Google App Engine. Google App Engine som platform. Claus Myglegaard Vagner og Jacob von Eyben

Størrelse: px
Starte visningen fra side:

Download "Google App Engine. Google App Engine som platform. Claus Myglegaard Vagner og Jacob von Eyben"


1 GoogleAppEngine GoogleAppEnginesomplatform ClausMyglegaardVagnerogJacobvonEyben

2 Abstract CloudcomputingerenteknologidervinderfremidengenerelleITinfrastruktur. SocialemediersåsomLinkedIn,TwitterogFacebookharøgetbehovetfor distribueredeapplikationerogdatacentre. StorevirksomhedersomGoogleogAmazonharåbnetopforatudefrakommende kanbenyttederescloudcomputinginfrastruktur. RapportenfokuserepåudviklingafJavaapplikationerpåGoogleAppEngine. Ligeledesserdenpåomudviklingietcloudcomputingmiljøkræverenanden tilgangtilarkitekturen,setiforholdtiltraditionellehostedeapplikationer. Dererudvikletenonlinenetbutiksomdanneretpraktiskerfaringsgrundlagtil underbyggelseafvoreskonklusioner.ligeledeserderpådetteoretiskeplan, perspektiveretiforholdtilfølgendealternativer:amazonec2,stax,aptana CloudConnectogegenhosting. RapportenviserhvaddertekniskskaltilforatudvikleenapplikationpåGoogle AppEngine,beståendeafteknologistakken:Wicket,Spring,JPA. Ligeledesviserrapportenatcloudcomputingkræverenandentilgangsvinkeltil specieltpersisteringafdata. GoogleAppEngineerengratisognemplatformatstarteoppå.Platformen skalerernemtogervelegnettilapplikationstypermedspidsbelastningsperioder. Enrækkekritiskebegrænsningeromkringlagerpladsogenøvregrænsepå processeringstidforetrequest,gøratmanbørovervejealternativecloud computingimplementationer.

3 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret Indledning Motivation Formål Problemformulering Aspekter Forretningen Platformen Integration Baggrund CloudComputing GoogleAppEngine Prismodelogkvoter BigtableogGAEDatastore Udviklingogafviklingafwebapplikation KendtebegrænsningeriGAE GoogleAppEngineservices Case Valgafteknologier JPA Spring Wicket Caseerfaringer Prismodelogkvoter Administrationogovervågning Backup Portering Versionering Persisteringafdata Transaktionsstyring Adgangtilfilsystemet Fejlsøgning Unittest Sockethåndtering HTTP/HTTPS FTP Webservices AlternativertilGoogleAppEngine AmazonElasticComputerCloud Stax AptanaCloudConnect Egenhosting Opsummering Konklusion Litteraturliste Process AfClausMyglegaardVagnerogJacobvonEyben Side1af44

4 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret Indledning Googlelanceredei2008GoogleAppEngine(fremoverbetegnetGAE)oggjorde hermedplatformen,sommangeafderesegneapplikationerbyggerpå, tilgængeligforatandrekunneudnytteden. GAEgivermulighedforgratisatafviklewebapplikationerpåGooglesIT infrastrukturogdenvejigennemmulighedfornemtatskaleresinapplikationtil atkunnehåndteremangesamtidigebrugere. MedGAEtilbyderGoogledogikkebaregodeskaleringsmulighederfor webapplikationer,menenhelstøbtplatformsomskalhjælpeudviklernemed helelivscyklussenforenapplikation.manuploadersinkodetilgooglesom sørgerfor,atafvikleden,atopgradereplatformen,atviselogfiler,ogidethele tagetaltvedligeholdelsesomliggerudoverselveapplikationskoden. Dettebetyder,atmansomudviklerkankoncentreresigomdetatudvikleselve applikationenogikkeominstallation/opsætningafmiljøetdenskalafviklesi. Platformenunderstøttertoprogrammeringssprog.DetfortolkedesprogPython ogdetkompileredesprogjava.tilbeggesprogerderlavetetsoftware DevelopmentKitsomgørdetmuligt,atudviklesinapplikationlokaltfor efterfølgendeatuploadedentilgae.administrationafapplikationenforegår gennemenwebbaseretkonsol. IdennerapportvilviudelukkendefokuserepådendelafGAEderkanafvikle Javawebapplikationer.Viviludvikleenlillenetbutik,somvibenyttersomcase, tilatkommerundtomgaeplatformenogdenvejigennembesvare problemformuleringen. 1.1 Motivation MotivationenbagdetteprojektbyggerpåatundersøgeomGAEkunneværeen muligplatformforfremtidigeapplikationervimåtteudvikle. Hvismanvælgerselvattagesigafheleafviklingsplatformen,kandetvære omstændigtatfådeploy etenwebapplikation.derskalindkøbeshardware, opsættesnetværkoginstalleressoftwareogaltsammenskalløbende vedligeholdes. Etwebhoteludeibyen,medunderstøttelseafJava,erogsåenmulighed,som krævernogetmindreforatkommeigang,mendetvilaltidværeenløsningsom kosterogtypiskikkeskalerernemt. DaGAEløserovenståendeproblemervedgratisattilbydeafviklingafJava webapplikationerietnæstenvedligeholdelsesfritskalerbartmiljø,åbnerdet mulighedersomgørvejenfraidétilrealitetmegetkortere. 1.2 Formål Voresforhåbningogdetviønskeratundersøgeer,hvorvidtGAEkanværemed tilatdrivenyeideergennemafviklingafprototypersommåskeenddakunne udviklesigtilfærdigeapplikationerogstadigforblivepågaeplatformen. AfClausMyglegaardVagnerogJacobvonEyben Side2af44

5 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 VivilhaveafklaretomvimedGAEkanafvikleenapplikationudvikletsomvi ellersvillehavegjortdet,ietmiljømedfuldkontrol.oghvisikkedetkanladesig gøre,hvorstorebegrænsningernesåer. 1.3 Problemformulering MedudgangspunktiGAEsomplatformforenJavawebapplikationvilvi forklare/besvarefølgende: forklarehvilkeprincippermanskalbenytteforatafviklewebapplikationerpå GAE. sammenlignegaemedandrealternativerogudpegedevæsentligefordeleog ulemperiforholdtildisse. beskrivehvordandenunderliggendeimplementationafgaeindvirkerpå programmørensmuligheder. vurdererelevanteforholdomkringafviklingafprogrammerpågae,såsom skalerbarhed,robusthed,sikkerhedogportabilitet. forklarehvordanenjavawebapplikationkanmigreresfragaetiletandet servermiljøinklusivapplikationsdata. 1.4 Aspekter EnvurderingafenplatformsomGAEkansesfraforskelligesider. Viharvalgtatopdelebelysningeni3kategorier: Figur1:AspektersomvivilbrugeianalysenafGAE. Tilhverkategoriharvivalgtenrækkerelevanteaspekterdererværdattagei betragtningnårenplatformskalanalyseres Forretningen Setfraetforretningsmæssigtsynspunkterfølgendeaspekterinteressante. Prismodel HvilkenprismodeltilbyderGAE? Administrationogovervågning Erderhjælptiladministrationafapplikationen? Portering AfClausMyglegaardVagnerogJacobvonEyben Side3af44

6 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 Hvilkeudfordringererderiforbindelsemedatportereenapplikation vækfragaeplatformen? Backup Erderdatasikkerhed? Platformen Kiggervipåselveplatformenerderrenttekniskenrækkeinteressanteaspekter derbørkiggespå. Persisteringafdata Hvilkemulighedererderforatfåpersisteretdataoghvordanlaverman forespørgslermoddepersisterededata? Transaktionsstyring Hvilkemulighedererderforatstyretransaktioner? Adgangtilfilsystemet Erdetmuligtatskriveoglæsetilogfrafilsystemet? Fejlsøgning KanmanprofileogdebuggeenGAEdeployetapplikation? Unittest Hvadermulighederneforatafvikleunittest? Versionering Hvilkekraverdertilreleaseafnyeversioner? Integration HerservipåmulighederneforatkommunikeretilogfraenGAEhostet applikation. Sockethåndtering Hvorvidtderkanlavesdirektesocketforbindelsertilogfra applikationen? HTTP/HTTPS HvilkemulighederharmanforatforetageGETogPOSTforbindelserbåde medogudenbrugafssl? FTP ErdetmuligtatbenytteFTPprotokollen? Webservices Kanderforetageswebservicekaldtilogfraapplikationen? 2 Baggrund Ifølgendeafsnitvilvibeskrivehvadcloudcomputingteknologienerogkomme nærmereindpåhvadgaeplatformenbeståraf. 2.1 CloudComputing MedGAEmelderGooglesigpåbanenblandtudbydereafdetsåkaldteCloud Computing.Idetfølgendevilvigiveenkortindsigtihvaddererkarakteristisk vedcloudcomputingogenredegørelsefortermertypiskbrugtomkringemnet. CloudComputing(CC)handleromatfåleveretnogleservicesfraenleverandør overinternettet.detkanværebådeinfrastrukturogsoftware. AfClausMyglegaardVagnerogJacobvonEyben Side4af44

