Enhanced Enrichment Performance of Nickel oxide Nanoparticles via Fabrication of Nanocomposite with Graphene Template
|
|
- Frans Christoffersen
- 4 år siden
- Visninger:
Transkript
1 Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Supporting Information for Enhanced Enrichment Performance of Nickel oxide Nanoparticles via Fabrication of Nanocomposite with Graphene Template Batool Fatima 1,2, Fahmida Jabeen 1, Zahra Padashbarmchi 3, Muhammad Najam-ul-Haq 1 * 1 : Division of Analytical Chemistry, Institute of Chemical Sciences, Bahauddin Zakariya University, Multan 60800, Pakistan. 2 : Australian Institute for Bioengineering and Nanotechnology, The University of Queensland, Brisbane, QLD 4072, Australia 3 : Department of Environmental Sciences, Faculty of Natural Resources, University of Tehran, , Karaj, Iran * Corresponding Author Dr. M. Najam-ul-Haq Institute of Chemical Sciences Bahauddin Zakariya University Multan Pakistan Tel.: najamulhaq@bzu.edu.pk
2 Preparation of HeLa Cell Extract HeLa cells were cultured in high glucose Dulbecco s modified Eagle s medium, supplemented with 10% fetal bovine serum, 100 U/mL penicillin and 100 U/mL streptomycin. The cells were cultivated on 150 mm tissue culture plastic dishes at 37 C in 5% CO 2 and 98% humidity. For total cell lysate preparation, cells were washed twice in ice cold PBS, harvested and centrifuged at 500xg for 4 min at 4 C. Cells collected from 15 cm dish were re-suspended in 1 ml of lysis buffer (50 mm Tris-HCl, ph 8.0), 0.5% Triton X100, 150 mm NaCl, 5 mm MgCl 2, 1 mm DTT, 10 mg/ml leupeptin, 10 mg/ml aprotinin and 1 mm PMSF. Lysis was performed for 30 min at 4 C followed by the centrifugation at 16000xg for 10 min at 4 C. Protein concentration was determined using Coomassie Plus Protein Assay (Thermo Scientific).
3 Fig. S1 MALDI-MS spectra eluted fractions after applying β-casein digest to (a) graphene nanofoam and (b) derivatized graphene nanofoam with orthosilicate. αs1, αs2 and β reprents the detected phosphopeptides with status of phosphorylation given in brackets.
4 Fig. S2 Comparison of metal oxides nanoparticles using β-casein digest for (a) zirconia NPs (b) titania NPs and (c) nickel oxide NPs. αs2 and β reprents the detected phosphopeptides with status of phosphorylation given in brackets.
5 Fig. S3 Serum phosphopeptides analysis using graphene-nio nanocomposite.
6 Table S1 Serum analysis using graphene-nio nanocomposite using MALDI-MS. Search parameters are Charge=1+, MS Tol.: Da, Trypsin, Mascot 2.4.1, SwissProt database, modifications: Global:, Optional: Oxidation (M), Phospho (ST), Phospho (Y). Tree Dev. Dev. Meas. M/z Calc. MH+ Int. hierarchy (Da) (ppm) Range P Sequence Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens GN=PYCARD PE=1 SV=2 ASC_HUMAN peak VLTDEQYQAVRAEPTNPSK 3: Phospho (ST) 7: Phospho (Y) 15: Phospho (ST) peak LFSFTPAWNWTCKDLLLQALR 3: Phospho (ST) 12: peak GALLSMDALDLTDKLVSFYLETYGAELTANVLR 5: Phospho (ST) 6: Oxidation (M) 12: Phospho (ST) 17: Phospho (ST) 19: Phospho (Y) 22: Phospho (ST) 23: Phospho (Y) 28: Phospho (ST) peak DMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHR 2: Oxidation (M) 15: Phospho (ST) 19: Phospho (ST) 32: Phospho (ST) Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens GN=CACNG2 PE=1 SV=1 CCG2_HUMAN peak SSSRSTEPSHSR 1: Phospho (ST) 2: Phospho (ST) 3: Phospho (ST) 5: Phospho (ST) 6: Phospho (ST) peak STEPSHSRDASPVGIK 1: Phospho (ST) 2: Phospho (ST) 5: Phospho (ST) peak GFNTLPSTEISMYTLSR 4: Phospho (ST) 13: Phospho (Y) peak AVRASSIFPILSVILLFMGGLCIAASEFYK 5: Phospho (ST) 6: Phospho (ST) 12: Phospho (ST) 29: Phospho (Y) 22: IQ domain-containing protein K OS=Homo sapiens GN=IQCK PE=2 SV=1 IQCK_HUMAN peak TKFIACDFLTEWLYNQNPK 1: Phospho (ST) 14: Phospho (Y) 6: peak LKPSCSTDSSFTRTPVPTVSLASR 4: Phospho (ST) 5: peak TCSPKEYLETFIFPVLLPGMASLLHQAK 1: Phospho (ST) 7: Phospho (Y) 2: peak QEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDK 6: Phospho (ST) 13: Oxidation (M) 19: Phospho (ST) 23: Phospho (Y) 27: Phospho (ST) 37: Histatin-1 OS=Homo sapiens GN=HTN1 PE=1 SV=2 HIS1_HUMAN peak Jan 1 MKFFVFALVLALMISMISADSHEK 15: Phospho (ST) 18: Phospho (ST) 21: Phospho (ST)
