DM01 DM Obl. Afl. Jacob Christiansen, , D12, Elias 13/ Side 1 af 7

Save this PDF as:
 WORD  PNG  TXT  JPG

Størrelse: px
Starte visningen fra side:

Download "DM01 DM01. 4. Obl. Afl. Jacob Christiansen, 130282, jacob.ch@mail.tdcadsl.dk. D12, Elias 13/5-2003. Side 1 af 7"

Transkript

1 DM01 DM01 4. Obl. Afl. Jacob Christiansen, , D12, Elias 13/ Side 1 af 7

2 DM01 Indholdsfortegnelse: BILAG: FORMÅL: KLASSER: DNA2: METODER: LOADFILE: METODER: TEST: LILLE GENSEKVENS:(BILAG 3) STOR GENSEKVENS:(BILAG 4) KONKLUSION:...7 Bilag: 1. Dna2.java 2. LoadFile.java 3. Test på lille kode 4. Test på stor kode 5. Lille gensekvens 6. Lille proteinkode 7. Stor gensekvens 8. Stor proteinkode Side 2 af 7

3 DM01 1 Formål: Formålet med denne opgave er at fremstille et program til genkending af protein i en genstreng vha. aminosyrer. Til dette formål skrives en main klasse, som finder den pågældende kode. Desuden skrives en klasse, som har til formål at åbne de filer som henholdsvis indeholder genstrengen og protein koden. Side 3 af 7

4 DM01 2 Klasser: 2.1 Dna2: Main klasse som bruges til at finde kodningen af proteinet Metoder: main: Main metoden er opbygget af flere dele. Første del initialiserer programmet, dvs. import af klasser og deklarering af variabler. Anden del er indlæsning af de to filer som indeholder det data, som programmet skal arbejde på. Sidste del er selve programmet, hvor selve kodningen for proteinet findes. Dette gøres på følende måde: 1. Genstrengen gennemløbes fortløbende og en genstreng i passende længde tages ud. 2. Den nye genstreng gennemløbes igen og gen-par, aminosyre, tages ud og sammenlignes med proteinkoden. Så frem kombinationen er gyldig, tilføjes parret til vores hashtable, mapping. 3. Så frem at koden ikke er gyldig, slettes hashtable, og en ny genstreng udtages og skridt 2 gentages. 4. Findes en gyldig løsning, sorteres hashtable vha. en string array og kodningen udskrives. Side 4 af 7

5 DM LoadFile: LoadFile er klassen til at hente data ind fra en fil og sætte alle linjerne sammen til en lang Metoder: Load: Denne metode bruges til at hente selve filen ind og sætte alle linjerne sammen til en lang. Dette gøres med en while-løkke, som hele tiden henter en ny linje ind og tilføjer den til den lange indtil der ikke er flere linjer i filen. Til sidst returneres den lange linje. Side 5 af 7

6 DM01 3 Test: For at teste om vores program giver de løsninger som er rigtige og dem som vi ønsker, vil vi først bruge vores program en lille gensekvens men en lille proteinkode, hvor vi ved at der er 5 løsninger. Hvis programmet finder alle 5 løsninger og de alle er forskellige, vil der være stor mulighed for at programmet gør sit job rigtigt. (bilag 3) Derefter prøver vi så på den store gensekvens, med den store proteinkode. Disse skal kun give en løsning, og findes den, må vi gå ud fra at resultatet er rigtigt, da der i en hashtable kun er mulighed for at være et sæt af hver kode par.(bilag 4) 3.1 Lille gensekvens:(bilag 3) Det ses at programmet fandt alle 5 løsninger og at de alle 5 er forskellige. Her fra må vi slutte at programmet virker rigtigt, på små gensekvenser. 3.2 Stor gensekvens:(bilag 4) Det ses at programmet kun finder en løsning, hvilket også var forudsagt. Ved at gennemgå koden ses det at der ikke er to ens kodepar, hvilket også er i overensstemmelse med vores hashtable. Side 6 af 7

7 DM01 4 Konklusion: Ved at se på vores output, ses det at vores program giver det rigtige resultat. Dog kan vi ikke være helt sikker, da dette kræver at vi gennemgår gensekvensen manuelt og kontrollerer at koden stemmer over ens. Selve programmet kan laves på flere måder, for eksempel kan den inderste for-løkke laves som en while-løkke. Men om der er tid og hukommelse at sparer, kan kun en yderligere udvikling af programmet vise, dog mener jeg at den løsning som jeg er kommet frem til er let, hurtig og enkel at finde rundt i og let at overskue, så forståelsen opnås hurtig. Side 7 af 7

8 Bilag 1 //************************************************************************ // // Dna2.java Lavet af: Jacob // // Et program til proteingenkendelse // //************************************************************************ //import af nødvendige klasser import java.util.*; public class Dna2 public static void main(string[] args) //initialisering af variabler osv. String genstreng,amino,prot; int count=0,antal=0,forkert=0; boolean fit; Hashtable kode=new Hashtable(); System.out.println(); System.out.println("Velkommen til DNA Analyse 1.0"); System.out.println(); //indlæsning af genstreng og proteinkode vha. LoadFile.java LoadFile genfile=new LoadFile(args[0]); String gen=genfile.load(); LoadFile protfile=new LoadFile(args[1]); String protstreng=protfile.load(); //tjek for om proteinstrengen passer til genstrengen if(gen.length()>=protstreng.length()*3) System.out.println("Indput filer er valide\n"); else System.out.println("Genstrengen skal vaerer min. 3*laengden af proteinstrengen."); System.exit(0); //for løkke til at hive en gensekvens ud med den rigtige længde for(int i=0;i<=(gen.length()-protstreng.length()*3);i++) kode.clear(); count=0; genstreng=gen.substring(i,i+protstreng.length()*3); fit=true; //for løkke til at hive aminosyre strengene ud for(int j=0;j<genstreng.length()&&fit==true;j+=3) amino=genstreng.substring(j,j+3); prot=protstreng.substring(count,count+1); //tjek om aminosyren findes i Hashtable

9 Bilag 1 if(kode.containskey(amino)) //tjek om aminosyren allerede har et billede if(!kode.get(amino).equals(prot)) fit=false; else fit=true; else //tilføjer nøgle og billede kode.put(amino,prot); count++; //end for j //udskriver Hashtable, hvis løsning er fundet if(count==protstreng.length()&&kode.size()>0)_ antal++; //sortering af hahstable Enumeration liste; liste=kode.keys(); String[] array=new String[kode.size()]; for(int k=0;k<kode.size();k++) array[k]=(string)liste.nextelement(); Arrays.sort(array); System.out.println(""); System.out.println("En mulig loesning er:"); System.out.println(""); for(int l=0;l<kode.size();l++) System.out.println(" ["+array[l]+"] -> "+kode.get(array[l])); System.out.println(""); System.out.println(" Antal aminosyrer: "+kode.size()); System.out.println(""); _ else forkert++; _ //end for i System.out.println("\nDer var "+antal+" mulige loesninger."); _