7 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 FølgendeerkarakteristiskforCC(Reese, 2009): Elastisk MedCCskalmanhurtigtkunnefåstilletekstraressourcertilrådighedog ligeledesfrigøreressourcersomikkelængereernødvendige. Udgifter PrisenforCCafregnesefterforbrug.Detgiverenlangtmindreudgifttil indkøbafhardware.nogleafdisseudgifterrykkesdogoveriden efterfølgendeoperationelledelogudgiftenvilafhængeafhvilkenformfor CCderbenyttes.LidtsenerevilvikommeindpåprismodellernefordeCC platformeviharvalgtattageibetragtning. Klienter Enapplikationskalkunnetilgåsuafhængigtaflokalitet.Detvilsige,at manmedenbrowsermedeninternetforbindelseskalkunnenå applikationenoveraltiverden. Pålidelighed Pålidelighedvilværestørreiogmedatmantypiskharredundante lokationermedserveresomallebidragertildensamme cloud. Skalerbarhed SkalerbarhedernogetmansombrugernemtskalkunneskruepåietCC miljø.detkunneentenskeautomatiskellergennemetwebinterfacehvor manefterbehovkanskrueopforressourcer.dettekanværemeget anvendeligtforapplikationersomsvingermegetiantalletafsamtidige brugere. IforbindelsemedCCbliverderoftenævntfleretyperafservices: InfrastrutureasaService IaaS PlatformasaService PaaS SoftwareasaService SaaS AfClausMyglegaardVagnerogJacobvonEyben Side5af44

8 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 Følgendefigurviserhvordandisseformeroverlapperhinanden: Figur2:ViserhvordanIaaS,PaasogSaaSoverlapperhinanden. IaaShenvendersigprimærttilnetværksarkitekterogerleverancenafIT infrastruktur.detteskeroftegennemenvirtualiseringsteknologi.manfåraltså ikkeandetendcomputerestillettilrådighedogmanskalselvsørgefor installationafsoftware.nogleudbyderehardoglavetværktøjersomletterdette. Mereunderafsnit4.2. PaaShenvendersigtilapplikationsudviklereogerleverancenafenhelplatform medapi ertilatudvikleapplikationerpå.manhartypiskmindrefleksibilitetend vediaasdamanerunderlagtenprædefineretplatform.derimodkanman udelukkendekoncentreresigomatudviklesinapplikation.gaeerenpaas. SaaShenvendersigtilslutbrugerneogerleverancenafnogetsoftwaresomer hostetgennemcc.eksemplerpådetteergmailoggoogledocs. 2.2 GoogleAppEngine Vivilidetteafsnitbelyseplatformenudfradendokumentationderfindesom GoogleAppEngine.Detvilværedokumentationskrevetomselveplatformen ellerrelateredeemnersomf.eks.bigtable Prismodelogkvoter GAEersomtidligerenævntgratisatkommeigangmed.Googlehardogsatnogle kvoterpåforbrugsomdetkosteratoverskride.manskalaktivtslåtil,gennem administrationen,atmanforventeratskullebetaleforforbrugudoverkvoterne medsinaktuelleapplikation.detbetyder,atmanikkeligepludseligfåren regningfragooglefordimanharoverskrevetenkvote.harmanikkeaktiveret AfClausMyglegaardVagnerogJacobvonEyben Side6af44

9 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 betalingforapplikationenogmanoverskriderenkvotevilderopståenfejlsom viltagesigforskelligtudaltefterhvilkenkvotederoverskrides 1. OverordnetsetkanmanopdeleGAEkvoteri2kategorier: fakturerbarekvoter fastekvoter Defakturerbarekvoterkanforøgesgennembetalinghvorimoddefastekvoter ikkekan,dadeermedtilatsikreatgae,somplatform,kanydeogskaleresom detloves. Enkvoteblivernulstilleténgangidøgnet. Fakturerbarekvoter Defakturerbarekvotererpålagtfølgenderessourcer: Båndbredde CPU Lagerplads E mail NårkvoternefordisseressourceroverskridesharGoogleenprismodelhvor manbetalerfordetmangåroverkvoten. Ressource Kvote Prispr.enhed Enhed Udgåendebåndbredde 1 $0,12 Gigabyte Indgåendebåndbredde 1 $0,10 Gigabyte CPUtid 6,5 $0,10 CPUtimer Lagerplads 1 $0,15 Gigabyteommåneden Sendtee mails 2000 $0,0001 Modtager Tabel1:Kvoterogpriserpåforbrugudoverkvoterne 2 anno12/2009. Mådenhvorpåmanadministrereomkostningerneer,atmanopsætteret dagsbudgetforhvadensapplikationmåbrugeafpenge.gårensapplikationud overkvoternefortilsidstatrammeomkostningsgrænsenvildersomtidligere nævntreturneresenfejlfraapplikationen. Googleharydermerelaveten pr.minutkvote forbådefakturerbaresomikke fakturerbarekvoter.dennekvotesikreapplikationenmodikkeatforbrugeen kvotemegethurtigthvisf.eks.enandenapplikationkørerrovdriftpåenspecifik ressource.eksempelvisfordenindgåendebåndbreddehvorkvotenpr.dager1 gigabyte,såmådermaksimaltkomme56megabyteiminuttet. Fastekvoter Dererressourcer/servicessomGoogleikketilladeratmanbarekøbermereaf. DeenkelteGAEservicessomvibeskriversenerevilallehaveetsætaffaste 1Enmeredetaljeretbeskrivelseafhvilkenfejlsomkommerhvornårerbeskrevether: 2Priseroplystgennem AfClausMyglegaardVagnerogJacobvonEyben Side7af44

10 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 kvotertilknyttet 3.BortsetfraMailservicenhardeandreserviceskvoteraltefter omdeterenbetalendeapplikation. Vivurdereratmangeafdefastekvotererhøjeogvilideflestetilfældevære tilstrækkeligeihvertfaldhvismanharopsatbetalingforsinapplikation.idet øjeblikmanopsætterbetalingøgesdissefasterkvoter.foreksempelkanen gratisapplikationmodtage1,3millionforespørgsleromdagenhvorimoden betalendeapplikationkanmodtage43millioner.kvoterneergenereltmeget højereforbetalendeapplikationer,menmankommerdogogsålangtmedet maksimumpå1,3millionforespørgsleromdagen. Derkanværeforskelligeårsagertil,atmanikkekankøbesigtilmere,meni bundoggrundmådetbyggepå,atgaesomplatformsætternogleydrerammer foralleapplikationernesomermedtilatsikreydeevne,stabilitetog skalerbarhedforheleplatformen BigtableogGAEDatastore BigTable(Fay Chang, 2006)erenproprietærdatabaseudvikletafGoogle.Google benytterselvbigtabletilenrækkeafderesegneapplikationersomf.eks: YouTube,GoogleMaps, Databasetype GoogleharunderudviklingenafBigTablehaftfokuspåatdistribueredataud overenlangrækkefysiskemaskiner. DetharværetmedtilatBigTableikkeerenrelationeldatabasesomkendesfra,ms SqlogMySql.Dvs.dererikkeernogettraditioneltdatabase skema. Istedeterdataorganiserethierarkisk.Entiteteridatabasengrupperesi træstrukturerhvorhverentiteterennodeiettræ.entræstrukturbetegnessom enentitygroup,hvordenøversteentitetbetegnessomtræetsroot entity. ForskellenimellemBigTableogentraditionelrelationeldatabasekanudtrykkes igennemfølgendelilleeksempel: Ienrelationeldatabasemodelleresforholdetmellemenbogogetkapitelveden en til mangerelation,hvorimoddetibigtablemodeleresvedatenboger forældreentitetentiletkapitelienhierarkiskstruktur. Denmanglendeskemadefinitiongøratconstraintskunkanadministreresi applikationslaget.denneformforløstskemabetegnessoftscheme.etframework somf.eks.javapersistinceapi(jpa) somviharvalgtatbenytteivorescase kanhjælpemedtilathåndteredetteigennemdetsrelationsannoteringer. 3Enoversigtoverallekvoternekanlæsesher: AfClausMyglegaardVagnerogJacobvonEyben Side8af44

11 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 EntityGroup EntiteterbetegnessomværendeisammeEntityGrouphvisdetilhørersamme root entity.heltkonkretvildetsigeatderesnøgleerprefix etdetsamme. Eksemplerpånøglerkansesher: butik(1)/customer("003307f4-bc60-483c-b87d-ddc5738cdbc0") butik(1)/customer("42dba cbe-9ec3-b8707ba7de58") Kodeeksempel1:TonøglerforCustomerentiteterderbeggefigurererunderdensammeroot entityderhedder butik(1). Transaktionshåndtering BigTableindeholderikkeisigselvtransaktionsstyring,mendennesupporter byggetindidetpersistenslagderbenyttespågae somerenudvidelseaf BigTable.ViharvalgtatbetegnepersistenslagetGAEDatastore,mendereri skrivendestundikkemeldtnogetofficieltnavnudfragooglesside.detrygtesat navnetpådettedatastorebetegnesmegastore 4. TransaktionsstyringiGoogleDatastore,kankunforetagesindenforentiteteri sammeentitygroup. QueryLanguage ForespørgslerimodBigTabledatabasenskerigennemGooglesegetquerysprog GQL(GoogleQueryLanguage).GQLerisyntaksmegetligSQLsomkendesfra relationelledatabaser. BigTableharfrastarthaftfokuspåhastighedvedforespørgslerogharderfor committetsigtilatforespørgslerskalererlinærtiforholdtilresultatsættet(ross, 2009).DethargjortatderendnuikkeersupportforjoinsiBigTable,daGoogle ikkeharløstproblemstillingen,atundgåatlaveetkrydsproduktvedjoinafto ellerfleretabeller(ross, 2009) Udviklingogafviklingafwebapplikation GAEplatformenharsupportforkodekompileretmedJava5eller6. ForatkunneafvikleenwebapplikationpåGAEplatformenskalderbenytteset GAESoftwareDevelopmentKit(SDK)dergratiskandownloadesfraGoogle. DeterigennemdenneSDK,atapplikationeruploadestilGAEplatformen. GAESDK etgørdetogsåmuligtatafvikleenapplikationlokaltigennemen stubbetgaeplatform.unittestafklasser,samtdownloadingaflogfilerskerogså igennemdettesdk. MedGAESDK enfølgeretant 5 script,dergørdetnemtatkompilereoguploade applikationertilgaeplatformen.ivoresudviklingharvidogvalgtprimærtat 4IfølgedenneblogkandetværeMegaStorederbenyttes: 5Anteretxmlscriptingsprog,derividudstrækningbrugestilkompileringogautomatisktestaf kode AfClausMyglegaardVagnerogJacobvonEyben Side9af44