7 Leucine zipper putative tumor suppressor 2 OS=Homo sapiens GN=LZTS2 PE=1 SV=2 LZTS2_HUMAN peak QLQHNYIQMYRR 6: Phospho (Y) 9: Oxidation (M) 10: Phospho (Y) Dynactin subunit 5 OS=Homo sapiens GN=DCTN5 PE=1 SV=1 DCTN5_HUMAN MELGELLYNKSEYIETASGNK 8: Phospho (Y) 11: Phospho (ST) 13: Phospho peak Jan 1 (Y) 16: Phospho (ST) 18: Phospho (ST) Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 MFRN1_HUMAN peak Jan 1 MELRSGSVGSQAVAR 5: Phospho (ST) 7: Phospho (ST) RTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVK 2: Phospho peak (ST) 13: Phospho (ST) 22: Phospho (ST) Photoreceptor-specific nuclear receptor OS=Homo sapiens GN=NR2E3 PE=1 SV=1 NR2E3_HUMAN peak STAQVHLDSMESNTESRPESLVAPPAPAGR 1: Phospho (ST) 2: Phospho (ST) Protein Mpv17 OS=Homo sapiens GN=MPV17 PE=1 SV=1 MPV17_HUMAN peak GRTLTMVSLGCGFVGPVVGGWYK 22: Phospho (Y) 11: Mid1-interacting protein 1 OS=Homo sapiens GN=MID1IP1 PE=1 SV=1 M1IP1_HUMAN peak TPPVPDSGSANGSFFAPSRDMYSHYVLLK 22: Phospho (Y) Melanoma-associated antigen 9 OS=Homo sapiens GN=MAGEA9 PE=2 SV=1 MAGA9_HUMAN peak KLLTQDWVQENYLEYR 12: Phospho (Y) 15: Phospho (Y) EPICYPSLYEEVLGEEQEGV 5: Phospho (Y) 7: Phospho (ST) 9: Phospho (Y) peak : Rab11 family-interacting protein 1 OS=Homo sapiens GN=RAB11FIP1 PE=1 SV=3 RFIP1_HUMAN peak GTEDSLMGRTR 2: Phospho (ST) peak DSSPSSSPSPKGFR 2: Phospho (ST) 3: Phospho (ST) 5: Phospho (ST) 6: Phospho (ST) 7: Phospho (ST) peak QPSFPANKGTEDSLMGR 3: Phospho (ST) 10: Phospho (ST) 13: Phospho (ST) peak SPIMADLNLSLPSIPEVASDDER 1: Phospho (ST) 10: Phospho (ST) 13: Phospho (ST) 19: Phospho (ST) Protein Wnt-2 OS=Homo sapiens GN=WNT2 PE=1 SV=1 WNT2_HUMAN peak CHGVSGSCTLRTCWLAMADFR 5: Phospho (ST) 7: Phospho (ST) 9: Phospho (ST) 1: 8: 13: peak Jan-38 1 MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSR 29: Phospho (Y) UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2 GALE_HUMAN peak VNLTGTIQLLEIMKAHGVK 4: Phospho (ST) 6: Phospho (ST) Centriole, cilia and spindle-associated protein OS=Homo sapiens GN=CCSAP PE=1 SV=2 CCSAP_HUMAN
8 peak Protein FAM131A OS=Homo sapiens GN=FAM131A PE=2 SV=1 F131A_HUMAN peak Olfactory receptor 52E5 OS=Homo sapiens GN=OR52E5 PE=3 SV=2 O52E5_HUMAN ASSSENPWMTEYMRCYSAR 2: Phospho (ST) 3: Phospho (ST) 12: Phospho (Y) 16: Phospho (Y) 15: SLGPLEAQDSLYNSPLTESCLSPAEEEPAPCK 1: Phospho (ST) 12: Phospho (Y) 20: 31: peak ALSTCGSHVCVMLAFYLPALFSFMTHR 3: Phospho (ST) 4: Phospho (ST) 7: Phospho (ST) 16: Phospho (Y) 22: Phospho (ST) 5: 10: Multifunctional protein ADE2 OS=Homo sapiens GN=PAICS PE=1 SV=3 PUR6_HUMAN peak AAISNKITSCIFQLLQEAGIK 4: Phospho (ST) 10: peak LPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSK 3: Phospho (ST) 8: Phospho (ST) 9: Phospho (ST) 7: BTB/POZ domain-containing protein KCTD14 OS=Homo sapiens GN=KCTD14 PE=1 SV=2 KCD14_HUMAN RPTMSTVVELNVGGEFHTTTLGTLR 3: Phospho (ST) 5: Phospho (ST) 6: peak Phospho (ST) 18: Phospho (ST) N-acetyllactosaminide beta-1,6-n-acetylglucosaminyl-transferase, isoform B OS=Homo sapiens GN=GCNT2 PE=2 SV=1 GNT2B_HUMAN peak EYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFAR 2: Phospho (Y) Putative uncharacterized protein encoded by LINC00474 OS=Homo sapiens GN=LINC00474 PE=5 SV=2 CI027_HUMAN peak Tumor protein D53 OS=Homo sapiens GN=TPD52L1 PE=1 SV=1 TPD53_HUMAN TSNWGSSFSEKSGCMQTHPSMNLDCR 1: Phospho (ST) 2: Phospho (ST) 6: Phospho (ST) 15: Oxidation (M) 21: Oxidation (M) 14: 25: peak MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKA : Phospho (ST); 2 Oxidation (M) peak KAELVQLEDEITTLRQ: Phospho (ST) peak KSWHDMQTTTAYKK : 2 Phospho (ST); Oxidation (M); Phospho (Y) peak KSWHDMQTTTAYKKT : Phospho (Y) peak KSWHDMQTTTAYKKT : 4 Phospho (ST); Oxidation (M); Phospho (Y) peak KKFGDMSYSIRH: Phospho (Y) peak KFGDMSYSIRHSISMPAMRN: 3 Phospho (ST); 2 Oxidation (M); Phospho (Y) peak RHSISMPAMRN + Phospho (ST) peak KTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRR + 2 Phospho (ST)