10 Bilag 2 //************************************************************************ // // LoadFile.java Lavet af: Jacob // // Et program til proteingenkendelse // //************************************************************************ //import af nødvendige klasser import cs1.keyboard; import java.io.*; public class LoadFile private String filename; //constructor public LoadFile(String file) filename = file; //Load metode public String Load() String line, longline=""; try //åbning af filen FileReader fr = new FileReader(filename); BufferedReader infile = new BufferedReader(fr); line = infile.readline(); //sammensætning af linjer til en lang while (line!=null) longline+=line; line = infile.readline(); infile.close(); catch (FileNotFoundException not_found) System.out.println ("Filen findes ikke."); catch (IOException io_error) System.out.println ("I/O fejl."); return longline;

11 Bilag 3 Velkommen til DNA Analyse 1.0 Indput filer er valide En mulig loesning er: [aat] -> R [agc] -> M [atg] -> M [att] -> Q [cta] -> S [gca] -> I [gct] -> H Antal aminosyrer: 7 En mulig loesning er: [att] -> R [caa] -> I [cta] -> H [gca] -> M [tag] -> S [tgc] -> M [ttg] -> Q Antal aminosyrer: 7 En mulig loesning er: [aat] -> I [agc] -> S [caa] -> M [gct] -> M [tag] -> H [tgc] -> Q [ttc] -> R Antal aminosyrer: 7 En mulig loesning er: [aat] -> M [agc] -> H [att] -> I [cta] -> M [gca] -> S [gct] -> Q [tca] -> R Antal aminosyrer: 7 En mulig loesning er: [att] -> M [caa] -> S [cat] -> R [cta] -> Q [gca] -> H [tag] -> M [ttg] -> I Antal aminosyrer: 7 Der var 5 mulige loesninger.

12 Bilag 4 Velkommen til DNA Analyse 1.0 Indput filer er valide En mulig loesning er: [aaa] -> K [aac] -> N [aag] -> K [aat] -> N [aca] -> T [acc] -> T [acg] -> T [act] -> T [aga] -> R [agc] -> S [agt] -> S [ata] -> I [atc] -> I [atg] -> M [att] -> I [caa] -> Q [cac] -> H [cag] -> Q [cat] -> H [cca] -> P [ccc] -> P [ccg] -> P [cct] -> P [cga] -> R [cgc] -> R [cgg] -> R [cgt] -> R [cta] -> L [ctc] -> L [ctg] -> L [ctt] -> L [gaa] -> E [gac] -> D [gag] -> E [gat] -> D [gca] -> A [gcc] -> A [gcg] -> A [gct] -> A [gga] -> G [ggc] -> G [ggg] -> G [ggt] -> G [gta] -> V [gtc] -> V [gtg] -> V [gtt] -> V [tac] -> Y [tat] -> Y [tca] -> S [tcc] -> S [tcg] -> S [tct] -> S [tgc] -> C [tgg] -> W [tgt] -> C [tta] -> L [ttc] -> F [ttg] -> L [ttt] -> F Antal aminosyrer: 60 Der var 1 mulige loesninger.

13 attgctagcaatgctagcaattgctagcaattcat Bilag 5

14 MSIQHMR Bilag 6

15 Bilag 7 cagctgtggtgtcatggtcggtgatcgctagggtgccgagcgcatctcgactgcacggtg caccaatgcttctggcgtcaggtagttattggaaagctgtggtatggctgtgcaggtcgt aaatcactgcataactcgctgctgcctaaggcgcactcccgttctggataatgttttttg cgccgacatcataacggttctggcaaatattctgaaatgagctgttgacaattaatcatc gaactagttaactagtacgcaagttcacgtaaaaagggtatcgacaatgaaagcaatttt cgtactgaaaggttggtggcgcacttcctgaaacgggcagtgtattcaccatgcgtaaag caatcagatacccagcccgcctaatgagcgggcttttttttgaacaaaattagagaataa caatgcaaacacaaaaaccgactctcgaactgctaacctgcgaaggcgcttatcgcgaca atcccaccgcgctttttcaccagttgtgtggggatcgtccggcaacgctgctgctggaat ccgcagatatcgacagcaaagatgatttaaaaagcctgctgctggtagacagtgcgctgc gcattacagctttaggtgacactgtcacaatccaggcactttccggcaacggcgaagccc tcctggcactactggataacgccctgcctgcgggtgtggaaagtgaacaatcaccaaact gccgtgtgctgcgcttcccccctgtcagtccactgctggatgaagacgcccgcttatgct ccctttcggtttttgacgctttccgtttattgcagaatctgttgaatgtaccgaaggaag aacgagaagccatgttcttcagcggcctgttctcttatgaccttgtggcgggatttgaag atttaccgcaactgtcagcggaaaataactgccctgatttctgtttttatctcgctgaaa cgctgatggtgattgaccatcagaaaaaaagcacccgtattcaggccagcctgtttgctc cgaatgaagaagaaaaacaacgtctcactgctcgcctgaacgaactacgtcagcaactga ccgaagccgcgccgccgctgccagtggtttccgtgccgcatatgcgttgtgaatgtaatc agagcgatgaagagttcggtggcgtagtgcgtttgttgcaaaaagcgattcgcgctggag aaattttccaggtggtgccatctcgccgtttctctctgccctgcccgtcaccgctggcgg cctattacgtgctgaaaaagagtaatcccagcccgtacatgttttttatgcaggataatg atttcaccctatttggcgcgtcgccggaaagctcgctcaagtatgatgccaccagccgcc agattgagatcccccggaattcgagctcgcccggggatcctctagagtcgacctgcagcc caagcttatcgatgataagctgtcaaacatgagaattaattcttgaagacgaaagggcct cgtgatacgcctatttttataggttaatgtcatgataataatggtttcttagacgtcagg tggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttctaaatacattc aaatatgtatccgctcatgagacaataaccctgataaatgcttcaataatattgaaaaag gaagagtatgagtattcaacatttccgtgtcgcccttattcccttttttgcggcattttg ccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagtt gggtgcacgagtgggttacatcgaactggatctcaacagcggtaagatccttgagagttt tcgccccgaagaacgttttccaatgatgagcacttttaaagttctgctatgtggcgcggt attatcccgtgttgacgccgggcaagagcaactcggtcgccgcatacactattctcagaa tgacttggttgagtactcaccagtcacagaaaagcatcttacggatggcatgacagtaag agaattatgcagtgctgccataaccatgagtgataacactgcggccaacttacttctgac aacgatcggaggaccgaaggagctaaccgcttttttgcacaacatgggggatcatgtaac tcgccttgatcgttgggaaccggagctgaatgaagccataccaaacgacgagcgtgacac cacgatgcctgtagcaatggcaacaacgttgcgcaaactattaactggcgaactacttac tctagcttcccggcaacaattaatagactggatggaggcggataaagttgcaggaccact tctgcgctcggcccttccggctggctggtttattgctgataaatctggagccggtgagcg tgggtctcgcggtatcattgcagcactggggccagatggtaagccctcccgtatcgtagt tatctacacgacggggagtcaggcaactatggatgaacgaaatagacagatcgctgagat aggtgcctcactgattaagcattggtaactgtcagaccaagtttactcatatatacttta gattgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataa tctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgtaga aaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaac aaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctaccaactctttt tccgaaggtaactggcttcagcagagcgcagataccaaatactgtccttctagtgtagcc gtagttaggccaccacttcaagaactctgtagcaccgcctacatacctcgctctgctaat cctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaag acgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagcc cagcttggagcgaacgacctacaccgaactgagatacctacagcgtgagcattgagaaag cgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaac aggagagcgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgtcgg gtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagcct atggaaaaacgccagcaacgcggcctttttacggttcctggccttttgctggccttttgc tcacatgttctttcctgcgttatcccctgattctgtggataaccgtattaccgcctttga gtgagctgataccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgagga agcggaagagcgcctgatgcggtattttctccttacgcatctgtgcggtatttcacaccg catatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagtatacact ccgctatcgctacgtgactgggtcatggctgcgccccgacacccgccaacacccgctgac gcgccctgacgggcttgtctgctcccggcatccgcttacagacaagctgtgaccgtctcc gggagctgcatgtgtcagaggttttcaccgtcatcaccgaaacgcgcgagg