12 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 brugeetpluginudvikletafjetbrains 6,derpasserspecifikttilIntellijIDEA,somer denide(udviklingsmiljø)viharvalgtatbenytteunderudviklingenafvorescase. ForatafvikleenwebapplikationpåGAEplatformenskalapplikationen udover densædvanligeweb.xmlfil,ogsåindeholdeenspecielappengine web.xml. Denneappengine web.xmlindeholderspecifikkegaeparametre.deterf.eks. versionenafdensoftwarederuploades,miljøvariablebrugtiapplikationenog omapplikationenunderstøtterssl.indholdetafdenneappengine web.xmlfil fortolkesafgaeplaformennårapplikationenuploades KendtebegrænsningeriGAE ApplikationerpåGAEplatformenhostesiensandbox,forståetpådenmådeaten rækkespecifikkejavaapi erikkekanbenyttespågae.mådengaeharvalgtat implementeredettepåervedatarbejdemedetmodificeretjavaruntime Environment(JRE).DetteJREindeholderenwhitelist 7 afalledeklasserfrajava DevelopmentKit et(jdk)somkanbrugesunderafviklingenafetprogram. PådennemådeharGAEforhindretfølgendeoperationerderallevillebinde afviklingenafenwebapplikationtilenspecifikfysiskmaskineogdermed besværliggøredistribuering: Ingenadgangtilfilsystemet o Skriveoglæsetildiskbinderafviklingentildenfysiskemaskine Ingenoprettelseaftråde o Implementationenafhvorledestrådeafviklesbindersigkraftigttil enspecifikjvm,somigenknyttersigtildenmaskineapplikationen afviklespå. Ingendirektesocketadgang o Direktesocketadgangerento vejskommunikationimellemto netværksadresserogdetviligenbindeapplikationentilenspecifik maskineitidsrummethvordennesocketeråben. VedatforhindreadgangentildissenævntetingbevarerGooglekontrollenover hvordeønskeratafvikleapplikationen. DerernogleandrevæsentligebegrænsningerforapplikationenpåGAE.En forespørgseltilapplikationkanmaksimaltkørei30sekunderhvilketbetyderat hvismanharstoredatamængderellerlaverandentungprocesseringvildenne begrænsningværeenhindring. Ydermeremåetsvarfraapplikationenikkeoverstige10MBoghverenkelt datastoreentitysomgemmeskanikkefyldemereend1mb.1mbgrænsenkan hurtigtbliveoverstegethvismanvilgemmebilleder,pdffileroglign. 6FirmaetbagIDE enintellijidea 7 AfClausMyglegaardVagnerogJacobvonEyben Side10af44

13 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 Kvote Maksimum 10 Tidpr.forespørgsel 30sekunder httpsvarstørrelse 10MB Entitetstørrelse 1MB Kodestø 150MB Tabel2:TabelovernoglefastebegrænsningermedGAE GoogleAppEngineservices GAEtilbyderenrækkeservices,somensapplikationerfritkanbenytte,mensom ogsåermedtilatimødekommeenrækkeafdebegrænsningerderfindespågae platformen.vivilhergennemgådeforskelligeservices. Cronjobs Atmanikkekanoprettetrådegørdetumiddelbartumuligtatforetage asynkroneoperationer.foratimødekommedetteproblem,hargaeudstilletet proprietærtapitilnetopathåndterecronoperationer 8.IgennemdetteAPIer detmuligtatschedulereretjobtilatblivekørtpåfastlagtetidspunkter.deter specieltnyttigtnårf.eks.etopensourceapisomquartz 9 ikkeunderstøttes. TaskQueue IgennemdetteAPIerdetmuligtlæggeopgaverienkø,hvorfradesåvilblive udført.detteapieriskrivendestundstadigunderudviklingogbetegnesderfor ikkestabilt. URLFetching Detersomsagtikkemuligtatoprettedirektesocketstilandremaskinerpå relateredeklasser.deerimplementerettilatbenyttegae segenurlfetch 10 service,fornetopatforhindredendirektesocketforbindelse. DetteURLFetchAPIbenyttesogsåtilattilgåHTTPSadresser.DenGoogle specifikkeproxyderbenyttesunderhttp/httpsforbindelsergiverikke mulighedforatauthenticatedenhostderforbindestil.resultateter,atalle certifikateraccepteresinklusivself signedcertificater.dennemangelpå authenticationgørdetumuligtatforhindrehvadderiit terminologierbetegnes man in the middle 11 angreb.denneurlfetchservicegørdetkunmuligtat forbindetilport80og443,somerstandardporteforhttp/httpsforbindelser. Memcache MemcacheerencachederkanbrugespåGAEplatformen.Deterendistribueret 8 9http://www.quartz 10 11Enbetegnelsehvordereren3.partsomlyttermedpåendataudveksling: in the middle_attack AfClausMyglegaardVagnerogJacobvonEyben Side11af44

14 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 hukommelsesbaseretcachesomkanbrugesforandatastore etellerhelterstatte detafhængigtafapplikationen. MemcacheerenimplementationafenJavastandard 12 somgiveretinterfaceder svarertildatastrukturenforetjavamap.detvilsige,atmangennemennøgle kanhenteoggemmeværdierforalleklassersomerserializable. Mail MedGAEplatformenharmanmulighedforatsendeogmodtagee mails. InterfaceterJavaMail(javax.mail).DererikkebehovforatkonfigurereenSMTP server,dadetergivetgennemimplementationenafmailservicen. Nårenapplikationskalmodtageene mailskerdetgennemenforespørgsel initieretafplatformentilapplikation,somsåskalhaveimplementeretnoget kodetilattageimoddisse,somf.eks.enservlet. XMPP EnGAEapplikationkansendeogmodtagechatbeskedertilogfraenhver XMPP 13 kompatibelservice.dettekunneværegoogletalk.indkommende beskederbliverlavetomtilenhttppostmodenbestemturlsomapplikationen kanlaveenservlettilattageimod. Billeder Udviklermanenapplikationsomkræverbilledbehandling,erdettemuligtpå GAE.Derfindesenbilledeservicesomkanhjælpemedf.eks.atskalere,rotere ellerbeskæreetbillede. Mankanogsåsætteflerebilledersammenogkonverteremellemforskellige formater.servicenharenalgoritmesomkanværemedtilatforbedrekvaliteten afbilleder.harmanbehovformetainformationombilledet,såsomhøjdeog breddekandetteogsåladesiggøre. GoogleAccounts EnhverapplikationpåGAEkanbrugeGoogleAccountssomlogin.Viharivores casevalgtatgøredette.nårmanskalloggeindblivermansendtvideretilen loginsidesomikkedirekteerendelafensapplikation.detteskalmanvære opmærksompåmht.applikationsdesignet,dadennesidefølgergooglesstandard logindesign. Nårenbrugererloggetinderderadgangtilmailadressen.Ermanudviklerpåen applikationvilmanværemarkeretsomadministrator.denneadministrator informationerogsåtilgængeligforapplikationenefterbrugerenerloggetind. GoogleAccountsservicenerikkenødvendigatbruge,meneretalternativtilselv atskriveenbrugerhåndtering. 12JSR107(javax.cache) 13ExtensibleMessagingandPresenceProtocol AfClausMyglegaardVagnerogJacobvonEyben Side12af44

15 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret Case Dererblevetudvikletenbutikmedbegrænsetfunktionalitetforståetpåden mådeatfokuserrettetmodateksercereapplikationensåledes,atvifårbelystde deleafgaedetkræverforatbesvareproblemformuleringensåfyldestgørende sommuligt. Casenertilgængeligpåfølgendeurl: Netbutikkenvilbeståaftobrugergrænseflader. Admininistrationsgrænseflade Enadministrationsgrænseflade,hvordetermuligtatopretteprodukterderkan sælgesibutikken. Dennegrænsefladevilkræveautorisationforatfåadgangtil. Dererlavetenfiktivordrebehandlerdermedjævnemellemrumvilsøgealle ikkebehandledeordreigennemogbehandledem.ipraksisvildetikkesige andetendatmarkererdemsombehandlet. Offentliggrænseflade Ensidehvorallekanvælgeiblandtdeprodukterderkankøbesibutikken. Dervilværemulighedforatfyldevarerien'indkøbskurv'. ForatgennemføreetkøbskalbrugerenloggeindviaenGoogleAccount.Første gangenbrugerkøbeributikkenskalvedkommendeindtastenogle brugerspecifikkeoplysninger dissevilblivegemttilfremtidigekøb. Selvebetalingenvilbliveudeladtdavibegrænserosfraatintegreremedsikker internetbetaling. Detvilogsåværemuligtatseenlisteoverhistoriskeordre. Følgendefigurviseretkøbs flowibutikken: Figur3:Diagramderviserhvorledesenordregennemføres. AfClausMyglegaardVagnerogJacobvonEyben Side13af44