9
Coordinator: Dr. Hsien-Ming Lee Coach Professor: Dr. Joseph J.-T. Huang Sit-in Professor: Dr. Su-Chang Lin. Presenter: Bagher Golzarroshan
Coordinator: Dr. Hsien-Ming Lee Coach Professor: Dr. Joseph J.-T. Huang Sit-in Professor: Dr. Su-Chang Lin Presenter: Bagher Golzarroshan 1 Outline Introduction Cancer Apoptosis Apoptosis and disease Scope
Læs mereCell Physiol Biochem 2015;37: DOI: / Published online: September 11, 2015
www.karger.com/cpb 719 1421-9778/15/0372-0719$39.50/0 Qi Accepted: et al.: JMJD2A August Inhibition 06, 2015 Attenuates Neointimal Hyperplasia in Diabetic Rats Original Paper This is an Open Access article
Læs mereSupporting Information for Publication. Assessment of extracellular vesicles purity using proteomic standards
Supporting Information for Publication Assessment of extracellular vesicles purity using proteomic standards Tingting Wang #, Kyle W. Anderson,#, and Illarion V. Turko,#,* Biomolecular Measurement Division,
Læs mereChallenges for the Future Greater Helsinki - North-European Metropolis
Challenges for the Future Greater Helsinki - North-European Metropolis Prof. Dr.-Ing. / M.A. soc. pol. HafenCity University Hamburg Personal introduction background: - urban and regional planning - political
Læs mereExpanded View Figures
Expanded View Figures m/z 413.23, 2+ y6 y5 y4 y3 y2 y1 H I T G I E R b1 b2 b3 b5 b6 Figure EV1. MS/MS spectra of peptides mapped to MKKK7., LTQ-Orbitrap MS/MS spectra of MKKK7 peptides identified in FLS2-GFP-co-immunoprecipitated
Læs merePossibilities for Reuse of Calcium Carbonate Pellets from Drinking Water Softening
Possibilities for Reuse of Calcium Carbonate Pellets from Drinking Water Softening Camilla Tang, PhD student Laure Lopato (HOFOR), Sally Nyberg Kornholt (HOFOR) & Hans-Jørgen Albrechtsen (DTU) Danish Water
Læs mereAppendix 1: Udregning af mængde cellesuspention til udsåning. Faktor mellem total antal celler og antal celler der ønskes udsås:
Appendix Appendix 1: Udregning af mængde cellesuspention til udsåning Fortyndingsfaktor: Efter trypsinering og centrifugering af celler fra cellestokken, opblandes cellerne i 1 ml medie. For at lave en
Læs mereCertificate No.: GMO - Detection of 35S promotor, nptii Gen, NOS/NPTII modification
1/2 GeneScan Eurofins GeneScan GmbH, Engesserstr. 4, D - 79108 Freiburg Syngenta Flowers Mr. Joost Kos Westeinde 62 P.O Box 2 1600AA Enkhuizen Niederlande Eurofins GeneScan GmbH Engesserstr. 4, D-79108
Læs mereBiotest Aps er en privat, forskningsbaseret virksomhed inden for mikrobiologi, bioraffinering og fermentering.
Biotest Aps Biotest Aps er en privat, forskningsbaseret virksomhed inden for mikrobiologi, bioraffinering og fermentering. Biotest s speciale er udviklingsarbejde i laboratorie- og pilotskala samt rådgivning
Læs mereThe test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
Formaldehyde 50 M. L 0.02-1.00 mg/l HCHO / Chromotropic acid 176 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption
Læs mereKU benchmark med udvalgte institutioner FORSKNING OG INNOVATION
KØBENHAVNS UNIVERSITET SAGSNOTAT Opdateret 04. MAJ 2017 Vedr. KU benchmark med udvalgte institutioner FORSKNING OG INNOVATION UNIVERSITETSPARKEN 1, Herunder er en benchmarking af KU med udvalgte europæiske
Læs mereBesvarelse af vitcap -opgaven
Besvarelse af -opgaven Spørgsmål 1 Indlæs data Dette gøres fra Analyst med File/Open, som sædvanlig. Spørgsmål 2 Beskriv fordelingen af vital capacity og i de 3 grupper ved hjælp af summary statistics.
Læs merewhat is this all about? Introduction three-phase diode bridge rectifier input voltages input voltages, waveforms normalization of voltages voltages?