16 Bilag 8 MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGK ILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPV TEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEAD KVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQ ATMDERNRQIAEIGASLIKHW

Modul 3: Sandsynlighedsregning

Modul 3: Sandsynlighedsregning Forskningsenheden for Statistik ST01: Elementær Statistik Bent Jørgensen Modul 3: Sandsynlighedsregning 3.1 Sandsynligheder................................... 1 3.2 Tilfældig udtrækning fra en mængde........................

Læs mere

DM01 DM01. 3. Obl. Afl. Jacob Christiansen, 130282, jacob.ch@mail.tdcadsl.dk. D12, Elias 18/3-2003. Side 1 af 11

DM01 DM01. 3. Obl. Afl. Jacob Christiansen, 130282, jacob.ch@mail.tdcadsl.dk. D12, Elias 18/3-2003. Side 1 af 11 DM01 DM01 3. Obl. Afl. Jacob Christiansen, 130282, jacob.ch@mail.tdcadsl.dk D12, Elias 18/3-2003 Side 1 af 11 DM01 Indholdsfortegnelse: BILAG:...2 1 FORMÅL:...3 2 KLASSER:...4 2.1 DILEMMA:...4 2.1.1 METODER:...4

Læs mere

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 2

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 2 DM502 Forelæsning 2 Repetition Kompilere og køre Java program javac HelloWorld.java java HeloWorld.java Debugge Java program javac -g HelloWorld.java jswat Det basale Java program public class HelloWorld

Læs mere

(19) DANMARK (11) DK B1 (12) PATENTSKRIFT. Ci2. Patent- og Varemærkestyrelsen

(19) DANMARK (11) DK B1 (12) PATENTSKRIFT. Ci2. Patent- og Varemærkestyrelsen (19) DANMARK (11) DK 176903 B1 Ci2 (12) PATENTSKRIFT Patent- og Varemærkestyrelsen (51) Int.CI. 8 : C 12 N 15/31 (2006.01) A 61 K 39/02 (2006.01) A 61 K 48/00 (2006.01) A 61 P 31/04 (2006.01) C 07 K 14/29

Læs mere

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 3

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 3 DM502 Forelæsning 3 Indlæsning fra tastatur Udskrift til skærm Repetition Beregning af middelværdi Gentagelse med stop-betingelse (while) Heltalsdivision Division med nul Type-casting ( (double) ) Betinget

Læs mere

Jacob Christiansen, Institut for MAtematik og DAtalogi, Syddansk Universitet, Odense

Jacob Christiansen, Institut for MAtematik og DAtalogi, Syddansk Universitet, Odense 7 DM -. Obligatoriske Opgave Løsning af ligningssystem vha. fipunktmetoden Jacob Christiansen, 8 moffe@imada.sdu.dk Institut for MAtematik og DAtalogi, Syddansk Universitet, Odense. Opgaven Der skal implementeres

Læs mere

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 4

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 4 DM502 Forelæsning 4 Flere kontrolstrukturer for-løkke switch-case Metoder Indhold Arrays og sortering af arrays String-funktioner for-løkke Ofte har man brug for at udføre det samme kode, for en sekvens

Læs mere

//Udskriver System.out.println("Hej " + ditfornavn + " " + ditefternavn + "."); System.out.println("Du er " + dinalder + " aar gammel!

//Udskriver System.out.println(Hej  + ditfornavn +   + ditefternavn + .); System.out.println(Du er  + dinalder +  aar gammel! Denne guide er oprindeligt udgivet på Eksperten.dk Brugerinput i Java Denne her artikel gennemgår diverse ting ved brug af brugerinput i Java. Den starter med det simple og fortæller derefter skridt for

Læs mere

(19) DANMARK (11) DK 175533 B1 ( 1 2) PATENTSKRIFT. Patent- og Varemærkestyrelsen

(19) DANMARK (11) DK 175533 B1 ( 1 2) PATENTSKRIFT. Patent- og Varemærkestyrelsen (19) DANMARK (11) DK 175533 B1 ( 1 2) PATENTSKRIFT Patent- og Varemærkestyrelsen (51) Int.C1 7.: A 61 K 39/295 A 61 K 39/205 A 61 K 39/285 A 61 K 39/42 C 12 N 15/00 (21) Patentansøgning nr: PA 1985 06062

Læs mere

Videregående Programmering Obligatorisk opgave - 3. semester, efterår 2004

Videregående Programmering Obligatorisk opgave - 3. semester, efterår 2004 Overvågningssystem Beskrivelse Bagagesorteringssystemet består af et antal skranker (check-in) til modtagelse og registrering af bagage, et automatiseret sorteringsanlæg samt et antal terminaler (gates),

Læs mere

University of Southern Denmark Syddansk Universitet. DM503 Forelæsning 11

University of Southern Denmark Syddansk Universitet. DM503 Forelæsning 11 DM503 Forelæsning 11 Generics Pakker Exceptions Indhold Generics Nedarvning og Generics Generics Nedarvning og Generics Husk Box fra sidst Generics public class Box {! private T object;! public void

Læs mere

Kursus i OOP og Java. Kursus i Objektorienteret programmering i Java

Kursus i OOP og Java. Kursus i Objektorienteret programmering i Java Kursus i OOP og Java Kursus i Objektorienteret programmering i Java Åben Dokumentlicens Dette foredragsmateriale er under Åben Dokumentlicens (ÅDL) Du har derfor lov til frit at kopiere dette værk Bruger

