Standard front page. Course exam with. with project agreement. Thesis/project exam. Name(s): Birthdate and year: ITU-mail: Course e-portfolio

Størrelse: px
Starte visningen fra side:

Download "Standard front page. Course exam with. with project agreement. Thesis/project exam. Name(s): Birthdate and year: ITU-mail: Course e-portfolio"


1 Standard front page Course exam with Thesis/project exam with project agreement C od : BIOI Supervisor: ourse: Innovation og iværksætteri Course manager: Elisabeth Broe Christensen Thesis or project title: Course eportfolio Name(s): Birthdate and year: ITUmail: Cecilia HartvigBollin chab Mads Wejnold Jørgensen mjoe Morten Lomholt Schubert mlom Ray Thom Will rtho Simon Schultz Nommesen snom Esben Fregerslev Thomsen efre

2 INNOVATION & IVÆRKSÆTTERI FORÅR 2014 Cecilia HartvigBollin Mads Wejnold Jørgensen Morten Lomholt Schubert Ray Thom Will Simon Schultz Nommesen Esben Fregerslev Thomsen Antal anslag: / 10 normalsider (inkl. tre tabeller á 700 tegn)

3 1" Indholdsfortegnelse Executive"Summary"..."2 Introduktion"..."2 Projektbeskrivelse"..."2 Industrianalyse"..."2 TheFiveCompetitiveForcesModel...3 Threatofsubstitutes...3 Threatofnewentrants...3 Rivalryamongexistingfirms...3 Bargainingpowerofbuyers...3 Bargainingpowerofsuppliers...3 NatureofParticipants...3 KeySuccessFactors...4 IndustryTrends...4 Environmentaltrends...4 Businesstrends:...4 LongBtermProspects...4 Markedsanalyse"..."5 Kundesegmentering...5 Destuderendeital...5 B2C...5 Behov...5 B2B...6 Konkurrentanalyse...6 Benchmarkanalyse...7 Benchmarktabel...7 Stakeholders...7 Marketingstrategi"..."8 MarketingMix...8 Produkt...8 Pris...8 Promovering...8 Placering...8 KeyPartnerships...8 Universiteterne...8 Tandklinikker...9 ProprietaryIssues...9 Økonomi"..."9 PriserogService...9 Potentiellekunder...9 Kommission...9 Opstartsomkosninger...10 Fonde...10 UdgifterogDrift...10 FinansielFremskrivning...10 Budget...11 Plan"for"key"activities"..."12 Konklusion"..."12 Appendix"..."13 Appendix1:Citater...13 Appendix2:BilledefraFacebook...15 Appendix3:ResultaterfraUniinterviews...16 Appendix4:Interviewmedtandlæge...20 Appendix5:Resulaterforsurver...22 Appendix6:Lydfil...30

4 Tandhjulettilbyderetnyttagpåenellerskonservativbranche indenfortandsundhed,tandklinikkerogtandpleje.deter Tandhjuletsvisionogmålatsænkedethøjeantalafstuderende somikkegårtiltandlægeellertandplejer,vedattilbydeenbillig, fleksibelogsimpelløsningpåetsamfundsmæssigtproblem. Konceptetvilgavnealleinvolveredeparteriformaføkonomisk fremgangogpositivomtale.samarbejde)og)gennemsigtigheder nøgleordforatopnåetsuccesfuldtresultat,derforharalle interessenteretansvarforatværeetaktivitandhjuletsnetværk. Talrigeundersøgelserogkilderharudmeldtenpositivholdningtil konceptetogifølgedenfinansiellefremskrivningerderudsigttil profitpåsjetteår.deforretningsmæssigebegreberidenne businessplanertagetfrabogen BruceRBarringerandR.Duane Ireland:Entrepreneurship Successfullylaunchingnewventures. Tandhjuleterenmobiltandkliniksomtilbyderforebyggende procedurer,såsomtandtjekogtandrensning,tilstuderendepå videregåendeuddannelserikøbenhavnsområdettilenfavorabel pris.patientenfårenservicesomersimpel,hurtig,billigog gennemskueligligeforanuddannelsesinstitutionenshoveddør dermedsparerpatiententidogtransport. Vedstørreogmereavanceredeprocedurer,somkræverandre klinikfaciliteter,tilbydertandhjuletenhenvisningtilentandklinik tætpåpatientensegenadresse.viaenskriftligekontrakti samarbejdetmellemtandhjuletogtandklinikkerne,findesen kommisionsbaseretbetalingsform,hvoriklinikkerneskalbetaleet bestemtprocentmæssigbeløbforhenvistekunder. Executive)Summary Introduktion Projektbeskrivelse Industrianalyse Tandlægeklinikkeromsatteigennemsnitfor 1.i 2012.Medca praksisseridanmark,heraf822iregion Hovedstaden,ertandsundhediDanmarkenmilliardindustriog enlukrativbrancheatstarteopi.undersøgelserviseratmange ungedroppertandlægenellertandplejennårdefylder18årogselv skaltilatbetale.tandlægeforeningenopfordrertilatmanbliver tilknyttetenfasttandlægeogderforfårtilbudomregelmæssige tandeftersyn 3. Der)er)i)hvert)fald)mange)som)springer)det)over,)vi)kalder)dem)drop9 out'ere,)fordi)i)kommer)ud)som)189årige)fra)den)kommunale) tandpleje,)og)fordi)i)så)hører)historier)om)at)det)er)så)dyrt)og)jeres) forældre)har)fået)lavet)kroner)og)broer)og)de)har)dårlige)tænder)osv,) så)tænker)i)'puha)det)bliver)dyrt'. 1[3[2013.pdf 2SundhedsdokumentationenvedStatensSerumInstitut 2SundhedsdokumentationenvedStatensSerumInstitut arbejdsmarked/ydere%20indenfor%20praksissektoren.aspx 3Tandlægeforeningen: dropper_tandlaegen.aspx 2"