what is this all about? v A Introduction three-phase diode bridge rectifier D1 D D D4 D5 D6 i OUT + v OUT v B i 1 i i + + + v 1 v v input voltages input voltages, waveforms v 1 = V m cos ω 0 t v = V m
Læs mereThe GAssist Pittsburgh Learning Classifier System. Dr. J. Bacardit, N. Krasnogor G53BIO - Bioinformatics
The GAssist Pittsburgh Learning Classifier System Dr. J. Bacardit, N. Krasnogor G53BIO - Outline bioinformatics Summary and future directions Objectives of GAssist GAssist [Bacardit, 04] is a Pittsburgh
Læs mereBetydning af Kvælstoftilførsel for Proteinindhold, Proteinets Ekstraherbarhed og Proteinkvalitet ved Fraktionering af Græs og Kløver
Betydning af Kvælstoftilførsel for Proteinindhold, Proteinets Ekstraherbarhed og Proteinkvalitet ved Fraktionering af Græs og Kløver Rasmus Dahl-Lassen Københavns Universitet, PLEN INBIOM Seminar 17-09-18
Læs mereVPN VEJLEDNING TIL MAC
VPN VEJLEDNING TIL MAC MAC OS X 1 VPN VEJLEDNING TIL MAC Formålet med en VPN forbindelse er, at du kan tilgå nogle af Aarhus Universitets services hjemmefra, som ellers kun er tilgængelige, når du er på
Læs mereLossepladser og vandressourcer
BETYDNINGEN AF GRUNDVANDSOVERFLADEVANDS- INTERAKTION FOR VANDKVALITETEN I ET VANDLØB BELIGGENDE NEDSTRØMS FOR RISBY LOSSEPLADS PhD studerende Nanna Isbak Thomsen1 PhD studerende Nemanja Milosevic1 Civilingeniør
Læs merePreparation of hydrazine functionalized polymer brushes. hybrid magnetic nanoparticles for highly specific
Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides Guang Huang a,b,c, Zhen Sun b,c, Hongqiang Qin b, Liang Zhao b, Zhichao
Læs mereMetal Oxide Varistor:TVM-B Series
Features 1. RoHS compliant 2. High surge suppress capability 3. EIA size 0402 ~ 2220 4. Operating voltage: 5.5 ~ 85 Vdc 5. Bidirectional and symmetrical V/I characteristics 6. Multilayer ceramic construction
Læs mereJournal of Separation Science and Engineering Vol. 1, No. 2, 2010, pp CO 2 N 2. . CO 2 /N 2 (FT-IR) (AFM) CO 2 %
Journal of Separation Science and Engineering Vol. 1, No. 2, 2010, pp. 67-78 - N 2 CO 2 * - - - - *(a.babaluo@sut.ac.ir) - - - - - -. CO 2 /N 2. (FT-IR) (AFM) (OM) (SEM) % CO 2 %.. : : - () ;.... CO 2
Læs mereÓ³ Ÿ , º 2(193).. 505Ä ²,.. Ìμ ²Ö μ, Œ.. ʲ,.. μ μ,.. ŠÊ²,.. ŠÊ² ±μ. Ñ Ò É ÉÊÉ Ö ÒÌ ² μ, Ê
Ó³ Ÿ. 2015.. 12, º 2(193).. 505Ä516 Œ ˆŠ ˆ ˆ Š ƒ Š ˆŒ Š ˆ œ Š œ Œ Š Š º 3 Š ˆ -2.. ²,.. Ìμ ²Ö μ, Œ.. ʲ,.. μ μ,.. ŠÊ²,.. ŠÊ² ±μ Ñ Ò É ÉÊÉ Ö ÒÌ ² μ, Ê μé ² ÕÉ Ö ³ Éμ ± ʲÓÉ ÉÒ ³ Ö ËË Í ²Ó μ ²μÉ μ É μ- Éμ±
Læs mereChlorine dioxide 50 T mg/l ClO 2 DPD / Glycine
Chlorine dioxide 50 T 0.05-1 mg/l ClO 2 DPD / Glycine 119 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range
Læs mereAge Standardized Incidence Rate-ASR GLOBOCAN ASR ASR.
p [ ] Age Standardized Incidence Rate-ASR ASR - ASR - GLOBOCAN C B - email: Amiralmasi@arakmu.ac.ir - p< ICD-O C22 Cochran-Armitage WinPepi 2.1 CI ± ± ± ± ± ± ± ± ± References 1. Etemadi A, Sadjadi A,
Læs mereThe test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
Formaldehyde 10 M. L 1.00-5.00 mg/l HCHO H 2 SO 4 / Chromotropic acid 175 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption
Læs mereFrequency Dispersion: Dielectrics, Conductors, and Plasmas
1/23 Frequency Dispersion: Dielectrics, Conductors, and Plasmas Carlos Felipe Espinoza Hernández Professor: Jorge Alfaro Instituto de Física Pontificia Universidad Católica de Chile 2/23 Contents 1 Simple
Læs mereManeurop reciprocating compressors
MAKING MODERN LIVING POSSIBLE Maneurop reciprocating compressors MT - MTZ - LTZ - NTZ - 60 z R404A - R507A - R407C - R134a - R22 QUICK REFERENCE PRODUCT RANGE Nominal voltage M-BP Applications LBP Applications
Læs mereDanish Language Course for International University Students Copenhagen, 12 July 1 August Application form
Danish Language Course for International University Students Copenhagen, 12 July 1 August 2017 Application form Must be completed on the computer in Danish or English All fields are mandatory PERSONLIGE
Læs mereKey words: HSVE, Serological Diagnosis, ELISA
Key words: HSVE, Serological Diagnosis, ELISA Fig. 1 IgM and IgG antibody levels in acute phase CSF of patients with HSVE by age as determined by ELISA index at 1: 10 dilution of CSF age in years Fig.