Læs mere

Eksempel: Skat i år 2000

Eksempel: Skat i år 2000 Kursus 02199: Programmering afsnit 2.1-2.7 Anne Haxthausen IMM, DTU 1. Værdier og typer (bl.a. char, boolean, int, double) (afsnit 2.4) 2. Variable og konstanter (afsnit 2.3) 3. Sætninger (bl.a. assignments)

Læs mere

Fra DNA til protein - lærerens tekst

Fra DNA til protein - lærerens tekst Fra DNA til protein - lærerens tekst Af sidsel sangild Denne øvelse handler om proteinsyntese og proteiners foldning. Den giver mulighed for at danne nogle andre billeder af fænomenet, end man får ved

Læs mere

(19) DANMARK. 2six,l (12) PATENTSKRIFT. Patent- og Varemærkestyrelsen (11) DK 175072 B1

(19) DANMARK. 2six,l (12) PATENTSKRIFT. Patent- og Varemærkestyrelsen (11) DK 175072 B1 (19) DANMARK (11) DK 175072 B1 2six,l (12) PATENTSKRIFT Patent- og Varemærkestyrelsen (51) Int.C1 7.: C 12 N 15/38 A 61 K 39/245 C 12 N 15/63 G 01 N 33/569 (21) Patentansøgning nr: PA 1987 02888 (22).

Læs mere

Søgemaskineprojekt. Analyse og implementering af en søgemaskine og en crawler til denne. Vejleder: Theis Rauhe (theis@it-c.dk)

Søgemaskineprojekt. Analyse og implementering af en søgemaskine og en crawler til denne. Vejleder: Theis Rauhe (theis@it-c.dk) Søgemaskineprojekt Analyse og implementering af en søgemaskine og en crawler til denne Morten Franck (skyfer@it-c.dk) Vejleder: Theis Rauhe (theis@it-c.dk) Peter G. Hansen (gath@it-c.dk) Påbegyndt den

Læs mere

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et:

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: F2011-Opgave 1. En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: Forward primer: 5 CC ATG GGT ATG AAG CTT TGC AGC CTT

Læs mere

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 6

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 6 DM502 Forelæsning 6 Klasser og objekter Introduktion Math-klassen Indhold Klasser vs. objekter Først et tænkt eksempel: Vi vil lave en bil i Java 1. spørgsmål: Hvad karakteriserer en bil? Model År Farve...

Læs mere

DM01 DM01. 2. Obl. Afl. Jacob Christiansen, 130282, jacob.ch@mail.tdcadsl.dk. D12, Elias 18/3-2003. Side 1 af 9

DM01 DM01. 2. Obl. Afl. Jacob Christiansen, 130282, jacob.ch@mail.tdcadsl.dk. D12, Elias 18/3-2003. Side 1 af 9 DM01 2. Obl. Afl. Jacob Christiansen, 130282, jacob.ch@mail.tdcadsl.dk D12, Elias 18/3-2003 Side 1 af 9 Indhold 1. Formål... s. 3 2. Klasser... s. 3 2.1. Player... s. 3 2.1.1. Metoder... s. 3 2.1.1.1.

Læs mere

Genetiske afstande og afstandsmatricer

Genetiske afstande og afstandsmatricer Genetiske afstande og afstandsmatricer Denne vejledning indeholder en række små øvelser og opgaver der illustrerer, hvordan man ud fra genetiske sekvenser kan udregne en gennemsnitlig evolutionær afstand

Læs mere

BIOS. Celledeling hos en bananflue KOPIARK 135 GENETIK

BIOS. Celledeling hos en bananflue KOPIARK 135 GENETIK KOPIARK 135 GENETIK Celledeling hos en bananflue Her er en celle fra en bananflue. Tegn det rigtige antal kromosomer i cellekernen. Se Grundbog B, s. 106. Hvor mange kromosomer har en bananflue i hver

Læs mere

Hanne Niels Edith Harald Carsten Jørgen Henrik.

Hanne Niels Edith Harald Carsten Jørgen Henrik. Programmering 1999 Forelæsning 18, fredag 5 november 1999 Anvendelse af udvalgssortering Quicksort Rapportopgave Programmering 1999 KVL Side 18-1 Eksempel 2 på anvendelse af udvalgssortering Sortering

Læs mere

Løsning af møntproblemet

Løsning af møntproblemet Løsning af møntproblemet Keld Helsgaun RUC, oktober 1999 Antag at tilstandene i problemet (stillingerne) er repræsenteret ved objekter af klassen State. Vi kan da finde en kortest mulig løsning af problemet

Læs mere

Datalogi OB, Efterår 2002 OH er, forelæsning 3/9-2002 - forstå datastrukturer og algoritmer (teoretisk forståelse og intuition)

Datalogi OB, Efterår 2002 OH er, forelæsning 3/9-2002 - forstå datastrukturer og algoritmer (teoretisk forståelse og intuition) Datalogi OB, Efterår 2002 OH er, forelæsning 3/9-2002 Datastrukturer og algoritmer Henning Christiansen henning@ruc.dk http://www.ruc.dk/~henning Formål: at kunne - forstå datastrukturer og algoritmer

Læs mere

DM502. Peter Schneider-Kamp (petersk@imada.sdu.dk) http://imada.sdu.dk/~petersk/dm502/

DM502. Peter Schneider-Kamp (petersk@imada.sdu.dk) http://imada.sdu.dk/~petersk/dm502/ DM502 Peter Schneider-Kamp (petersk@imada.sdu.dk) http://imada.sdu.dk/~petersk/dm502/ 1 DM502 Bog, ugesedler og noter De første øvelser Let for nogen, svært for andre Kom til øvelserne! Lav opgaverne!

Læs mere

S 1 S 2 S 3 S 4 S S S S Fig. 1

S 1 S 2 S 3 S 4 S S S S Fig. 1 Bilag: Udskrift af klassen EvolutionaryTree.java Udskrift af klassen Edge.java Formål: Der skal konstrueres et evolutionstræ, også omtalt som det letteste udspændende træ. Træet skal have n input, som

Læs mere

Kromosomer med genet: Genotype (= arveformel): RR Rr rr Fænotype (= fremtoning): Rød Rød Hvid

Kromosomer med genet: Genotype (= arveformel): RR Rr rr Fænotype (= fremtoning): Rød Rød Hvid Kromosomer med genet: R R R r r r Genotype (= arveformel): RR Rr rr Fænotype (= fremtoning): Rød Rød Hvid P-generation: Kønsceller: RR rr Meiose R R r r Befrugtning F 1-generation: Meiose Rr Rr Kønsceller:

Læs mere

I profil-feltet kan imastra-kunder vælge om upload skal ske ligesom filerne var indsendt til mailboksen eller

I profil-feltet kan imastra-kunder vælge om upload skal ske ligesom filerne var indsendt til mailboksen eller Upload fil Upload fil skal ses som et alternativ til at indsende tællefiler vedhæftet til mails Upload fil kan være en hurtigere og mere håndholdt måde at få data ind i Mastra på. Man starter med via Gennemse

Læs mere

BRP 6.9.2006 Kursusintroduktion og Java-oversigt

BRP 6.9.2006 Kursusintroduktion og Java-oversigt BRP 6.9.2006 Kursusintroduktion og Java-oversigt 1. Kursusintroduktion 2. Java-oversigt (A): Opgave P4.4 3. Java-oversigt (B): Ny omvendings -opgave 4. Introduktion til næste kursusgang Kursusintroduktion:

Læs mere

Indledning. Hvorfor det forholder sig sådan har jeg en masse idéer om, men det bliver for meget at komme ind på her. God fornøjelse med læsningen.

