioner EUR skal give børn større sikkerhed på internettet EU får et nyt program for forbedring af sikkerheden på internettet

Læs mere

Orientering om studieretningsprojektet, -opgaven og den større skriftlige opgave (uddrag)

Orientering om studieretningsprojektet, -opgaven og den større skriftlige opgave (uddrag) Orientering om studieretningsprojektet, -opgaven og den større skriftlige opgave (uddrag) BILAG 2 Studieretningsprojektet i stx Større skriftlig opgave på hf Vejledning til elever/kursister Udarbejdet

Læs mere

Projektledelse i praksis

Projektledelse i praksis Projektledelse i praksis - Hvordan skaber man (grundlaget) for gode beslutninger? Martin Malis Business Consulting, NNIT mtmi@nnit.com 20. maj, 2010 Agenda Project Governance Portfolio Management Project

Læs mere

Ansøgning til Studienævn for Farmaci om godkendelse af SPECIALEKONTRAKT for FARMACEUTUDDANNELSEN

Ansøgning til Studienævn for Farmaci om godkendelse af SPECIALEKONTRAKT for FARMACEUTUDDANNELSEN Ansøgning til Studienævn for Farmaci om godkendelse af SPECIALEKONTRAKT for FARMACEUTUDDANNELSEN Læs vejledningen først 1. Personoplysninger / personal information Navn / name: Gade, husnummer, postnummer

Læs mere

Application form for access to data and biological samples Ref. no

Application form for access to data and biological samples Ref. no Application form for access to data and biological samples Ref. 2016-02 Project title: Applicant: Other partners taking part in the project Names and work addresses: "Skilsmisse og selvvurderet mentalt

Læs mere

Den anerkendende metode

Den anerkendende metode Institut for Marketing og Organisation MSc SOL Kandidatafhandling Forfatter: Lars Bloch Mikkelsen Vejleder: Sarah Robinson Den anerkendende metode Med fokus på entreprenørielle processer i Studentervæksthus

Læs mere

How consumers attributions of firm motives for engaging in CSR affects their willingness to pay

How consumers attributions of firm motives for engaging in CSR affects their willingness to pay Bachelor thesis Institute for management Author: Jesper Andersen Drescher Bscb(sustainability) Student ID: 300545 Supervisor: Mai Skjøtt Linneberg Appendix for: How consumers attributions of firm motives

Læs mere

Syllabus. On-Line kursus. POSitivitiES. Learning. Applied Positive Psychology for European Schools

Syllabus. On-Line kursus. POSitivitiES. Learning. Applied Positive Psychology for European Schools PositivitiES Applied Positive Psychology for European Schools POSitivitiES Positive European Schools On-Line kursus Learning This project has been funded with support from the European Commission.This

Læs mere

COGNITIVE FITNESS IN IMMERSIVE VIRTUAL WORLDS

COGNITIVE FITNESS IN IMMERSIVE VIRTUAL WORLDS COGNITIVE FITNESS IN IMMERSIVE VIRTUAL WORLDS Designing af Communication- and Learning Environment for people suffering from Aphasia - Ulla Konnerup, Aalborg University, ullak@hum.aau.dk Afasi Afasi er

Læs mere

PERSPECTIVES ON MARKETING OF GREEN ELECTRICITY:

PERSPECTIVES ON MARKETING OF GREEN ELECTRICITY: PERSPECTIVES ON MARKETING OF GREEN ELECTRICITY: MODELING CONSUMER ADOPTION, CHOICE BEHAVIOR AND CONSUMER SWITCHING By Yingkui Yang THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE

Læs mere

MARITIME PROFESSIONALS, ASHORE AND AT SEA. Online Identitet. 29-03-2011 www.job2sea.com 1

MARITIME PROFESSIONALS, ASHORE AND AT SEA. Online Identitet. 29-03-2011 www.job2sea.com 1 Online Identitet 2011 29-03-2011 www.job2sea.com 1 Online Identity The social web, i.e. the usage of the web to support the social process, represents a space in which people have the possibility to express

Læs mere

Statistical information form the Danish EPC database - use for the building stock model in Denmark

Statistical information form the Danish EPC database - use for the building stock model in Denmark Statistical information form the Danish EPC database - use for the building stock model in Denmark Kim B. Wittchen Danish Building Research Institute, SBi AALBORG UNIVERSITY Certification of buildings

Læs mere

Dean's Challenge 16.november 2016

Dean's Challenge 16.november 2016 O Dean's Challenge 16.november 2016 The pitch proces..with or without slides Create and Practice a Convincing pitch Support it with Slides (if allowed) We help entrepreneurs create, train and improve their

Læs mere

Dagsorden 2-c) Spørgsmål/udeståender vedrørende begrænsninger ved nuværende regulering

Dagsorden 2-c) Spørgsmål/udeståender vedrørende begrænsninger ved nuværende regulering Dagsorden 2-c) Spørgsmål/udeståender vedrørende begrænsninger ved nuværende regulering Møde i VULA FTTH arbejdsgruppe 19. august Allan Bartroff 1 To aspekter af samme emne 1. Hvilke begrænsninger oplever