Læs merePræsentation af BETA II hæve/sænke bord
Præsentation af BETA II hæve/sænke bord Beskrivelse Beta II Hæve/sænkebord: Stel: Bordplade: Bordet er udført i et enkelt og stringent design, der er lagt vægt på stabilitet og funktionalitet. Bordet er
Læs mereBedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering Titel (forfatter)
Bedømmelse af klinisk retningslinje foretaget af Enhed for Sygeplejeforskning og Evidensbasering Titel (forfatter) Link til retningslinjen Resumé Formål Fagmålgruppe Anbefalinger Patientmålgruppe Implementering
Læs mereFACULTY OF SCIENCE :59 COURSE. BB838: Basic bioacoustics using Matlab
FACULTY OF SCIENCE 01-12- 11:59 COURSE BB838: Basic bioacoustics using Matlab 28.03. Table Of Content Internal Course Code Course title ECTS value STADS ID (UVA) Level Offered in Duration Teacher responsible
Læs mereRessourcer i en cirkulær økonomi muligheder og udfordringer
Ressourcer i en cirkulær økonomi muligheder og udfordringer Anders Damgaard, seniorforsker, DTU Miljø Mandag den 5. Marts 2018 DTU Miljø Agenda Hvorfor fokus på cirkulær økonomi og ressourcer Muligheder
Læs mere< Elabscience ELSIA Kit 20% 할인품목 >
< Elabscience ELSIA Kit 20% 할인품목 > Cat No. Product Name 20% DC Price Signaling Pathways E-EL-H0004 Human ADP/Acrp30 (Adiponectin) ELISA Kit 470,000 E-EL-H0012 Human BMP-4 (Bone Morphogenetic Protein 4)
Læs mereTo the reader: Information regarding this document
To the reader: Information regarding this document All text to be shown to respondents in this study is going to be in Danish. The Danish version of the text (the one, respondents are going to see) appears
Læs mere( ) .(Gorst 1999) .(Motwani et al. 1994) .(Saraph et al. 1989)
... ( : ) - drbahrami.38@gmail.com ( ) - ( / / / / )...... (ISO) (TQM) :.(Gorst 999)... -....(Motwani et al. 994).(Saraph et al. 989) 06 ... -.. - - -.(Valmohammadi et al. 004) ISO.(Beaufort & Longest
Læs mereEngineering of Chemical Register Machines
Prague International Workshop on Membrane Computing 2008 R. Fassler, T. Hinze, T. Lenser and P. Dittrich {raf,hinze,thlenser,dittrich}@minet.uni-jena.de 2. June 2008 Outline 1 Motivation Goal Realization
Læs mereKALK- OG TEGLVÆRKSFORENINGEN. CPR Sustainable Construction
CPR Sustainable Construction 1 Tommy Bisgaard - Direktør i Kalk- og Teglværksforeningen - Formand for DS 417 (CEN TC350 & 351) - Formand for miljøkomiteen i TBE & CU (keramiske industrier i Europa) - Medlem
Læs mereEngelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. www.jysk.dk og www.jysk.com.
052430_EngelskC 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau C www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation
Læs mereUser Manual for LTC IGNOU
User Manual for LTC IGNOU 1 LTC (Leave Travel Concession) Navigation: Portal Launch HCM Application Self Service LTC Self Service 1. LTC Advance/Intimation Navigation: Launch HCM Application Self Service
Læs mereRug danner store mængder af sekundære indholdsstoffer i kernen og under spiring af betydning for plantens forsvar og vores kost.
Rug danner store mængder af sekundære indholdsstoffer i kernen og under spiring af betydning for plantens forsvar og vores kost. Per L. Gregersen Fariha Tanwir Institut for Molekylærbiologi og Genetik
Læs mereSupplemental Information. Transparent-to-Dark Electrochromic Behavior. in Naphthalene-Diimide-Based. Mesoporous MOF-74 Analogs
Chem, Volume 1 Supplemental Information Transparent-to-Dark Electrochromic Behavior in Naphthalene-Diimide-Based Mesoporous MF-74 Analogs Khalid AlKaabi, Casey R. Wade, and Mircea Dinca Supplemental Information
Læs mereDanish Language Course for Foreign University Students Copenhagen, 13 July 2 August 2016 Advanced, medium and beginner s level.
Danish Language Course for Foreign University Students Copenhagen, 13 July 2 August 2016 Advanced, medium and beginner s level Application form Must be completed on the computer in Danish or English All
Læs mereReport on examination of the catalogues on the freezers in the MP archive, room 14.01.15
Annex 3.2.3.2 Report on examination of the catalogues on the freezers in the MP archive, room 14.01.15 11 April 2012 the Panel inspected the freezers in the MP archive, including the then newly found -
Læs mereDemensdagene 7. maj Nis Peter Nissen Alzheimerforeningen
Demensdagene 7. maj 2018 Nis Peter Nissen Alzheimerforeningen Ann og Jørgen: Demens og livsglæde: Farverne gør mig glad. De kommer fra hjertet, som lyset i sygdommen Støt mennesker med demens Mobil Pay
Læs mereRoE timestamp and presentation time in past
RoE timestamp and presentation time in past Jouni Korhonen Broadcom Ltd. 5/26/2016 9 June 2016 IEEE 1904 Access Networks Working Group, Hørsholm, Denmark 1 Background RoE 2:24:6 timestamp was recently
Læs mereThe use of instrumented gait analysis in interdisciplinary interventions for children with cerebral palsy
PhD thesis The use of instrumented gait analysis in interdisciplinary interventions for children with cerebral palsy Helle Mätzke Rasmussen Department of Clinical Research Faculty of Health Sciences University
Læs mereSl. No. Title Volume
GLOBAL LIBRARY Updated List of Print Journals & Law Reports Back Volume Sl. No. Title Volume 1 AALL Spectrum V15-V17 2 Academy of Management Journal V54-V56 3 ACTS: Indiana 1973, 1987-2000 4 Administrative
Læs mereSOFTWARE PROCESSES. Dorte, Ida, Janne, Nikolaj, Alexander og Erla
SOFTWARE PROCESSES Dorte, Ida, Janne, Nikolaj, Alexander og Erla Hvad er en software proces? Et struktureret sæt af AKTIVITETER, hvis mål er udvikling af software. En software proces model er en abstrakt
Læs mereELISA metoden, til bestemmelse af den genetiske profil i høns.