16 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret Valgafteknologier Ivoresvalgafteknologiertiludviklingafcasen,harvilagtvægtpåatbenytte teknologiervivederanerkendteiopensourcemiljøetogsamtidigvilvære seriøsekandidaternårder,ienvirksomhed,skalvælgesteknologiidag. Derudoverharvilagtvægtpåatdeterteknologiervierbekendtmedfravores hverdagsomprofessionellesoftwareudviklere JPA JavaPersistenceAPI(JPA)eretpersistensAPIudvikletafSun. Dennetypeframework ogsåbetegnetobject Relational Mapping(ORM)API gørdetmuligtatmappejavaobjektertilrelationelledatabaser. Normaltnårmanmapperjavaobjekterimodrelationelledatabaserkanman vælgeimellemenrækkeforskelligeimplementationerafjpa,mendagoogle DatastoresomnævntikkeerenrelationeldatabaseerdetkunDatanucleus 14 der endnuharenimplementationafjpaopimodgoogledatastore.datanucleuser implementeretvedatdenskalpostprocessererdenkompileredebytekodefor dejpaannoteredeklasser,indendekanafviklespågae. ForespørgsleriJPAskerigennemJPQL(JavaPersistenceQueryLanguage). DatanucleusimplementationenafJPAsørgerforatoversættedetteJPQLtilGQL somerforespørgselssprogetimodgoogledatastore. Etalternativtvalghavdeværetdetandetpersisteringsframeworkunderstøttet pågaejavadataobjects(jdo).jdotagerikkeudgangspunktienrelationel datastruktur,menerenmeregenerelabstraktionoverpersisteretdata. ViharvalgtatholdefastiJPA,davigernevilleprøveatudvikleenapplikationtil GAE,somviellersvillehavegjortdet,hvorvinormaltvillevælgeJPA Spring Springeretframeworkderharvundetfremisoftwareindustrienikølvandetpå detopgørderharværetmedde tunge EJB2containererogJ2EE.Springbliver afmangebetegnetsomen"lightweightcontainer.enletvægtscontainerder håndtererenrækkecrosscutting concernssåsomf.eks.transaktioner,loggingog authentication/autorization desammetingejb2containerevaretog nubare udenatstillekravomatkodenafviklesietspecifiktcontainermiljø. DerudovertilbyderSpringogsåbegrebetDependencyInjection.Kortfortalt,er dependendcyinjectionenformforinversionofcontrol,hvormådenhvorpåen afhængighedfraenklassetilenandenikkelængereopfyldesvedopslag,men istedet gives (injectes)indviaentenset ermetoderellersomparametretil konstruktørenforjavaklassen.hervedlavesderenløskobling,dadeninject ede klasseførstafgørespåruntimetidspunktet Wicket DerfindeenlangrækkeforskelligewebframeworkspåJavaplatformen.Enstor delafdemestbenyttedeopensourceframeworksderidagbenyttesiindustrien, 14DatanucleuseretJPA1.0kombatibeltframeworktilprocesseringafjavaklasser mappesnedtilbigtabletabeller AfClausMyglegaardVagnerogJacobvonEyben Side14af44

17 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 meddettefratidligere. KortfortalterWicketetkomponentbaseretwebframeworkdergiverenren opdelingimellempræsentationslagetogdetlogiskelag. 3.2 Caseerfaringer Udviklingenafdensimplenetbutikviharstilletopsomcase,hargivetenrække erfaringersomviharvalgtatbeskriveienopdelingdersvaretildeaspektervi vilbelysevedgaeplatformen Prismodelogkvoter Prismodellerogkvotererberørtiafsnit2.2.1.Vierivorescaseikkekommet yderligereindpådetteemne. AfClausMyglegaardVagnerogJacobvonEyben Side15af44

18 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret Administrationogovervågning GAEkommermedenadministrationskonsolsomstillerforskelligefunktionertil rådighedsomgøradministrationogovervågningnemmere. Administration Billede1:ScreenshotafDashboardfraGAEadministrationskonsollen Viharigennemudviklingenafvorescaseværettopersonersomhverisærhar kunnelæggenyeversionerafapplikationenoppågae.denneadministrationaf hvemsomerudviklerpåapplikationenereteksempelpåhvadmankanstyrefra konsollen.nårdererfrigivetennyversionvildetteogsåfremgåunder Versions skærmbilledethvormanogsåharmulighedforatskifteversionen. LigeledesbliverderogsåvedligeholdtenAdminLogsomviserhvilkenudvikler somhargjorthvad,somf.eks.athavelagtennyversionpå. ManharogsåmulighedforattilgåDatastore etoglaveforespørgsler,menogså opretteogredigeredatastoreentiteter. AfClausMyglegaardVagnerogJacobvonEyben Side16af44

19 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 AfClausMyglegaardVagnerogJacobvonEyben Side17af44 Overvågning GAEovervågningstarterpåforsidenafkonsollen.Herharmanmulighedforatfå diversegraferoverf.eks.forespørgslerpr.sekund,menogsåhvormangegange applikationenharreturneretenfejlpågrundafatenkvoteeroverskredet. MankansehvilkenURIsomindenfordesidste24timerhargenereretflestfejl ogderleveresetøjebliksbilledeafbelastningenpåapplikationen,samthvadder bliverbrugtafcputidfordeforskelligeuris. Dererogsåadgangtillogfiler,somkanpålæggesfiltre.Viharfleregangehaft behovforattilgådisselogfilergennemudviklingenafcasennårviharoplevet problemerpågae,somviikkegjordelokalt. Overvågningengiverselvfølgeligogsåetfuldstændigtoverblikoverforbrugi forholdtilkvoterneforapplikationen Backup DerfindesingenværktøjerellerhjælptilatforetagebackupafdatapåGAE platformen,såbackupermanselvansvarligfor.dadetkunerdenenkelte applikationderkantilgådetgoogledatastoredererallokerettilapplikationen, skalenegenudvikletbackupprocedureogsåkørepåplatformen.skaldette styresafencronmekaniskeskalbackupkunneinitieresafeturlkald Portering Vivilherkommeindpåhvilkemulighederdererforatportereenapplikationtil ogfragae. Porteringafdata Ligesomforbackupafdata,findesderingenværktøjerderkanhjælpemed dette. Deterderforoptilapplikationsudviklerneselvatsørgeforatskriveden nødvendigekodedergørdettemuligt.eksportenskalværemuligatforetage igennemetalmindeligthttprequest,forsomvikommernærmereindpåer detteenesteintegrationsmulighed. Nårdennesoftwareskriveserdetvigtigtatværeopmærksompåbegrænsningen forhvorlængeetrequestertilladtatkørepågae,samtbegrænsningenpå10mb forresultatetpåenforespørgsel(seafsnit2.2.4),dadetkanværeenhindringfor atskrivestørrebatchoperationertileksportafdata. Detmestsandsynligevilleværeatmanerinteresseretiateksporteretilen relationeldatabase.detvillederforværenaturligtatforsøgeateksporteredata direktetilsqlinsertstatements.dadataigoogledatastoreergemthierarkiskog ikkeharetschematilatsikredatakonsistens,såkanopgavenhurtigtvisesig ikkeatværetriviel.ligeledesskalbinærtdataenteneksporteresseparateller base64encode sforatværemuligtateksporterersomtekst. Vedeksporteringtilenrelationeldatabasevilledetværenaturligtfremoverat gørebrugafenrelationeldatabasesmulighederforatgenererid erautomatisk. IdkonverteringfraGoogle skeyformat,derrepræsentererenhierarkisk struktur,tilintegerbaseretid,erderforhellerikkehelttriviel.

20 GoogleAppEnginesomplatform Vejleder:ArneJohnGlenstrup IT Universitet,Efteråret2009 Ateksportererdirektetilsqlinsertstatementsermåskeikkedenoptimale løsning.eneksporttilf.eks.xmlellerjsonkanogsåværeenløsning,daman derigennemikkeharlagtsigfastpåetdestinationsformat.omvendtskalder skrivesenparserimodtagerenden,derkanforståudvekslingsformatet. Porteringafapplikationen Somudviklerbindermanuundgåeligtapplikationenoppåenrækkeproprietære API er,derskaltagesibetragtningvedmigreringafenapplikation.detværesig tilsigtetsomnårvif.eks.vælgeratgørebrugafgoogleaccountlogin,menogså utilsigtet,nårvi tvinges tilatbrugekeyfactoryogkeyobjektetsomnøglefor ensentiteter,ibestræbelsenpåatsikretransaktionsstyringpåtværsafalle entiteter(seafsnit3.2.7). HvortætbundetenapplikationerpåGoogleAPI erermegetindividuel,men voreserfaringfortælleratjolængereenapplikationhareksisteretpåengiven platform,jostørreersandsynlighedenforatdererdeleafapplikationender benytterproprietæreapi er. DetypiskeeksemplereratenapplikationbenytterdatabasespecifikkeSQL statements,ellercontainerspecifikkej2eefeatures. Vierderforoverbevistom,athvismanikkedesignermedenfremtidigmigrering itankernefrastart,vilapplikationenpåsigtblivetætbundettilplatformen, hvorforenporteringikkevilværetriviel. ViharkonkretkiggetpåhvormegetvorescaseharbenyttetproprietæreAPI er ogkanse,atviharbundetapplikationeniforbindelsemedfølgende: IdgenereringerbundettilKeyFactoryogKeyklasserne. GoogleAccountloginsomnøgletilkundedata,samttilbeskyttelseaf administrativesider(kræveradministrationsrettigheder) UnittestsætteretspecieltGAEmiljøop. VibenytterGoogleCron.Vedenmigreringvilviskulleimplementereen lignendefunktionalitetpådennyeplatform. VoresperfomancemålingerbenytterGoogle sdelegateapi Versionering IadministrationsværktøjetderstillestilrådighedpåGAEplatformenerdetnemt atstyrehvilkenversionafenapplikationderskalværetilgængeligpådomænet. Opgraderingafselvesoftware enerderforennemoperation.ennyversion skrivesindiappengine web.xmlognårapplikationeneruploadettilgae platformen,kandennyeversionvælgesfraadministrationskonsollen. Anderledesforholderdetsigforselvedatagrundlaget. Nårenapplikationstadigerunderudviklingogendnuikkeoffentliggjort,er datagrundlagetofteikkeetessentieltproblem.detersandsynligvisiordenat manfratidtilandensletteraltdataforigenatindlæsetestdata. Nårenapplikationertagetibrugerdatakerneniapplikationenogdatabliver pludseligtetcentraltbegrebvedreleaseafnyeversioner.detersandsynligtat ennyversionafapplikationenpåettidspunktbærernyedatastrukturermedsig. AfClausMyglegaardVagnerogJacobvonEyben Side18af44