Indledning. Hvorfor det forholder sig sådan har jeg en masse idéer om, men det bliver for meget at komme ind på her. God fornøjelse med læsningen. Indledning...2 Variabler...13 Eksempel: 1...13 Eksempel 2:...13 Eksempel 3:...15 Eksempel 4:...16 Metoder...17 Metode (intet ind og intet ud)...17 Metode (tekst ind)...18 Metode (tekst ind og tekst ud)...19

Læs mere

AAU, Programmering i Java Intern skriftlig prøve 18. maj 2007

AAU, Programmering i Java Intern skriftlig prøve 18. maj 2007 AAU, Programmering i Java Intern skriftlig prøve 18. maj 2007 Opgavebesvarelsen skal afleveres som enten en printerudskrift eller som et passende dokument sendt via email til fjj@noea.dk. Besvarelsen skal

Læs mere

Civilingeniøreksamen 49104 12. januar 2001. Skriftelig prøve den 12. januar 2001 Kursusnummer 49104

Civilingeniøreksamen 49104 12. januar 2001. Skriftelig prøve den 12. januar 2001 Kursusnummer 49104 Skriftelig prøve den 12. januar 2001 Kursusnummer 49104 Kursusnavn: Programmering. Tilladte hjælpemidler: Alle skriftlige hjælpemidler Opgavesættet består af fire opgaver, der har følgende vægtning: Opgave

Læs mere

Databaseadgang fra Java

Databaseadgang fra Java Databaseadgang fra Java Grundlæggende Programmering med Projekt Peter Sestoft Fredag 2007-11-23 Relationsdatabasesystemer Der er mange databaseservere Microsoft Access del af Microsoft Office MySQL god,

Læs mere

Geografisk lokalisering i JSP

Geografisk lokalisering i JSP Denne guide er oprindeligt udgivet på Eksperten.dk Geografisk lokalisering i JSP Denne artikel forklarer lidt om hvorfor og hvordan man laver geografisk lokalisering og viser noget kode. Der er andre artikler

Læs mere

Test af It-komponent

Test af It-komponent Test af It-komponent I programmeringssproget Java Programmet Login service Elev: Mads Funch Klasse 2.4 Mat, It, Programmering Skole: Roskilde Tekniske Gymnasium HTX Underviser: Karl Dato: 31-08-2016 Side

Læs mere

Kursus navn: Indledende programmering Kursus nr. 02101

Kursus navn: Indledende programmering Kursus nr. 02101 Danmarks Tekniske Universitet Side 1 af 8 sider Skriftlig prøve, den 15. december 2007 Kursus navn: Indledende programmering Kursus nr. 02101 Tilladte hjælpemidler: Alle skriftlige hjælpemidler Vægtning

Læs mere

Hvad er Objekter - Programmering

Hvad er Objekter - Programmering Denne guide er oprindeligt udgivet på Eksperten.dk Hvad er Objekter - Programmering En rigtig god gennemgang af hvad objekter er! Hvordan de oprettes og anvendes! Det er helt klart til nybegyndere, som

Læs mere

Dag 10 Flertrådet programmering

Dag 10 Flertrådet programmering Videregående programmering i Java Dag 10 Flertrådet programmering Fremlæggelse af programmering/status for projekter Dokumentation med javadoc Flertrådede designmønstre: Arbejdstråd, Producent Konsument,

Læs mere

Introduktion til ActionScript

Introduktion til ActionScript Introduktion til ActionScript Kaspar Rosengreen Nielsen kaspar@interactivespaces.net i n t e r a c t i v e s p a c e s. n e t Kaspar Nielsen, kaspar@interactivespaces.net 1 Dagens program Opsamling på

Læs mere

MySQL i Java. Tutorial lavet af Jákup W. Hansen TSU 2006 2.semester 05.januar 2007

MySQL i Java. Tutorial lavet af Jákup W. Hansen TSU 2006 2.semester 05.januar 2007 MySQL i Java Tutorial lavet af Jákup W. Hansen TSU 2006 2.semester 05.januar 2007 Hvad er MySQL? Det er et database system, som er gratis for os at bruge. Det er lidt mere besværligt i starten at bruge

Læs mere

Virkefeltsregler i Java

Virkefeltsregler i Java Virkefeltsregler i Java int i; int k; Sequence s; int j; What s in a name? Brian spillede blændende i søndags! Skolen ligger i Viby Ring til Kirsten og sig at... Et navn fortolkes i en kontekst og konteksten

Læs mere

9.8 Kildekode. side 88. Pakke Klasse Sidenummer. fortsætter..

9.8 Kildekode. side 88. Pakke Klasse Sidenummer. fortsætter.. 9.8 Kildekode Pakke Klasse Sidenummer db Aktivitetstype 91 Behandler 91 ConnectDB 92 DagensKommentar 93 Helligdag 94 IkkePrimaerTid 94 Patient 96 Patientaftale 96 PatientAktivitet 97 Patientgruppe 98 PatientgruppeItem

Læs mere

SAX Simple API for XML.

SAX Simple API for XML. SAX Simple API for XML. En API (Application Programming Interface) et bibliotek eller et sæt af funktioner eller metoder. SAX er et sådant bibliotek af abstrakte metoder som f. eks. startdocument() eller

Læs mere

Sekvensafstand DM34 - Eksamensopgave. Jacob Aae Mikkelsen

Sekvensafstand DM34 - Eksamensopgave. Jacob Aae Mikkelsen Sekvensafstand DM34 - Eksamensopgave Jacob Aae Mikkelsen 19 10 76 kokken@grydeske.dk 27. maj 2005 Resumé Rapporten her beskriver tre forskellige rekursive metoder til at sammenligne tekst strenge med.