ELISA metoden, til bestemmelse af den genetiske profil i høns. 1 Formål: Formålet med denne øvelse er at demonstrere brugen af antistoffer i diagnostisk eller forskningsøjemed. Dvs. til at undersøge om
Læs mereUdvalget for Videnskab og Teknologi. UVT alm. del - Svar på Spørgsmål 34 Offentligt. Udvalget for Videnskab og Teknologi
Udvalget for Videnskab og Teknologi UVT alm. del - Svar på Spørgsmål 34 Offentligt Ministeren for videnskab, teknologi og udvikling Udvalget for Videnskab og Teknologi Folketinget Christiansborg 1240 København
Læs mereHydrogen Burning in Stars-II
ydrogen Burning in Stars-II ydrogen in induced reaction have lowest oulomb barrier highest reaction rate Reaction chain with lowest Z elements are the -chains -chains limited by weak interaction based
Læs mereINTER AQUA ADVANCE. Fremtidens Smolt Produktion Sunndalsøra Oktober 2014
INTER AQUA ADVANCE Fremtidens molt Produktion unndalsøra 22-23 Oktober 2014 INTER AQUA ADVANCE Udfordringer i forbindelse med fremtidig smolt produktion: 1) lam behandling 2) Vandkvalitet 3) Flexible produktion/anlæg
Læs mereVidereudvikling af LDV til on-sitemåling
Videreudvikling af LDV til on-sitemåling Sammenligning mellem LDV og gasnormal i naturgasanlæg 19-21. maj 2010 Rapportforfattere: Matthew Adams, Teknologisk Institut Kurt Rasmussen, Force Technology LDV
Læs mereWhere and why? - How to use welded branches
O-LETS 1.1.6.1 Where and why? - How to use welded branches Welded Tee 1. Everywhere where welded branches are recommended O-let 2. O-lets replace the welded Tee coasing a reduction of material and labour
Læs mereProtein databases Rasmus Wernersson. (Slides af Henrik Nielsen & Morten Nielsen).
Protein databases Rasmus Wernersson (Slides af Henrik Nielsen & Morten Nielsen). Background- Nucleotide databases GenBank, http://www.ncbi.nlm.nih.gov/genbank/ National Center for Biotechnology Information
Læs mereNærskibsfart med bundlinieeffekt: Klima og miljø. Hans Otto Kristensen. hohk@mek.dtu.dk. Tlf: 45 25 13 95 alt. 40 45 90 20
Nærskibsfart med bundlinieeffekt: Klima og Hans Otto Kristensen hohk@mek.dtu.dk Tlf: 45 25 13 95 alt. 4 45 9 2 Sidste nyt vedr. TEMA 21 ang. lastbiler Effekt og fartafhængighed for skibe Baggrund for DTU
Læs mereTEKSTILER. i det nye affaldsdirektiv. - Kravene til, og mulighederne for, de danske aktører
TEKSTILER i det nye affaldsdirektiv. - Kravene til, og mulighederne for, de danske aktører Artikel 3, stk. 2b definitionen af municipal waste Municipal waste means a) mixed waste and separately collected
Læs mere"Cross Reactive Material 197 glycoconjugate vaccines contain privileged conjugation sites"
1 2 3 4 5 6 7 Supplementary Material for manuscript: "Cross Reactive Material 197 glycoconjugate vaccines contain privileged conjugation sites" Authors Uwe Möginger 1, 2, Anja Resemann 3, Christopher E.
Læs mereSOP for håndtering af blod og knoglemarv ved hæmatologisk sygdom Regionernes Bio- og GenomBank
SOP for håndtering af blod og knoglemarv ved hæmatologisk sygdom Regionernes Bio- og GenomBank Baggrund Denne Standard Operating Procedure (SOP) omhandler indsamling af perifert blod (PB) og knoglemarvsaspirat
Læs mereHeuristics for Improving
Heuristics for Improving Model Learning Based Testing Muhammad Naeem Irfan VASCO-LIG LIG, Computer Science Lab, Grenoble Universities, 38402 Saint Martin d Hères France Introduction Component Based Software
Læs mereForventer du at afslutte uddannelsen/har du afsluttet/ denne sommer?
Kandidatuddannelsen i Informationsvidenskab - Aalborg 2 respondenter 5 spørgeskemamodtagere Svarprocent: 40% Forventer du at afslutte uddannelsen/har du afsluttet/ denne sommer? I hvilken grad har uddannelsen
Læs mereReference wetlands in three ecoregions of the central plains.
Reference wetlands in three ecoregions of the central plains. Central Plains Center for BioAssessment Kansas Biological Survey KBS Report 147 Beury, Baker, and Huggins Nov. 2008 Denver EPA grant FED41930
Læs mereBrug af Educational IT i undervisningen: PollEverywhere. Associate Professor Carsten Bergenholtz
Brug af Educational IT i undervisningen: PollEverywhere Associate Professor Carsten Bergenholtz (cabe@mgmt.au.dk) Department of Management / Institut for Virksomhedsledelse TATION Agenda Hvad er PollEverywhere?
Læs mereIn the reference list for your publication, please cite both the original version of the CSI and the Danish translation using the following format:
Dear Colleague, Thank you for your interest in using a translated version of the Children s Somatization Inventory. Included with this letter is the translated version of the CSI you requested. Both parent
Læs mereHvilket af efterfølgende udsagn er forkert? a) Golgi-proteiner syntetiseres i ER b) mitochondriale proteiner syntetiseres i cytosol c)
Test 3 Hvilket af efterfølgende udsagn er forkert? a) Golgi-proteiner syntetiseres i ER b) mitochondriale proteiner syntetiseres i cytosol c) plasmamembran-proteiner syntetiseres i cytosol d) lysosomale
Læs mereApplication of High- resolution LiDAR-derived DEM in Landslide Volume Estimation
Application of High- resolution LiDAR-derived DEM in Landslide Volume Estimation Chih Ming Tseng 1, Ching Weei Lin 2, Jin King Liu 1. Chang Jung Christian University 2. National Cheng Kung University TAIWAN
Læs mereAntibiotic resistance in aquaculture: Novel antimicrobials based on essential oils
Antibiotic resistance in aquaculture: Novel antimicrobials based on essential oils SARTER S. and P. DANTHU CIRAD UMR-95 Qualisud,, URP-Forêt et Biodiversité 1 Partnership Madagascar University of Antananarivo
Læs mereForventer du at afslutte uddannelsen/har du afsluttet/ denne sommer?