Tredjepart webservices

Tredjepart webservices Tredjepart webservices 4. juni 2015 USS Dok. Klik her for at angive tekst. 1/12 Indholdsfortegnelse Introduktion... 3 Miljøer... 3 Adgang... 3 API kald... 4 GET: /authorizations... 4 Input 4 Output 4 Output

Læs mere

OIOSAML.NET og Umbraco. ved Thomas Ravnholt ravnholt @

OIOSAML.NET og Umbraco. ved Thomas Ravnholt ravnholt @ OIOSAML.NET og Umbraco ved Thomas Ravnholt ravnholt @ Silverbullet, stiftet 2003 Silverbullet A/S IT- rådgivning, projektledelse og implementering Officiel SKI-leverandør Kontorer i Århus

Læs mere

Databaseadgang fra Java

Databaseadgang fra Java Databaseadgang fra Java Grundlæggende Programmering med Projekt Peter Sestoft Fredag 2007-11-23 Relationsdatabasesystemer Der er mange databaseservere Microsoft Access del af Microsoft Office MySQL god,

Læs mere

Indhold. Senest opdateret:03. september 2013. Side 1 af 8

Indhold. Senest opdateret:03. september 2013. Side 1 af 8 Indhold Introduktion... 2 Scenarier hvor API et kan benyttes... 2 Scenarie 1 Integration til lagerhotel... 2 Scenarie 2 Integration til økonomi system... 2 API Modeller... 2 Webshop2 API Model v1... 3

Læs mere

Videregående Programmering Obligatorisk opgave - 3. semester, efterår 2004

Videregående Programmering Obligatorisk opgave - 3. semester, efterår 2004 Overvågningssystem Beskrivelse Bagagesorteringssystemet består af et antal skranker (check-in) til modtagelse og registrering af bagage, et automatiseret sorteringsanlæg samt et antal terminaler (gates),

Læs mere

Indhold. Senest opdateret : 30. juli 2010. Side 1 af 5

Indhold. Senest opdateret : 30. juli 2010. Side 1 af 5 Indhold Introduktion... 2 Scenarier hvor API et kan benyttes... 2 Scenarie 1 Integration til lagerhotel... 2 Scenarie 2 Integration til økonomi system... 2 Webshop2 API Model... 3 Brugen af API et... 4

Læs mere

Hvordan vælger jeg dokumentprofilen?

Hvordan vælger jeg dokumentprofilen? Hvordan vælger jeg dokumentprofilen? Valget af OIOUBL profil i en konkret dokumentudveksling vil bl.a. afhænge af, hvilke OIOUBL profiler den anden part i udvekslingen understøtter. Et konkret eksempel

Læs mere

Assignment #5 Toolbox Contract

Assignment #5 Toolbox Contract Assignment #5 Toolbox Contract Created by: René Kragh Trine Randløv E mail address cph 23 11 2014 1 Introduktion Dette dokument indeholder en vertikal kontrakt for et system som skal

Læs mere

RMI med BlueJ. Tutorial lavet af Jákup W. Hansen TSU 2006 3.semester 11. desember 2007

RMI med BlueJ. Tutorial lavet af Jákup W. Hansen TSU 2006 3.semester 11. desember 2007 RMI med BlueJ Tutorial lavet af Jákup W. Hansen TSU 2006 3.semester 11. desember 2007 Hvad er RMI? Når man arbejder med Distribuerede Systemer, som igen vil sige at man ønsker at flere end én komputer

Læs mere

4 sekunder. 20 sekunder. 1-3 timer. 14% hurtigere. 5-6% bagud. 30/70 split. Vejen til succes med Hybrid Cloud v/cso, Poul Bærentsen, Atea

4 sekunder. 20 sekunder. 1-3 timer. 14% hurtigere. 5-6% bagud. 30/70 split. Vejen til succes med Hybrid Cloud v/cso, Poul Bærentsen, Atea 4 sekunder 1-3 timer 20 sekunder 14% hurtigere 5-6% bagud 30/70 split Vejen til succes med Hybrid Cloud v/cso, Poul Bærentsen, Atea Emnerne jeg vil tale om Brændende platforme versus brændende ambitioner

Læs mere

Integrationsmanual. Anvendelse af webservice til kursusoversigt i Campus. Brugervejledning til udviklere

Integrationsmanual. Anvendelse af webservice til kursusoversigt i Campus. Brugervejledning til udviklere Integrationsmanual Anvendelse af webservice til kursusoversigt i Campus Brugervejledning til udviklere Moderniseringsstyrelsen Webservice manual til udviklere 2016 1 1. Indholdsfortegnelse Nyt kapitel

Læs mere

University of Southern Denmark Syddansk Universitet. DM503 Forelæsning 11

University of Southern Denmark Syddansk Universitet. DM503 Forelæsning 11 DM503 Forelæsning 11 Generics Pakker Exceptions Indhold Generics Nedarvning og Generics Generics Nedarvning og Generics Husk Box fra sidst Generics public class Box {! private T object;! public void

Læs mere

Software Construction 1 semester (SWC) Spørgsmål 1

Software Construction 1 semester (SWC) Spørgsmål 1 Spørgsmål 1 Objekter #1 Giv en kort præsentation af begrebet objekt, samt hvorledes du erklærer(declare), opretter(create) og bruger objekter Du kan beskrive o Datatyper o Variable / Instans variable /

Læs mere

1 Domæne 2 1.1 Design valg... 2 1.1.1 User... 2. 2 Klassediagran 5

1 Domæne 2 1.1 Design valg... 2 1.1.1 User... 2. 2 Klassediagran 5 INDHOLD 1 Domæne 2 1.1 Design valg.................................... 2 1.1.1 User.................................... 2 2 Klassediagran 5 3 Serbio 7 3.1 Kommunikation..................................

Læs mere

Fra idé til virkelig med Azure Mobile Services

Fra idé til virkelig med Azure Mobile Services Fra idé til virkelig med Azure Mobile Services Niels Ladegaard Beck Holion @nielslbeck Windows Developers in Denmark Azure App Service Mobile App Introduktion til Azure Mobile Services Platform

Læs mere

FairSSL Fair priser fair support

FairSSL Fair priser fair support Small Business Server 2003 Certifikat administration Følgende vejledning beskriver hvordan man vælger hvilke adresser der skal være i ens SBS 2003 SSL certifikat. For support og hjælp til anvendelsen af

Læs mere


SigmaT. Java + Groovy Disposition Om SigmaT Eksempel på indlejring af Groovy Overvågning af PEM Ønske om dynamisk loaded Java uden at fifle med classloaderen Groovy til hjælp Opsamling hvad jeg ikke har fortalt

Læs mere

AAU, Programmering i Java Intern skriftlig prøve 18. maj 2007

AAU, Programmering i Java Intern skriftlig prøve 18. maj 2007 AAU, Programmering i Java Intern skriftlig prøve 18. maj 2007 Opgavebesvarelsen skal afleveres som enten en printerudskrift eller som et passende dokument sendt via email til Besvarelsen skal

Læs mere

EDH-dokumenter. - på eksterne hjemmesider der ikke hostes af C&B Systemer

EDH-dokumenter. - på eksterne hjemmesider der ikke hostes af C&B Systemer EDH-dokumenter - på eksterne hjemmesider der ikke hostes af C&B Systemer Opbygning EDH-dokumenter For at præsentere EDH dokumenter på en hjemmeside, skal der konstrueres et system til hjemmesiden, der

Læs mere

FairSSL Fair priser fair support

FairSSL Fair priser fair support Microsoft IIS 6 Certifikat administration Følgende vejledning beskriver hvordan man installere et certifikat på en IIS 6 For support og hjælp til anvendelsen af denne vejledning kan du kontakte FairSSL

Læs mere

DM01 DM01. 3. Obl. Afl. Jacob Christiansen, 130282, D12, Elias 18/3-2003. Side 1 af 11

DM01 DM01. 3. Obl. Afl. Jacob Christiansen, 130282, D12, Elias 18/3-2003. Side 1 af 11 DM01 DM01 3. Obl. Afl. Jacob Christiansen, 130282, D12, Elias 18/3-2003 Side 1 af 11 DM01 Indholdsfortegnelse: BILAG:...2 1 FORMÅL:...3 2 KLASSER:...4 2.1 DILEMMA:...4 2.1.1 METODER:...4

Læs mere

Integrated Total Facility Management for Real Estate, Infrastructure & Facility Management

Integrated Total Facility Management for Real Estate, Infrastructure & Facility Management Integrated Total Facility Management for Real Estate, Infrastructure & Facility Management Udfordringen Top down Lederskab visioner Buttom up Fakta om Informi GIS 90 medarbejdere Full-size IT hus; salg/rådgivning/

Læs mere

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 2

University of Southern Denmark Syddansk Universitet. DM502 Forelæsning 2 DM502 Forelæsning 2 Repetition Kompilere og køre Java program javac java Debugge Java program javac -g jswat Det basale Java program public class HelloWorld