Læs mere

dintprog Manual Revision: 731 September 30, 2009 1 Introduktion 3 1.1 Notation... 3 I Begreber 4 2 Grundbegreber om programmering 4

dintprog Manual Revision: 731 September 30, 2009 1 Introduktion 3 1.1 Notation... 3 I Begreber 4 2 Grundbegreber om programmering 4 dintprog Manual Revision: 731 September 30, 2009 Indhold 1 Introduktion 3 1.1 Notation................................. 3 I Begreber 4 2 Grundbegreber om programmering 4 3 Grundbegreber om modellering

Læs mere

Forelæsning Uge 2 Torsdag

Forelæsning Uge 2 Torsdag Forelæsning Uge 2 Torsdag Java syntax og style guide Sætninger Simple sætninger (assignment, interne og eksterne metodekald) Sammensatte sætninger (blok, selektion, gentagelse) Udtryk og operatorer Brug

Læs mere

Forelæsning Uge 2 Mandag

Forelæsning Uge 2 Mandag Forelæsning Uge 2 Mandag Sætninger Simple sætninger (assignment, interne og eksterne metodekald) Sammensatte sætninger (blok, selektion, gentagelse) Udtryk og operatorer Java syntax og style guide Afleveringsopgave:

Læs mere

Sekvenser af længde mellem 1 og 4 ord repræsenteres ved en klasse Segment, som uden grundlæggende ser således ud:

Sekvenser af længde mellem 1 og 4 ord repræsenteres ved en klasse Segment, som uden grundlæggende ser således ud: Besvarelse af opgave til formuleret til øvelserne 10. september 2002 Datastrukturer og algoritmer Henning Christiansen 22/9-2002 Følgende er ikke en eksakt besvarelse af opgaven, idet den benytter hashtabeller

Læs mere

Forelæsning Uge 3 Torsdag

Forelæsning Uge 3 Torsdag Forelæsning Uge 3 Torsdag Billedredigering Gråtonebilleder (som er lidt simplere end farvebilleder) Arrays Kan "opbevare" et antal objekter (som ArrayList) Fast (på forhånd kendt) antal elementer Afleveringsopgave:

Læs mere

En kort introduktion til JDBC

En kort introduktion til JDBC En kort introduktion til JDBC af Henrik Bulskov Datalogi Roskilde Universitetscenter 22. marts 2001 JDBC er et generelt klassebibliotek til kommunikation med databaser. Det er ikke målrettet en bestemt

Læs mere

Rekursion og dynamisk programmering

Rekursion og dynamisk programmering Rekursion og dynamisk programmering Datastrukturer & Algoritmer, Dat C Forelæsning 12/10-2004 Henning Christiansen Rekursion: at en procedure kalder sig selv eller et antal metoder kalder hinanden gensidigt.

Læs mere

XML parsning i Java. Denne artikel beskriver hvordan man parser XML i Java. Den beskriver W3C DOM, SAX og JDOM.

XML parsning i Java. Denne artikel beskriver hvordan man parser XML i Java. Den beskriver W3C DOM, SAX og JDOM. Denne guide er oprindeligt udgivet på Eksperten.dk XML parsning i Java Denne artikel beskriver hvordan man parser XML i Java. Den beskriver W3C DOM, SAX og JDOM. Den forudsætter kendskab til Java og XML.

Læs mere

dintprog Manual Revision: 1241 August 24, 2010 I Introduktion 3 1 Notation 3 II Begreber 4 2 Grundbegreber om programmering 4

dintprog Manual Revision: 1241 August 24, 2010 I Introduktion 3 1 Notation 3 II Begreber 4 2 Grundbegreber om programmering 4 dintprog Manual Revision: 1241 August 24, 2010 Indhold I Introduktion 3 1 Notation 3 II Begreber 4 2 Grundbegreber om programmering 4 3 Grundbegreber om modellering 4 III Sprogkonstruktioner 5 4 Klasser

Læs mere

Geografisk lokalisering i ASP.NET

Geografisk lokalisering i ASP.NET Denne guide er oprindeligt udgivet på Eksperten.dk Geografisk lokalisering i ASP.NET Denne artikel forklarer lidt om hvorfor og hvordan man laver geografisk lokalisering og viser noget kode. Der er andre

Læs mere

SigmaT.

SigmaT. Java + Groovy Disposition Om SigmaT Eksempel på indlejring af Groovy Overvågning af PEM Ønske om dynamisk loaded Java uden at fifle med classloaderen Groovy til hjælp Opsamling hvad jeg ikke har fortalt

Læs mere

Servlets, Tomcat & BlueJ

Servlets, Tomcat & BlueJ Servlets, Tomcat & BlueJ Tutorial lavet af Jákup W. Hansen TSU 2006 3.semester 05.october 2007 Hvad er Servlets: For at forstå det, må vi først få styr på to begreber, nemlig statiske og dynamiske hjemmesider

Læs mere

Optimering af fraværsregistrering

Optimering af fraværsregistrering Journal Optimering af fraværsregistrering Eksamensprojekt i Programmering C, klasse 3.4, 2011 AFLEVERET 09-05-2014 Indhold Abstract... Fejl! Bogmærke er ikke defineret. Problemformulering... 2 Produktet...

Læs mere

Kursusarbejde 3 Grundlæggende Programmering

Kursusarbejde 3 Grundlæggende Programmering Kursusarbejde 3 Grundlæggende Programmering Arne Jørgensen, 300473-2919 klasse dm032-1a 21. november 2003 Indhold 1. Kode 2 1.1. forestillinger.h............................................. 2 1.2. forestillinger.cc.............................................

Læs mere

Noter og opgaver. Programmering A IMADA. Niels Kjeldsen & Jacob Aae Mikkelsen. Med grundig korrektur og rettelser af Edmund Christiansen

Noter og opgaver. Programmering A IMADA. Niels Kjeldsen & Jacob Aae Mikkelsen. Med grundig korrektur og rettelser af Edmund Christiansen Programmering A IMADA Noter og opgaver Niels Kjeldsen & Jacob Aae Mikkelsen Med grundig korrektur og rettelser af Edmund Christiansen Noter til Programmering A INDHOLD Indhold 1 Indledning 3 2 Kom i gang

Læs mere

Abstrakte datatyper C#-version

Abstrakte datatyper C#-version Note til Programmeringsteknologi Akademiuddannelsen i Informationsteknologi Abstrakte datatyper C#-version Finn Nordbjerg 1/9 Abstrakte Datatyper Denne note introducerer kort begrebet abstrakt datatype

Læs mere

O l e 3 1 2. 2 \n I b 1 1 1 1 7 \n. Ole 312.2 Ib 11117 TT_EOF. Ole 312.2. Ib 11117. Overview Tekstfiler, tegn og brikker

O l e 3 1 2. 2 \n I b 1 1 1 1 7 \n. Ole 312.2 Ib 11117 TT_EOF. Ole 312.2. Ib 11117. Overview Tekstfiler, tegn og brikker Programmering 1999 Forelæsning 8, fredag 24. september 1999 Overview Tekstfiler, tegn og brikker StreamTokenizer: indlæsning fra tekstfiler Formateret udskrift Programmering 1999 KVL Side 8-1 Tekstfiler

Læs mere

Protein databases Rasmus Wernersson. (Slides af Henrik Nielsen & Morten Nielsen).