Kandidatuddannelsen i Informationsarkitektur - Aalborg 3 respondenter 10 spørgeskemamodtagere Svarprocent: 30% Forventer du at afslutte uddannelsen/har du afsluttet/ denne sommer? I hvilken grad har uddannelsen
Læs mereEffekter af eksportfremme for danske virksomheder. Jakob Munch University of Copenhagen Georg Schaur University of Tennessee
Effekter af eksportfremme for danske virksomheder Jakob Munch University of Copenhagen Georg Schaur University of Tennessee Hvad ved vi om eksportfremme? De fleste lande bruger betydelige ressourcer på
Læs mereisearch Testsamling til evaluering af integreret søgning
isearch Testsamling til evaluering af integreret søgning Marianne Lykke, Peter Ingwersen, Birger Larsen, Haakon Lund og Toine Bogers DEFF projekt 2008-2009 Dagens emner Projektets formål og problemstilling
Læs mereVina Nguyen HSSP July 13, 2008
Vina Nguyen HSSP July 13, 2008 1 What does it mean if sets A, B, C are a partition of set D? 2 How do you calculate P(A B) using the formula for conditional probability? 3 What is the difference between
Læs mereVINTERTILBUD TILBUDDENE GÆLDER HELT FREM TIL 15.02.16
VINTERTILBUD TILBUDDENE GÆLDER HELT FREM TIL 15.02.16 LABORATORIEUDSTYR Binder BD inkubatorer Elektronisk controller APT.line Temperatur område stuetemp. +5⁰C op til 100⁰C Indvendig glasdør Binder BD 53
Læs mereReventlow Lille Skole
1 Reventlow Lille Skole - så kan du lære det! Engelsk 3.-4. Der vil mundtlig primært blive arbejdet ud fra clio portalen skriftligt arejder vi enten med pirana eller lets do it. Måned Uge nr. Forløb Antal
Læs mereFFIII - Nye trends: Baggrund for udvikling af beslutningsværktøjer
Downloaded from orbit.dtu.dk on: Jan 05, 2017 FFIII - Nye trends: Baggrund for udvikling af beslutningsværktøjer Hansen, Tina Beck; Møller, Cleide Oliveira de Almeida Publication date: 2016 Document Version
Læs mereThe soil-plant systems and the carbon circle
The soil-plant systems and the carbon circle Workshop 15. november 2013 Bente Hessellund Andersen The soil-plant systems influence on the climate Natural CO 2 -sequestration The soil-plant systems influence
Læs mereUsability-arbejde i virksomheder
Usability-arbejde i virksomheder Jan Stage Professor, PhD Forskningsleder i Information Systems (IS) og Human-Computer Interaction (HCI) Aalborg University, Department of Computer Science jans@cs.aau.dk
Læs mereIndustrial Stormwater Sampling St. Cloud, Minnesota August 25, 2009
Industrial Stormwater Sampling St. Cloud, Minnesota August 25, 2009 Sampling Preparation, Sample Collection, Documentation & Shipment Tim Portner What Makes Good Data Sampling Plans Sampling Procedures
Læs mereLADDERS, STANDS & PLATFORMS
LADDERS, STANDS & PLATFORMS Work Platforms...................................... 129 Step Stands.......................................... 129............................ 130-132........................
Læs mereTATION. Innovationsforståelser. Lektor Carsten Bergenholtz
AARHUS UNIVERSITY SCHOOL OF BUSINESS AND SOCIAL SCIENCES Innovationsforståelser Lektor Carsten Bergenholtz (cabe@mgmt.au.dk) Department of Management School of Business and Social Sciences Aarhus University
Læs mereAnalysis of monoclonal gammopathiesthe role of electrophoretic methods. Jens Bundgaard and Linda Hilsted Rigshospitalet, Copenhagen, Denmark
Analysis of monoclonal gammopathiesthe role of electrophoretic methods Jens Bundgaard and Linda Hilsted Rigshospitalet, Copenhagen, Denmark Equalis usermeeting march 2012 Outline Analysis in Denmark: Overview
Læs mereIT-udvalgsmøde. med Institutleder Kurt Jensen. Datalogisk Institut, Aarhus Universitet 4. Maj Erik Ernst
IT-udvalgsmøde med Institutleder Kurt Jensen Datalogisk Institut, Aarhus Universitet 4. Maj 2009 - Erik Ernst Oversigt Vigtige emner for udvalget i 2008 Udvalgets sammensætning Kommisorium, mulig opdatering
Læs mereEngelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen. og
052431_EngelskD 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau D www.jysk.dk og www.jysk.com Indhold: Opgave 1 Presentation
Læs mereRettelser pr. 17. oktober 2017 er markeret med *
Oversigt valgdata ordinært valg 017 Valgdata Bestyrelsen 017... Valgdata Akademisk Råd 017... Valgdata Ph.d-udvalg 017... Valgdata Institutråd 017... Valgdata studienævn ENGINEERING 017... 4 Valgdata studienævn
Læs mereClimate model results from the VR-LANDCLIM project
Climate model results from the VR-LANDCLIM project Presentation given at the NordForsk LANDCLIM workshop at SMHI, Norrköping, 24 February 2011 Erik Kjellström, Gustav Strandberg and Ulla Kokfelt Outline
Læs mereSKRIFTLIG EKSAMEN I NUMERISK DYNAMIK Bygge- og Anlægskonstruktion, 7. semester Torsdag den 19. juni 2003 kl Alle hjælpemidler er tilladt
SKRIFTLIG EKSAMEN I NUMERISK DYNAMIK Bygge- og Anlægskonstruktion, 7. semester Torsdag den 9. juni 23 kl. 9.-3. Alle hjælpemidler er tilladt OPGAVE f(x) x Givet funktionen f(x) x, x [, ] Spørgsmål (%)
Læs mereImproved OVW Retrievals in Extreme High Wind Events using QuikSCAT
Improved OVW Retrievals in Extreme High Wind Events using QuikSCAT OVWST Meeting 28 W. Linwood Jones & Pete Laupattarakasem Central Florida Remote Sensing Lab. (CFRSL) University of Central Florida, Orlando,
Læs mereKemiske fingeraftryk af forureningsprofiler i jord nye analytiske redskaber til en differentieret risikovurdering
Kemiske fingeraftryk af forureningsprofiler i jord nye analytiske redskaber til en differentieret risikovurdering Peter Mortensen, BU manager, Eurofins Miljø A/S Signe Vork, civilingeniør, Eurofins Miljø
Læs mereNeutron Activation of 76Ge
Neutron Activation of 76Ge Georg Meierhofer people involved: P. Grabmayr J. Jochum Kepler Center for Astro and Particle Physics University Tübingen P. Kudejova L. Canella J. Jolie IKP, Universität zu Köln
Læs mereØvelse med tarmkræftceller i kultur.