5 3" [ElisabethGregersen,FormandforDanskTandplejerforening.(jf. Appendix1og6)) TheFiveCompetitiveForcesModel Foratforstådenkonkreteindustrimanbevægersigindi,bruges "TheFiveCompetitiveForcesModel foratskabeoverblik. Threatofsubstitutes Itandlægebranchenerdermangeetableredeklinikker,sommed meremålrettedereklamekampagnerharmulighedforatgåefter detsammekundesegmentsomtandhjuletgør. Threatofnewentrants Nyekonkurrentervilhaveenhøjbarriereiformafinvesteringi entenenklinikellerenmobilklinik,dadettekræverenstorkapital. Devildesudenhavebrugfordesammelicenserogtilladelsertilat driveentandklinik.fondevilhellerikkeværetilgængeligtforet lignendeprojektdadeoftestkunstøtternyeinitiativer.desudenvil Tandhjuletindgåeksklusiveaftalermeduniversiteterneogde privatetandklinikker. Rivalryamongexistingfirms Dererpånuværendetidspunktikkestorkonkurrencepåmarkedet dadererbalancemellemantalletafkunderogudbydereaf tandpleje.dettekandogændresigifremtidenhvorstadigbedre tandsundhedvilbetydefærrebehandlinger. Tandlægerne)skal)til)at)vænne)sig)til)en)ny)verden,)fordi)tænderne)er) så)sunde)som)de)er)i)dag. [ElisabethGregersen,FormandforDanskTandplejerforening.(jf. Appendix1og6)) Bargainingpowerofbuyers Kunderneharenhøjforhandlingskraft,fordideharmulighedenfor atvælgehvilkentandklinikdeønskeratbenyttesigaf.tilgengæld erentandbehandlingennødvendighed,ogdervilderforaltidvære etbehovfortandpleje.tandhjulettilbyderpatientenennem,billig oglettilgængeligtandbehandling,ogtandhjuletvilderforhaveen højforhandlingskraft. Bargainingpowerofsuppliers Deetableredeklinikkerharpånuværendetidspunktstor forhandlingskraft,daindustrienersundogdekanfungere uafhængigtaftandhjulet.efterhåndensommarkedetændrersigog derkommerfærrebehandlinger,vilderopståenovervægtaf behandlere,ogsåvilderesforhandlingskraftbliveformindsket. EfterhåndensomTandhjuletskaberentilstedeværelseogen kundebasevilvoresforhandlingskraftoverforeksisterende klinikkerstige. NatureofParticipants Vedatsamarbejdemedklinikkerneogtilbydedemnyepatienter, mindskesrisikoenforatdebliverkonkurrentertiltandhjulet.hvis dekanfåprofitiformafflerepatienterfravoreshenvisninger,vil dekunneseatetsamarbejdevilværefordelagtigtogderforikke konkurreremedospåuddannelsesinstitutionerne.