Læs mere

Servlets, Tomcat & BlueJ

Servlets, Tomcat & BlueJ Servlets, Tomcat & BlueJ Tutorial lavet af Jákup W. Hansen TSU 2006 3.semester 05.october 2007 Hvad er Servlets: For at forstå det, må vi først få styr på to begreber, nemlig statiske og dynamiske hjemmesider

Læs mere

IT-Basecamp 2013. Real World Java EE Patterns Adam Bien. Real World Java EE Patterns, Adam Bien Copyright Lund&Bendsen A/S

IT-Basecamp 2013. Real World Java EE Patterns Adam Bien. Real World Java EE Patterns, Adam Bien Copyright Lund&Bendsen A/S IT-Basecamp 2013 Real World Java EE Patterns Adam Bien 1 Indhold Lidt om mig Baggrund for valg af emnet Bogens opbygning Fra J2EE til JEE 5/6 Overflødiggjorte patterns Fremhæve et par patterns 2 Kenneth

Læs mere

Virkefeltsregler i Java

Virkefeltsregler i Java Virkefeltsregler i Java int i; int k; Sequence s; int j; What s in a name? Brian spillede blændende i søndags! Skolen ligger i Viby Ring til Kirsten og sig at... Et navn fortolkes i en kontekst og konteksten

Læs mere

Computer netværk og TCP/IP protokoller. dcomnet 1

Computer netværk og TCP/IP protokoller. dcomnet 1 Computer netværk og TCP/IP protokoller dcomnet 1 Maskinarkitektur.. fokus på intern organisation af en enkelt computer: dcomnet 2 Computer netværk.. kommunikation mellem maskiner forbindet i et netværk:

Læs mere

Model Drevet Design i Praksis

Model Drevet Design i Praksis Model Drevet Design i Praksis Dansk IT - På Vej Hjem møde d. 8/9-2009 Jeppe Cramon - TigerTeam ApS Lidt om mig 15 års erfaring som software udvikler Partner i TigerTeam Første erfaring med model drevet

Læs mere

1.1 Formål Webservicen gør det muligt for eksterne parter, at fremsøge informationer om elevers fravær.

1.1 Formål Webservicen gør det muligt for eksterne parter, at fremsøge informationer om elevers fravær. FraværService - systemdokumentation BRUGERDOKUMENTATION: WEB-SERVICE Af: Logica Indhold 1. Indledning... 1 1.1 Formål... 1 1.2 Webservice version... 1 1.3 Historik... 1 2. Absence Webservice...

Læs mere

Dag 10 Flertrådet programmering

Dag 10 Flertrådet programmering Videregående programmering i Java Dag 10 Flertrådet programmering Fremlæggelse af programmering/status for projekter Dokumentation med javadoc Flertrådede designmønstre: Arbejdstråd, Producent Konsument,

Læs mere

Udvikling af DOTNET applikationer til MicroStation i C#

Udvikling af DOTNET applikationer til MicroStation i C# Udvikling af DOTNET applikationer til MicroStation i C# Praktiske tips for at komme i gang. Gunnar Jul Jensen, Cowi Hvorfor nu det? Mdl og Vba kan det hele Fordelene er : udviklingsmiljøet er eksternt

Læs mere

DOtAB. Teknisk rapport

DOtAB. Teknisk rapport DOtAB Teknisk rapport Indholdsfortegnelse Introduktion... 1 Systemarkitektur... 1 Teknologier... 1 Platforme for mobile enheder... 1 Kommunikations interfacet... 2 Udviklingsmiljø... 2 IDOtAB (service

Læs mere

Grænseflade til afhentning og indberetning af prøvekarakterer i dansk og matematik på

Grænseflade til afhentning og indberetning af prøvekarakterer i dansk og matematik på Grænseflade til afhentning og indberetning af prøvekarakterer i dansk og matematik på Dato 16-09-2015 Version Status 1.0 Gældende Ansvarlig Tobias Thisted Side 2 af 11 Ændringshistorik Version

Læs mere

Arkitektur principper og design mønstre til realisering af enterprise applikationer baseret på rige domænemodeller (

Arkitektur principper og design mønstre til realisering af enterprise applikationer baseret på rige domænemodeller ( Arkitektur principper og design mønstre til realisering af enterprise applikationer baseret på rige domænemodeller ( Kim Harding Christensen EOS A/S Margrethepladsen 3 8000 Århus TLF: 8732 8787

Læs mere

PROGRAM. using System; using System.Collections.Generic; using System.Text; using System.Collections;

PROGRAM. using System; using System.Collections.Generic; using System.Text; using System.Collections; PROGRAM using System; using System.Collections.Generic; using System.Text; using System.Collections; namespace EventManager class Program static void Main(string[] args) string hovedmenu = ""; string svar;

Læs mere

Forelæsning Uge 6 Mandag

Forelæsning Uge 6 Mandag Forelæsning Uge 6 Mandag Tingene i denne forelæsning er ikke eksamenspensum Forelæsningen afrunder kurset, og forklarer nogle af de begreber, som I har mødt under kurset uden at få detaljeret forklaring

Læs mere

Tabelbegrebet. Klassediagrammer (III) Oversigt. Anvendelse af Tabeller. Tabeller og qualified associations

Tabelbegrebet. Klassediagrammer (III) Oversigt. Anvendelse af Tabeller. Tabeller og qualified associations Tabelbegrebet Klassediagrammer (III) Tabeller og qualified associations originally by Michael R. Hansen modified/extended by Anne E. Haxthausen Informatics and Mathematical Modelling Technical University

Læs mere


Webserverprogrammering Webserverprogrammering WSP fortsat - dag 11 Behandling af XML (StAX) Syndikering og RSS med XML JAXB - XML Java-objekter Projekthjælp Dette materiale er under Åben Dokumentlicens, se

Læs mere

Web- og serverprogrammering

Web- og serverprogrammering Web- og serverprogrammering Arkitekturer i webprogrammer - dag 6 Model-View-Controller-arkitukturen Flerlags-arkitekturer Læsning: WJSP 10 Dette materiale er under Åben Dokumentlicens, se

Læs mere

Konference om Cloud Computing 18. maj 2011. Proof of Concept for transition til Cloud Lars Ravndrup Thomsen, Solutions Architect, KMD

Konference om Cloud Computing 18. maj 2011. Proof of Concept for transition til Cloud Lars Ravndrup Thomsen, Solutions Architect, KMD Konference om Cloud Computing 18. maj 2011 Proof of Concept for transition til Cloud Lars Ravndrup Thomsen, Solutions Architect, KMD POC, hvad er det? En søgning på internettet viser, at de fleste sites

Læs mere

Security as a Service hvorfor, hvornår og hvordan. Gorm Mandsberg, Aarhus, 13.06.2013

Security as a Service hvorfor, hvornår og hvordan. Gorm Mandsberg, Aarhus, 13.06.2013 Security as a Service hvorfor, hvornår og hvordan Gorm Mandsberg, Aarhus, 13.06.2013 SecaaS hvorfor, hvornår og hvordan hvad Hvorfor.. Hvornår.. Hvordan.. Disclamer: Dubex er MSSP og leverer

Læs mere

Note om RMI af Peter Kjærsgaard

Note om RMI af Peter Kjærsgaard Note om RMI af Peter Kjærsgaard 1. Filosofi Filosofien i RMI er, at et objekt på en server skal kunne kaldes fra en klient, som om server-objektet lå på klienten. RMI er dermed på et højere niveau end

Læs mere

HVORDAN VI DOWNLOADEDE INTERNETTET. Man skal crawle før man kan gå

HVORDAN VI DOWNLOADEDE INTERNETTET. Man skal crawle før man kan gå HVORDAN VI DOWNLOADEDE INTERNETTET Man skal crawle før man kan gå DAGSORDEN Hvem jeg er Behovet for en crawler Arkitektur Nutch og Hadoop MongoDB Udfordringer Tak for i dag JACOB AVLUND Partner i Siblingsoft

Læs mere

A11: Last Year s Exam

A11: Last Year s Exam A11: Last Year s Exam Agenda Design of Site map and Web- structure (3) Design of data model (1) Design of database transactions (2) Construction of HTML and PHP scripts (3) Exercise 3: Design of Site map

Læs mere

ODIN-webservice ændringer release 2010 v2.0

ODIN-webservice ændringer release 2010 v2.0 DOKUMENTATION OG VEJLEDNING ODIN-webservice ændringer release 2010 v2.0 Indholdsfortegnelse 1. Nye webservice metoder... 2 1.1 Anvendelse af køretøjer og personel fra fremmede beredskaber ifm. indberetning

Læs mere

Objektorienteret Programmering

Objektorienteret Programmering Objektorienteret Programmering Struktureret Systemudvikling Jan Bendtsen Automation and Control Indhold Lidt om programmeringssprog Klasser i Java Klasser i C++ Oversættelse og kørsel af kode Et eksempel:

Læs mere

Bilag 1 Rige billeder Ordremodtagelse

Bilag 1 Rige billeder Ordremodtagelse Bilag1 Rigebilleder Ordremodtagelse Tværfagligtprojektpå2.Semester Bilag afchristian,kennetogmartin 71 Overordnet Tværfagligtprojektpå2.Semester Bilag afchristian,kennetogmartin 72 Produktionsgulvet Tværfagligtprojektpå2.Semester

Læs mere



Læs mere

Agenda. Muligheder for anvendelse. Komponenter. Features. Restore muligheder. DR og TSM integration. Repository. Demo. Spørgsmål

Agenda. Muligheder for anvendelse. Komponenter. Features. Restore muligheder. DR og TSM integration. Repository. Demo. Spørgsmål Agenda Muligheder for anvendelse Komponenter Features Restore muligheder DR og TSM integration Repository Demo Spørgsmål Muligheder for anvendelse Data Center dmsave/lokal TSM Remote Office Application

Læs mere

Videregående programmering i Java

Videregående programmering i Java Videregående programmering i Java Dag 6 Komponenter (og lidt Swing og MVC) Læsning: VP 4, evt. VP 6 Dette materiale er under Åben Dokumentlicens, se Grafiske komponenter

Læs mere


Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Jan-juni 2016 Institution UCH/ Handelsskolen Uddannelse Fag og niveau Lærer(e) Hold EUX Business IT B Lars

Læs mere

Løsning af skyline-problemet

Løsning af skyline-problemet Løsning af skyline-problemet Keld Helsgaun RUC, oktober 1999 Efter at have overvejet problemet en stund er min første indskydelse, at jeg kan opnå en løsning ved at tilføje en bygning til den aktuelle

Læs mere

Copyright SaaS-it Consult 2011. Er Cloud Computing blot en hype eller repræsenterer det virkelig værdi? Teknologisk Institut 13.