Øvelse med tarmkræftceller i kultur. Baggrund Hver 3. dansker bliver ramt af kræft, inden de er blevet 75 år. Tyktarmskræft er den 3. hyppigste kræftform hos både mænd og kvinder, hvor henholdsvis 7.3
Læs mereapplies equally to HRT and tibolone this should be made clear by replacing HRT with HRT or tibolone in the tibolone SmPC.
Annex I English wording to be implemented SmPC The texts of the 3 rd revision of the Core SPC for HRT products, as published on the CMD(h) website, should be included in the SmPC. Where a statement in
Læs mereSummer 2014 Starbucks Beverage Nutrition Information *
Summer 2014 Starbucks Beverage Nutrition Information * KiloJoules Calories Total Fat (g) Saturated Fat (g) Trans Fat (g) Cholesterol (mg) Sodium (mg) Total Carbohydrates (g) Dietary Fiber (g) Sugars (g)
Læs mereHonour Roll (1993 Present)
Honour Roll ( Present) Fraser Coast Tourism Award for Best Business Kingfisher Bay Resort. Fraser Coast Tourism Award for Kingfisher Bay Resort. Fraser Coast Tourism Award for Best Marketing Kingfisher
Læs mereStandarder og køreplan for udvikling af metoder til karakterisering af nanomaterialer
Standarder og køreplan for udvikling af metoder til karakterisering af nanomaterialer Europa Kommissionen har gennem mandat M461 inviteret de europæiske standardiseringsorganer til at samarbejde om udviklingen
Læs mereNy rapport fra UNICEF: Report card 9: The children left behind - A league table of inequalitv in child wellbeing in the world's rich countries
Socialudvalget 0- SOU alm. del Bilag Offentligt UNICEF Danmark Pakhus Sundkaj,. 0 København 0 Tlf. + 00 Fax+ unicefdk@unicef.dk www.unicef.dk Til: Socialudvalget og stedfortrædere Protektor: Alexandra,
Læs mereThe Urban Turn i en dansk kontekst. Høgni Kalsø Hansen Institut for geografi & geologi, KU
The Urban Turn i en dansk kontekst Høgni Kalsø Hansen Institut for geografi & geologi, KU hh@geo.ku.dk Hansen, H.K & Winther, L. (2012) The Urban Turn Cities, talent and knowledge in Denmark Aarhus University
Læs mereGet Instant Access to ebook Madkundskab PDF at Our Huge Library MADKUNDSKAB PDF. ==> Download: MADKUNDSKAB PDF
MADKUNDSKAB PDF ==> Download: MADKUNDSKAB PDF MADKUNDSKAB PDF - Are you searching for Madkundskab Books? Now, you will be happy that at this time Madkundskab PDF is available at our online library. With
Læs mereGenanvendelse ja tak - men i et livscyklusperspektiv
Genanvendelse ja tak - men i et livscyklusperspektiv Thomas H Christensen Professor, Dr.,PhD DTU Miljø Danmarks Teknsike Universitet Kongens Lyngby thho@env.dtu.dk Affald i Europa -2009 Eurostat 2012 2
Læs mereMicroRNA-150 Inhibits the Activation of Cardiac Fibroblasts by Regulating c-myb
Original Paper 2016 The Author(s). 2016 Published The Author(s) by S. Karger AG, Basel Published online: May May 17, 17, 2016 2016 Published by S. Karger AG, Basel 2103 1421-9778/16/0386-2103$39.50/0 Accepted:
Læs mere175 g 20 stk. Varenr.: 5650007846 EAN: 5701979304667. 175 g 20 stk. Varenr.: 5650007845 EAN: 5701979304568. American Grill
Product Catalogue Crisps Franske Kartofler Dip Chips Havsalt Sour Cream & Dild 220 g 16 stk. Varenr.: 5650007878 EAN: 5701979304513 Varenr.: 5650007846 EAN: 5701979304667 Varenr.: 5650007845 EAN: 5701979304568
Læs mereBreaking Industrial Ciphers at a Whim MATE SOOS PRESENTATION AT HES 11
Breaking Industrial Ciphers at a Whim MATE SOOS PRESENTATION AT HES 11 Story line 1 HiTag2: reverse-engineered proprietary cipher 2 Analytic tools are needed to investigate them 3 CryptoMiniSat: free software
Læs mere