Protein databases Rasmus Wernersson. (Slides af Henrik Nielsen & Morten Nielsen). Protein databases Rasmus Wernersson (Slides af Henrik Nielsen & Morten Nielsen). Background- Nucleotide databases GenBank, http://www.ncbi.nlm.nih.gov/genbank/ National Center for Biotechnology Information

Læs mere

dmasark Aflevering - Uge 50

dmasark Aflevering - Uge 50 dmasark Aflevering - Uge 50 Michael Lind Mortensen, 20071202, DAT4 Michael Dahl, 20073943, DAT4 Katalog: http://www.daimi.au.dk/ u073943/dmasark/uge6/ 13. december 2007 Indhold 1 PingClient implementation

Læs mere

Tredjepart webservices

Tredjepart webservices Tredjepart webservices 4. juni 2015 USS Dok. Klik her for at angive tekst. 1/12 Indholdsfortegnelse Introduktion... 3 Miljøer... 3 Adgang... 3 API kald... 4 GET: /authorizations... 4 Input 4 Output 4 Output

Læs mere

Opgaven fortsat. Opfølgning på Opgave 2 og Use Cases. Opgaven. Trin 1: Væsentlige begreber. Resultatliste: 100 bryst, herrer

Opgaven fortsat. Opfølgning på Opgave 2 og Use Cases. Opgaven. Trin 1: Væsentlige begreber. Resultatliste: 100 bryst, herrer Opfølgning på Opgave 2 og Use Cases originally by Michael R. Hansen modified/extended by Anne E. Haxthausen Informatics and Mathematical Modelling Technical University of Denmark Opgaven fortsat Efter

Læs mere

Datalogi C, Efterår 2004 OH er, forelæsning 14/ Datastrukturer og algoritmer. Henning Christiansen

Datalogi C, Efterår 2004 OH er, forelæsning 14/ Datastrukturer og algoritmer. Henning Christiansen Datalogi C, Efterår 2004 OH er, forelæsning 14/9-2004 Datastrukturer og algoritmer Henning Christiansen henning@ruc.dk http://www.ruc.dk/~henning Kursusweb: http://www.ruc.dk/~henning/datce2004/ Formål:

Læs mere

Forelæsning Uge 2 Mandag

Forelæsning Uge 2 Mandag Forelæsning Uge 2 Mandag Sætninger Simple sætninger (assignment, interne og eksterne metodekald) Sammensatte sætninger (blok, selektion, gentagelse) Udtryk og operatorer Java syntax og style guide Afleveringsopgave:

Læs mere

RMI introduktion. Denne artikel beskriver Java RMI (Remtote Method Invocation).

RMI introduktion. Denne artikel beskriver Java RMI (Remtote Method Invocation). Denne guide er oprindeligt udgivet på Eksperten.dk RMI introduktion Denne artikel beskriver Java RMI (Remtote Method Invocation). Den beskriver teorien bag RMI, viser et simpelt kode eksempel og forklarer

Læs mere

Nye features i Java 1.5/5.0

Nye features i Java 1.5/5.0 Denne guide er oprindeligt udgivet på Eksperten.dk Nye features i Java 1.5/5.0 Denne artikel beskriver nye features i Java 1.5/5.0, som lige er kommet i final (ikke-beta) udgave. Den forudsætter et vist

Læs mere

import java.awt.event.*; import java.awt.*; Container <- Panel <- Applet Component <- Button <- Checkbox <- ScrollPane <- Label

import java.awt.event.*; import java.awt.*; Container <- Panel <- Applet Component <- Button <- Checkbox <- ScrollPane <- Label Programmering 1999 Forelæsning 13, tirsdag 12. oktober 1999 Oversigt Grafiske brugergrænseflader. Komponenter: Knapper, tekstfelter, checkbokse... Vinduer (containere). Hændelser, hændelsesstyret programmering.

Læs mere

Serialization i Java

Serialization i Java Serialization i Java Tutorial lavet af Jákup W. Hansen TSU 2006 1.semester 06.novemter 2006 Hvad er Serialization? I vores tekstbog Objects First with Java bliver denne del af Java ikke gennemgået. Men

Læs mere

Skjulte Markov Modeller og Genidentifikation 2003

Skjulte Markov Modeller og Genidentifikation 2003 Aarhus Universitet 18. december 2003 Datalogisk Institut Ny Munkegade, Bldg. 540 8000 Århus C Skjulte Markov Modeller og Genidentifikation 2003 Niels Christian Bach 19951570 Torben Lauritzen 19940336 Dette

Læs mere

Noter til C# Programmering Iteration

Noter til C# Programmering Iteration Noter til C# Programmering Iteration Programflow Programmer udfører det meste af deres arbejde vha. forgrening og løkker. Løkker Mange programmeringsproblemer kan løses ved at gentage en handling på de

Læs mere

Java Programmering. En bog for begyndere. Skrevet af Henrik Kressner

Java Programmering. En bog for begyndere. Skrevet af Henrik Kressner Java Programmering En bog for begyndere Skrevet af Henrik Kressner Indholdsfortegnelse Introduktion...3 1 Introduktion til Java...4 1.1 Javakoden...4 1.2 Det første program...6 1.2 Skriv til skærmen...6

Læs mere

SWC eksamens-spørgsmål. Oversigt

SWC eksamens-spørgsmål. Oversigt SWC eksamens-spørgsmål Oversigt #1 Typer og variable #2 Aritmetik og logik #3 Klasser (definition, objekter) #4 Klasser (metoder) #5 Klasser (nedarvning, polymorfi) #6 Conditional statements #7 Repetition

Læs mere

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 10

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 10 DM502 Forelæsning 10 Rekursion Fakultet n! Fibonaccitallene 2. projektopgave Opgaven Formalia Indhold Rekursion Rekursion Prøv at definere en liste af tal uden at bruge ordet liste Rekursion Prøv at definere

Læs mere

Singleton pattern i Java

Singleton pattern i Java Denne guide er oprindeligt udgivet på Eksperten.dk Singleton pattern i Java Denne artikel beskriver Singleton pattern og implementation i Java. Den forudsætter kendskab til Java men ikke til Singleton.

Læs mere

Undtagelseshåndtering i C#

Undtagelseshåndtering i C# Denne guide er oprindeligt udgivet på Eksperten.dk Undtagelseshåndtering i C# I modsætning til C++ kan man i C# ikke skrive et program uden undtagelseshåndtering, så derfor har jeg skrevet denne guide

Læs mere

Hashing og hashtabeller

Hashing og hashtabeller Datastrukturer & Algoritmer, Datalogi C Forelæsning 12/11-2002 Hashing og hashtabeller Teknik til at repræsentere mængder Konstant tid for finde og indsætte men ingen sortering af elementerne Specielt

Læs mere

Tabelbegrebet. Klassediagrammer (III) Oversigt. Anvendelse af Tabeller. Tabeller og qualified associations

Tabelbegrebet. Klassediagrammer (III) Oversigt. Anvendelse af Tabeller. Tabeller og qualified associations Tabelbegrebet Klassediagrammer (III) Tabeller og qualified associations originally by Michael R. Hansen modified/extended by Anne E. Haxthausen Informatics and Mathematical Modelling Technical University