Copyright SaaS-it Consult 2011. Er Cloud Computing blot en hype eller repræsenterer det virkelig værdi? Teknologisk Institut 13. Er Cloud Computing blot en hype eller repræsenterer det virkelig værdi? Teknologisk Institut 13. september, 2011 Cloud Computing & SaaS Hvor er vi på vej hen? Agenda Definitioner The SaaS-it Evolution

Læs mere

Design by Contract. Design and Programming by Contract. Oversigt. Prædikater

Design by Contract. Design and Programming by Contract. Oversigt. Prædikater Design by Contract Design and Programming by Contract Anne Haxthausen Informatics and Mathematical Modelling Technical University of Denmark Design by Contract er en teknik til at specificere

Læs mere

Affaldsdatasystem Vejledning supplement i system-til-system integration brugere

Affaldsdatasystem Vejledning supplement i system-til-system integration brugere Affaldsdatasystem Vejledning supplement i system-til-system integration brugere Dokument version: 2.0 ADS version: 1.0 Henvendelse vedrørende affald: Miljøstyrelsen Roskilde, Affaldssekretariatet

Læs mere

SAX Simple API for XML.

SAX Simple API for XML. SAX Simple API for XML. En API (Application Programming Interface) et bibliotek eller et sæt af funktioner eller metoder. SAX er et sådant bibliotek af abstrakte metoder som f. eks. startdocument() eller

Læs mere

Hosted løsning... 3. Hosted produkter... 4. Dedikeret server hosting... 5. Virtuel server hosting... 6. Shared Office hosting... 7

Hosted løsning... 3. Hosted produkter... 4. Dedikeret server hosting... 5. Virtuel server hosting... 6. Shared Office hosting... 7 2011 Indhold Hosted løsning... 3 Hosted produkter... 4 Dedikeret server hosting... 5 Virtuel server hosting... 6 Shared Office hosting... 7 Exchange hosting... 8 Remote Backup... 9 Hosted løsning Hosting

Læs mere

Tænk ud af boksen med Microsoft Dynamics NAV og kig på Microsoft Dynamics NAV 2016

Tænk ud af boksen med Microsoft Dynamics NAV og kig på Microsoft Dynamics NAV 2016 INDLÆG 02 DYNAMICS NAV Tænk ud af boksen med Microsoft Dynamics NAV og kig på Microsoft Dynamics NAV 2016 Peter G. Tranders 04.11.2015 CGI Group Inc. 2015 Peter G. Tranders Uddannelse Rolle Certificeringer

Læs mere

Computer netværk og TCP/IP protokoller. dcomnet 1

Computer netværk og TCP/IP protokoller. dcomnet 1 Computer netværk og TCP/IP protokoller dcomnet 1 Maskinarkitektur.. fokus på intern organisation af en enkelt computer: dcomnet 2 Computer netværk.. kommunikation mellem maskiner forbindet i et netværk:

Læs mere

Adgangskontrol med Arduino

Adgangskontrol med Arduino Adgangskontrol med Arduino AfAsbjørnAndreasen,BasthiannBildeogTobiasHøjsgaard Klasse2.4 RoskildeTekniskeGymnasium Formål med system Viharforsøgtatfremstilleetsystem,derskalkunneforhindreellertilladeadgangtiléneller

Læs mere

Hvad er et distribueret objekt? Plan 12.3. Objekter, objektreferencer, metoder, parameteroverførsel. Objekter: notation

Hvad er et distribueret objekt? Plan 12.3. Objekter, objektreferencer, metoder, parameteroverførsel. Objekter: notation Plan 12.3. Oversigt over grundlæggende begreber Java: eksempel på applikation, programmering og oversættelse Uddybning af grundlæggende begreber Java RMI implementation Forklaring af øvelsen Hvad er et

Læs mere

SIP. Session Initiation Protocol TDC IP telefoni Scale. SIP design mål

SIP. Session Initiation Protocol TDC IP telefoni Scale. SIP design mål Session Initiation Protocol TDC IP telefoni Scale design mål Give mulighed for at integrere nye faciliteter efterhånden som de opfindes er ikke en erstatning for det offentlige telefonnet - er helt sin

Læs mere

Common Language Runtime. Multithreading

Common Language Runtime. Multithreading Common Language Runtime Multithreading Multithreading Dedicated threads Programmøren kontrollerer starttidspunkt, levetid m.m. for den enkelte thread. Pooled threads Threads lånes fra en pulje af

Læs mere

Kursus i OOP og Java. Kursus i Objektorienteret programmering i Java

Kursus i OOP og Java. Kursus i Objektorienteret programmering i Java Kursus i OOP og Java Kursus i Objektorienteret programmering i Java Åben Dokumentlicens Dette foredragsmateriale er under Åben Dokumentlicens (ÅDL) Du har derfor lov til frit at kopiere dette værk Bruger

Læs mere

Vejledning til Retsinformation web services test stubs

Vejledning til Retsinformation web services test stubs Civilstyrelsen Vejledning til Retsinformation Version:2 2010.02.08 Indholdsfortegnelse 1. Introduktion... 3 2. Installation... 3 3. Web Service beskrivelse og testdata... 3 2010.02.08 2 Side 2 af 5 1.

Læs mere

2.15 21/05/2013 Tilføjet dokumentation af bvn input for GetEngagementDetailed

2.15 21/05/2013 Tilføjet dokumentation af bvn input for GetEngagementDetailed APOS2 REST API Forord Dette dokument er en del af APOS version 2 manualerne. APOS version 2 (APOS2 herefter) er et organisation, klassifikation og personale system baseret på Sag & Dokument standarderne.

Læs mere

- Installationsvejledning for SOSIGW 1.1, NSP

- Installationsvejledning for SOSIGW 1.1, NSP SOSIGW - Installationsvejledning for SOSIGW 1.1, NSP Indeks Indeks... 1 Revisionshistorik... 2 Introduktion... 2 Forudsætninger og krav... 2 Installér ønsket JDK.... 2 Konfigurer JDK til ubegrænset kryptering...

Læs mere

Når du holder møder i Connect

Når du holder møder i Connect Når du holder møder i Connect Det er vigtigt at den/de der er host og presenter på mødet sidder ved en forholdsvis kraftig computer, og har en god bredbåndsforbindelse. Hvis man skal vise præsentationer,

Læs mere

Øvelse 9. Klasser, objekter og sql-tabeller insert code here

Øvelse 9. Klasser, objekter og sql-tabeller insert code here Øvelse 9. Klasser, objekter og sql-tabeller Denne opgave handler om hvordan man opbevarer data fra databasekald på en struktureret måde. Den skal samtidig give jer erfaringer med objekter, der kommer til

Læs mere

Specifikation Abstrakt OO OS-API Rev. 1.7. Specifikation. Abstrakt, objektorienteret operativsystem-api

Specifikation Abstrakt OO OS-API Rev. 1.7. Specifikation. Abstrakt, objektorienteret operativsystem-api Specifikation Abstrakt, objektorienteret operativsystem-api Indhold 1 Indledning... 3 1.1 Introduktion... 3 1.2 Formål... 3 1.3 Overordnede krav... 3 2 Ressourcer i OS-API et... 4 2.1 Tråde... 4 2.2 Timere...

Læs mere

Janich dk. Joomla Case Janich Rasmussen. Freelance Joomla! Professional. Joomladay Danmark 2011

Janich dk. Joomla Case Janich Rasmussen. Freelance Joomla! Professional. Joomladay Danmark 2011 Joomla Case Janich Rasmussen Freelance Joomla! Professional Email: Twitter: Web: @janichdk Joomladay Danmark 2011 Hvad er sol? Infrastruktur Tilført kompleksiteter siden

Læs mere

Hvorfor skal vi bruge objekt orienteret databaser?

Hvorfor skal vi bruge objekt orienteret databaser? OODBMS Vs. RDBMS 1 Indholdsfortegnelse Hvorfor skal vi bruge objekt orienteret databaser?... 3 OODBMS i erhvervslivet... 4 Bagsiden af medaljen... 5 OODBMS i praksis... 6 Konklusion... 8 2 Hvorfor skal

Læs mere

TDCs Signaturserver. 11/05 - Version 1.0 2005 TDC Erhverv Sikkerhed og certifikater

TDCs Signaturserver. 11/05 - Version 1.0 2005 TDC Erhverv Sikkerhed og certifikater TDCs Signaturserver Side 2 Indhold Indledning...3 Teknisk projekt... 3 Tekniske forudsætninger... 3 Installation af klienten... 4 Udstedelse af signatur... 4 Anvendelse af signaturen... 6 Eksport af signaturen...