Læs mere

Aalborg University Culture, communication & Globalization 19/12-2011 7 th semester project

Aalborg University Culture, communication & Globalization 19/12-2011 7 th semester project Table of context 1. Introduction (PL)... 2 1.1. Problem formulation (PL,LN)... 6 2. Methodology (LN)... 8 2.1. A social constructivist approach (LN)... 9 2.2. The social constructivist effect on the project

Læs mere

Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk

Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk Plenumoplæg ved Nordisk Børneforsorgskongres2012 Professor Hanne Warming, Roskilde Universitet Kontakt: hannew@ruc.dk Medborgerskabets fire dimensioner (ifølge G. Delanty, 2000) Rettigheder Pligter Deltagelse

Læs mere

From innovation to market

From innovation to market Nupark Accelerace From innovation to market Public money Accelerace VC Private Equity Stock market Available capital BA 2 What is Nupark Accelerace Hands-on investment and business developmentprograms

Læs mere

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov.

Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. På dansk/in Danish: Aarhus d. 10. januar 2013/ the 10 th of January 2013 Kære alle Chefer i MUS-regi! Vores mange brugere på musskema.dk er rigtig gode til at komme med kvalificerede ønsker og behov. Og

Læs mere

Uddannelse!til! kritisk!tilgang!!!

Uddannelse!til! kritisk!tilgang!!! Uddannelsetil AlexanderAamand+40255 JesperHinzeNielsen+51632 MalteGyldenkærne+52477 MaltheCarlsen+52393 MikeBrandt+51740 OleHelms+52552 SveaKrukow+51729 Nr.S1525073149 Vejleder: KasperEskildsen Filosofifagmodulsprojekt4/6semester

Læs mere

Sikkerhed & Revision 2013

Sikkerhed & Revision 2013 Sikkerhed & Revision 2013 Samarbejde mellem intern revisor og ekstern revisor - og ISA 610 v/ Dorthe Tolborg Regional Chief Auditor, Codan Group og formand for IIA DK RSA REPRESENTATION WORLD WIDE 300

Læs mere

At tale med magten om prioritering af natur vi ikke kan se. Dansk Selskab for Marinbiologi 2. Oktober 2014 Peder Agger pa@ruc.dk

At tale med magten om prioritering af natur vi ikke kan se. Dansk Selskab for Marinbiologi 2. Oktober 2014 Peder Agger pa@ruc.dk At tale med magten om prioritering af natur vi ikke kan se Dansk Selskab for Marinbiologi 2. Oktober 2014 Peder Agger pa@ruc.dk Det glemte hav Danmark er geografisk set mere vand end land. Alligevel glemmes

Læs mere

KLAGENÆVNET FOR DOMÆNENAVNE

KLAGENÆVNET FOR DOMÆNENAVNE J.nr.: 1133 Klager: Sparekassen Kronjylland Tronholm 1 8900 Randers Indklagede: Malkhaz Kapanadze 16 Metechi Str. 0103 Tbilisi Tyskland Parternes påstande: Klagerens påstand Indklagede tilpligtes at overdrage

Læs mere

TA BUSSEN - LINIE 888 - HURTIGT BILLIGT BEHAGELIGT NEMT KØBENHAVN SILKEBORG ÅRHUS THISTED AALBORG KUN 120 KR. til Århus og Silkeborg. Aalborg og Thisted kun 140 kr. Ovenstående priser er for studerende

Læs mere

Hvad skal vi leve af i fremtiden?

Hvad skal vi leve af i fremtiden? Konkurrenceevnedebat: Hvad skal vi leve af i fremtiden? Mandag den 3. november 2014 www.regionmidtjylland.dk 1 Agenda Globalisering og dens udfordringer Væsentlige spørgsmål Eksempler 2 www.regionmidtjylland.dk

Læs mere

Kun 10 % er i alkoholbehandling hvordan får vi flere i alkoholbehandling?

Kun 10 % er i alkoholbehandling hvordan får vi flere i alkoholbehandling? Kun 10 % er i alkoholbehandling hvordan får vi flere i alkoholbehandling? Lars Iversen, professor emer. dr med, Statens Institut for Folkesundhed larsiversen1111@gmail.com Hvor mange har alkoholproblemer

Læs mere

Improving Interdisciplinary Education of Anatomy, Practical Sports using Non-Profit Software

Improving Interdisciplinary Education of Anatomy, Practical Sports using Non-Profit Software Improving Interdisciplinary Education of Anatomy, Biomechanics and Practical Sports using Non-Profit Software Interdeciplinary Sports Biomechanics Anatomy How to improve interdeciplinary? Examples in biomechanics

Læs mere

POSitivitiES Positive Psychology in European Schools HOW TO START

POSitivitiES Positive Psychology in European Schools HOW TO START POSitivitiES Positive Psychology in European Schools HOW TO START POSitivitiES Positive Psychology in European Schools PositivitiES er et Comenius Multilateral europæisk projekt, som har til formål at

Læs mere