Læs mere

14.1 Internationale programmer

14.1 Internationale programmer 14.1 Internationale programmer Når et program skal anvendes af flere kulturer og sprog opstår behov for at programtekster, beløb og datoangivelser afhænger af landet og sproget, og man må i gang med at

Læs mere

11. nationale biologiolympiade 2015. Tirsdag den 11. november 2014 Varighed: 90 minutter

11. nationale biologiolympiade 2015. Tirsdag den 11. november 2014 Varighed: 90 minutter 11. nationale biologiolympiade 2015 Tirsdag den 11. november 2014 Varighed: 90 minutter Opgaverne besvares direkte på svararket! Uden hjælpemidler! Husk at overføre alle svar til svararket! Kun svararket

Læs mere

Tree klassen fra sidste forelæsning

Tree klassen fra sidste forelæsning Programmering 1999 Forelæsning 12, fredag 8. oktober 1999 Oversigt Abstrakte klasser. Grænseflader. Programmering 1999 KVL Side 12-1 Tree klassen fra sidste forelæsning class Tree { int age; // in years

Læs mere

PROGRAM. using System; using System.Collections.Generic; using System.Text; using System.Collections;

PROGRAM. using System; using System.Collections.Generic; using System.Text; using System.Collections; PROGRAM using System; using System.Collections.Generic; using System.Text; using System.Collections; namespace EventManager class Program static void Main(string[] args) string hovedmenu = ""; string svar;

Læs mere

Systemkald DM14. 1. Obligatoriske opgave. Antal sider: 7 inkl. 2 bilag Afleveret: d. 18/3-2004 Afleveret af: Jacob Christiansen, 130282-2111

Systemkald DM14. 1. Obligatoriske opgave. Antal sider: 7 inkl. 2 bilag Afleveret: d. 18/3-2004 Afleveret af: Jacob Christiansen, 130282-2111 DM14 1. Obligatoriske opgave Systemkald Antal sider: 7 inkl. 2 bilag Afleveret: d. 18/3-2004 Afleveret af: Jacob Christiansen, 130282-2111 Side 1 af 5 Intro: Formålet med opgaven at et lave en system kald

Læs mere

Forelæsning Uge 2 Torsdag

Forelæsning Uge 2 Torsdag Forelæsning Uge 2 Torsdag Niveauer af programbeskrivelser Statiske / dynamiske beskrivelser Klassevariabler og klassemetoder Variabler og metoder der et tilknyttet klassen (i stedet for at være tilknyttet

Læs mere

Integer.parseInt(args[0]) konverterer tegnstreng (f.eks. "10") til heltal (10). if (udtryk) else

Integer.parseInt(args[0]) konverterer tegnstreng (f.eks. 10) til heltal (10). if (udtryk) else Programmering 1999 Forelæsning 2, fredag 3. september 1999 Betingede ordrer: if-, if Indlejrede betingede ordrer Løkker med begrænset iteration: for Løkker med ubegrænset iteration: while Betingede ordrer,

Læs mere

Speciale. Evaluering af Java til udvikling af indlejrede realtidssystemer ved brug af en eksisterende Java Optimized Processor (JOP)

Speciale. Evaluering af Java til udvikling af indlejrede realtidssystemer ved brug af en eksisterende Java Optimized Processor (JOP) Speciale Evaluering af Java til udvikling af indlejrede realtidssystemer ved brug af en eksisterende Java Optimized Processor (JOP) Speciale efterår 2005 Teknisk Informationsteknologi Jan Lauritzen & Mads

Læs mere

Vejledning til listings-pakken

Vejledning til listings-pakken Vejledning til listings-pakken Morten Ovi latex@student.dtu.dk / 6. juli 2004 Indhold 1 Om listings-pakken 1 2 Indstilling af listings 2 3 listings-pakken i praksis 2 3.1 listings i teksten............................

Læs mere

Software Construction 1 semester (SWC) Spørgsmål 1

Software Construction 1 semester (SWC) Spørgsmål 1 Spørgsmål 1 Objekter #1 Giv en kort præsentation af begrebet objekt, samt hvorledes du erklærer(declare), opretter(create) og bruger objekter Du kan beskrive o Datatyper o Variable / Instans variable /

Læs mere

Parallelle algoritmer

Parallelle algoritmer Parallelle algoritmer Von Neumann s model John von Neumann 1903-57 Von Neumanns model: Instruktioner og data er lagret i samme lager, og én processor henter instruktioner fra lageret og udfører dem én

Læs mere

Forelæsning Uge 5 Mandag

Forelæsning Uge 5 Mandag Forelæsning Uge 5 Mandag Algoritmeskabeloner findone, findall, findnoof, findsumof (sidste mandag) findbest Brug af klassen Collections og interfacet Comparable BlueJ s Debugger Nyttig til at inspicere

Læs mere

Forelæsning Uge 3 Mandag

Forelæsning Uge 3 Mandag Forelæsning Uge 3 Mandag ArrayList Collection med variabelt antal elementer Der er mange andre Collection typer (se Collection interfacet i JavaDoc) MusicOrganizer projektet Eksempel på brug af ArrayList

Læs mere

Hashing og hashtabeller

Hashing og hashtabeller Datastrukturer & Algoritmer, Datalogi C Forelæsning 16/11-2004 Hashing og hashtabeller Teknik til at repræsentere mængder Konstant tid for finde og indsætte men ingen sortering af elementerne Specielt

Læs mere

Anvendelse af metoder - Programmering

Anvendelse af metoder - Programmering Denne guide er oprindeligt udgivet på Eksperten.dk Anvendelse af metoder - Programmering En forhåbentlig rigtig god forklaring på hvad metoder er og hvordan de anvendes. Lidt om private og public, retur

Læs mere

Undervisningsbeskrivelse

Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Januar 2012 Institution Gymnasiet HTX Skjern Uddannelse Fag og niveau Lærer(e) Hold Htx Programmering C Henrik

Læs mere

DM34-1. Obligatorisk opgave Dilemma spillet. Jacob Aae Mikkelsen 191076 kok04

DM34-1. Obligatorisk opgave Dilemma spillet. Jacob Aae Mikkelsen 191076 kok04 DM34-1. Obligatorisk opgave Dilemma spillet Jacob Aae Mikkelsen 191076 kok04 April 2005 Kapitel 1 Resumé Denne rapport dokumenterer udviklingsforløbet og afprøvningen af et spil Dilemma. Spillet går ud

Læs mere

Dag 10 Flertrådet programmering

Dag 10 Flertrådet programmering Videregående programmering i Java Dag 10 Flertrådet programmering Fremlæggelse af programmering/status for projekter Dokumentation med javadoc Flertrådede designmønstre: Arbejdstråd, Producent Konsument,

Læs mere

Eksempel på en database: studenter, kurser, eksamener

Eksempel på en database: studenter, kurser, eksamener Udvidet Programmering 1999 Forelæsning 20, fredag 12. november 1999 Relationsdatabaser: relationer, tupler, attributter Forespørgselssproget SQL Databasesystemet PostgreSQL Tilgang til relationsdatabaser

Læs mere