Læs mere

Introduktion til NemHandel

Introduktion til NemHandel NemHandel i skyen - holdt business casen? Heinrich Clausen HotHouse Cph og Helle Schade-Sørensen IT og Telestyrelsen Introduktion til NemHandel Løftestangen: Bekendtgørelsen fra 2005 om elektronisk regning

Læs mere


DET KONGELIGE BIBLIOTEK NATIONALBIBLIOTEK OG KØBENHAVNS UNIVERSITETS- BIBLIOTEK. Index DET KONGELIGE Index Download driver... 2 Find the Windows 7 version.... 2 Download the Windows Vista driver.... 4 Extract driver... 5 Windows Vista installation of a printer.... 7 Side 1 af 12 DET KONGELIGE

Læs mere

Skriftlig eksamen i Datalogi

Skriftlig eksamen i Datalogi Roskilde Universitetscenter side 1 af 9 sider Skriftlig eksamen i Datalogi Modul 1 Vinter 1999/2000 Opgavesættet består af 6 opgaver, der ved bedømmelsen tillægges følgende vægte: Opgave 1 5% Opgave 2

Læs mere

Status på det trådløse netværk

Status på det trådløse netværk Status på det trådløse netværk Der er stadig problemer med det trådløse netværk, se status her: IT-service arbejder stadig med at løse problemerne

Læs mere

TDC - Alcatel Network Analyzer. Baseret på materiale fra mødet i VULA-videreudvikling 11. april 2014

TDC - Alcatel Network Analyzer. Baseret på materiale fra mødet i VULA-videreudvikling 11. april 2014 TDC - Alcatel Network Analyzer Baseret på materiale fra mødet i VULA-videreudvikling 11. april 2014 1 TDCs anvendelse af Alcatels Network Analyzer TDC har startet samarbejdet med Alcatel og er i øjeblikket

Læs mere

SIP. Session Initiation Protocol. TDC IP telefoni Scale

SIP. Session Initiation Protocol. TDC IP telefoni Scale SIP Session Initiation Protocol TDC IP telefoni Scale SIP design mål Give mulighed for at integrere nye faciliteter efterhånden som de opfindes SIP er ikke en erstatning for det offentlige telefonnet -

Læs mere


HYBRID TAKEOFF REDEFINED JOURNEY TO THE CLOUD BY EMC Søren Holm, Proact HYBRID TAKEOFF REDEFINED JOURNEY TO THE CLOUD BY EMC Søren Holm, Proact More than 3500 projects In control of 55 petabyte data 450 certified consultants More than 1.5M euro in training per year 55 PB,

Læs mere

Netværksmålinger. - en introduktion! Netteknik

Netværksmålinger. - en introduktion! Netteknik Netværksmålinger - en introduktion! Netteknik TCP - IP - Ethernet DNS eksempel På en ældre Windows 7 pc sker følgende deault ved DNS opslag: HOSTS filen kigges igennem DNS + DNS Suffix checkes LLMNR aktiveres

Læs mere

Præsentation af BSK regionens identity and access management platform

Præsentation af BSK regionens identity and access management platform Regionshuset It digital forvaltning BSK programmet Olof Palmens alle 17 Præsentation af BSK regionens identity and access management platform BrugerStamdataKataloget

Læs mere

På nedenstående billede skal du finde den figur som optræder nøjagtig 3 gange.

På nedenstående billede skal du finde den figur som optræder nøjagtig 3 gange. Navn: Klasse: Materiale ID: PIC.33.1.1.da Lærer: Dato: Klasse: Materiale ID: PIC.33.1.1.da Navn: Klasse: Materiale ID: PIC.33.2.1.da Lærer: Dato: Klasse: Materiale ID: PIC.33.2.1.da Navn: Klasse: Materiale

Læs mere

Vejledning i opsætning af MQ

Vejledning i opsætning af MQ NemKonto KMD Lauritzens Plads 1 9000 Aalborg Vejledning i opsætning af MQ 19. februar 2016 Side 1 Beskrivelse af MQ opsætning ved opkobling til KMD Nemkonto 1. Formål

Læs mere

Citrix CSP og Certificate Store Provider

Citrix CSP og Certificate Store Provider Project Name Document Title TDC Citrix Citrix og Certificate Store Provider Version Number 1.0 Status Release Author jkj Date 5-10-2006 Trademarks All brand names and product names are trademarks or registered

Læs mere

Web- og serverprogrammering

Web- og serverprogrammering Dette materiale er under Åben Dokumentlicens, se Web- og serverprogrammering Databasekommunikation - dag 7 Strategier til databaseadgang JDBC (Java DataBase Connectivity)

Læs mere

Shooting tethered med Canon EOS-D i Capture One Pro. Shooting tethered i Capture One Pro 6.4 & 7.0 på MAC OS-X 10.7.5 & 10.8

Shooting tethered med Canon EOS-D i Capture One Pro. Shooting tethered i Capture One Pro 6.4 & 7.0 på MAC OS-X 10.7.5 & 10.8 Shooting tethered med Canon EOS-D i Capture One Pro Shooting tethered i Capture One Pro 6.4 & 7.0 på MAC OS-X 10.7.5 & 10.8 For Canon EOS-D ejere der fotograferer Shooting tethered med EOS-Utility eller

Læs mere

Cloud og it-sikkerhedsudfordringerne: Dansk Automationsselskab

Cloud og it-sikkerhedsudfordringerne: Dansk Automationsselskab Cloud og it-sikkerhedsudfordringerne: Dansk Automationsselskab Carsten Jørgensen 7 marts 2012 Carsten Jørgensen 1999 2001 2006 2009 2011 Falck 2012 Falck 2011 Emergency Assistance Healthcare

Læs mere

Kursusarbejde 3 Grundlæggende Programmering

Kursusarbejde 3 Grundlæggende Programmering Kursusarbejde 3 Grundlæggende Programmering Arne Jørgensen, 300473-2919 klasse dm032-1a 21. november 2003 Indhold 1. Kode 2 1.1. forestillinger.h............................................. 2 1.2.

Læs mere

19. Bilag. 19.1 Bilag 1: Referenceliste med kontaktoplysninger til virksomheder. Rapportens fire undersøgelsesenheder:

19. Bilag. 19.1 Bilag 1: Referenceliste med kontaktoplysninger til virksomheder. Rapportens fire undersøgelsesenheder: 19. Bilag 19.1 Bilag 1: Referenceliste med kontaktoplysninger til virksomheder Rapportens fire undersøgelsesenheder: 1. SøgeMedier Kontakt: Tobias Thaastrup-Leth, Projektchef Klamsagervej 21B, 8230 Åbyhøj

Læs mere

Cloud Computing De juridiske aspekter

Cloud Computing De juridiske aspekter Cloud Computing De juridiske aspekter Forskningsnet Konference 2010 Middelfart Advokat Nis Peter Dall Hvad er Cloud? IaaS (Infrastructure as a Service) - Computerkraft, lagerplads mv. stilles til rådighed

Læs mere

Tabeller (I) Tabeller

Tabeller (I) Tabeller Tabeller (I) Klassediagrammer (III) Tabeller og qualified associations Michael R. Hansen Informatics and Mathematical Modelling Technical University of Denmark En tabel fra en mængde A til

Læs mere

FMK-online's brug af SmartFraming

FMK-online's brug af SmartFraming Side 1 af 9 FMK-online's brug af SmartFraming Version 1.1 2011-11-01 Side 2 af 9 Indholdsfortegnelse Indledning...3 Initialisering og login...3 Kontekst Properties...4

Læs mere

Søren Løbner (lobner) ddb Databaser 2007 10 10

Søren Løbner (lobner) ddb Databaser 2007 10 10 ddb Excercise Week 4 Fra relationships til relations Nu når vi har fået vores skemaer på plads, kan SQL udtrykkene til konstruktion af relationerne laves Det foregår ved at vi tager en 1 til 1 oversættelse

Læs mere

9.8 Kildekode. side 88. Pakke Klasse Sidenummer. fortsætter..

9.8 Kildekode. side 88. Pakke Klasse Sidenummer. fortsætter.. 9.8 Kildekode Pakke Klasse Sidenummer db Aktivitetstype 91 Behandler 91 ConnectDB 92 DagensKommentar 93 Helligdag 94 IkkePrimaerTid 94 Patient 96 Patientaftale 96 PatientAktivitet 97 Patientgruppe 98 PatientgruppeItem

Læs mere

Netværk & elektronik

Netværk & elektronik Netværk & elektronik Oversigt Ethernet og IP teori Montering af Siteplayer modul Siteplayer teori Siteplayer forbindelse HTML Router (port forwarding!) Projekter Lkaa Mercantec 2009 1 Ethernet På Mars

Læs mere

Software Projekt NoSQL vs RMDB

Software Projekt NoSQL vs RMDB Software Projekt NoSQL vs RMDB Skrevet af Carsten Sørensen, Hans Jørgen Frandsen, Peter Haislund Department of Computer Science, University of Aarhus Aabogade 34, 8200 Arhus N, Denmark 201200089, 19960442,

Læs mere

Video Projector Controller. Brugermanual

Video Projector Controller. Brugermanual Jægergårdsgade 152/05A DK-8000 Aarhus C DENMARK WWW.WAHLBERG.DK l Video Projector Controller Brugermanual WWW.WAHLBERG.DK TELEPHONE +45 86 18 14 20 CELL PHONE +45 40 52 20 88 EMAIL: Feb

Læs mere

Indholdsfortegnelse for kapitel 3

Indholdsfortegnelse for kapitel 3 Indholdsfortegnelse for kapitel 3 Kapitel 3 Design............................................................ 2 Database........................................................... 3 ER-diagram.................................................

Læs mere