6 4" KeySuccessFactors Defølgendepunkterervigtigenøglekriterierforatvirksomheden kandifferentieresigogopnåsuccespåmarkedet. [ Billigepriser. [ Mobilitetogfleksibilitetidendagligedrift. [ Simpelopsøgendemarkedsføringpåuddannelsesstederne vedbrugafplakater,nyhedsbreve,flyersogdigitale medier. [ Samarbejdemeduddannelsesinstitutionernesåde henvisertilos/gøropmærksommepåatvikommerog generelterder. [ Nemtoggennemskueligtprodukt [ Skabeetsamarbejdemedklinikkersompatienterkan henvisestil. IndustryTrends Environmentaltrends Dyrepriserogmanglendemotivationforatsøgetandbehandling, gøratflereogflereungedroppertandplejer[ogtandlægebesøg helt.klinikkernepåpegeratdepengemansparervedikkeatfå tjekketogrensetsinetænder,skalbetalestilenhøjereprisnårder endeligerbrugforenstorprocedure.samtidigharetøgetfokuspå personligtandplejegjort,atklinikkerneudførerfærreomfattende behandlinger,ogatpatienternesjældneregårtiltandlægen.dette betyder,attandlægerneskalhaveflerepatienterforatopretholde deresindkomst. Det)er)rigtig)ærgerligt)at)der)er)sådan)en)årrække)hvor)de)unge)ikke) får)undersøgt)deres)tænder,)fordi)så)kan)det)nemlig)godt)gå)galt.)det) er)ikke)fordi)at)man)behøver)at)komme)hvert)halve)år,)der)er)også) nogle)der)endda)kan)gå)halvandet)år)mellem)besøgene,)men)hvis)man) venter)alt)for)længe)så)er)der)jo)noget)som)man)kan)have)overset.) Derfor)er)det)vigtigt)at)komme)til)undersøgelse. )) ) ElisabethGregersen,FormandforDanskTandplejerforening.(jf. Appendix1og6)) Businesstrends: Dererengeneralkonservativtendensblandttandklinikkernedade ikkeopsøgernyepatienterviamarkedsføring.detkanskyldesat derfindesjuridiskereglerforhvordanentandklinikmåpromovere sigselvioffentligheden.dejuridiskereglerommarkedsføringenaf sundhedsydelservilbliveuddybetiproprietaryissues.) LongHtermProspects Somtidligerenævnt,skerderændringerimarkedetsom nuværendetandklinikkerikketilpassersigtil.dettebetyder,atder medåreneblivemindreogmindreatlavefortandlægerne,ogdevil derforværeinteresseredeiatfåflerepatienterindisystemet gennemnyekanaler. Men)med)de)tænder)som)I)er)udstyret)med,)fordi)I)har)fået)passet) dem)og)i)er)blevet)undervist)i)tandpleje,)så)har)i)jo)ikke)så)dårlige) tænder.)så)jeres)tænder)kan)rent)faktisk)nøjes)med)en)undersøgelse) en)gang)om)året,)og)så)er)det)ikke)sikkert)at)i)behøver)mere.)det)er) ikke)engang)alle)der)behøver)en)tandrensning)overhovedet.) ElisabethGregersen,FormandforDanskTandplejerforening.(jf. Appendix1og6))

7 Igennemegneundersøgelser(jf.Appendix1[6)somindbefatter spørgeskemaer,interviewsmedpatienter,tandlæger/plejereog formandenfordansktandplejerforeningen,sesdetatvores resultaterstemmeroverensmeddanmarksstatistikog landsdækkendeundersøgelseromungestandlægevaner. Detprimærekundesegmenterstuderendepåvideregående uddannelserihovedstadsområdet. Københavnsvideregåendeuddannelserhuserca studerende 4.Dissestuderendeerspredtudpåforskellige uddannelsesstederheriblandtku,cbs,itu,dtuogmetropol. UndersøgelsenfraVoxmeter 5 foretagetfortandlægeforeningen viserat17%afungemellem18[25årikkeharværettiltandlægen indenfordesidste2år. VoresspørgeundersøgelseforKøbenhavnsstuderendepå videregåendeuddannelserviserat25udaf95ikkeharværettil 4 videregaaende[uddannelser.aspx 5Tandlægeforeningenshjemmeside: dropper_tandlaegen.aspx tandlægenindenfordesidste2år,dvs.27%,hvilketerhøjereend denlandsdækkendeundersøgelse. Vedatbrugede17%fradenlandsdækkendeundersøgelsekandet ses,attandhjulethar16.095potentiellekunder. Igennemvoresspørgeskemaundersøgelsekanmanobservere forskelligegrundetilatpotentiellekunderikkegårtiltandlægen ellertandplejer.deterinteressantatinddragebehovetfrabåde demdergårtiltandlægeellertandplejer,ogdemderikkegør. Markedsanalyse Kundesegmentering Destuderendeital B2C Behov Disseobservationererudarbejdetfraegneundersøgelser(jf. Appendix1[6)beståendeaf244spørgeskemabesvarelser,et ekspertinterviewmedformandenfordansktandplejerforeningen, ElisabethGregersenogca.30åbneinterviewsmedstuderende, samtvoxmeterslandsdækkendeundersøgelse. [ Over50%afallerespondentersynesatprocedurerneer fordyre. [ Over70%harsværtvedattagesigsammentilatbestille entid. [ 88%afde17%derikkegårtiltandlæge,menerselvatde børgåtiltandlæge. [ Tidogdistanceharikkedenstorebetydningforvalgetom attagetiltandlæge. 5"

8 [ Antalletafpersonermed SygesikringDanmark erca.det sammeforbeggegrupper,henholdsvis35%og51%. [ 92%afderespondentersomharenfasttandlæge,møder regelmæssigttilårligekonsultationer. Resultaterneviseratrespondenterne: [ vilhaveenbilligløsning [ vilhaveensimpelløsning [ vilhaveatservicenkommertildem [ gerneviltilknyttesenfasttandlæge [ gårregelmæssigttilfastetandlægeaftaler Fordistuderendeofteharmegetbegrænsedeøkonomiskemidler, erderstorsandsynlighedforatdegårefterdebilligstetilbud. Udoverprisenbringesservicentildem,holderprocedurenså simpelsommuligtogkanendviderehenvisetilenfasttandlægetæt påderesadresse.flertalletafpatienternesomharenfasttandlæge, møderoptildereskonsultationerogderforsikresetkontinuerligt samarbejdemellemtandhjulet,patientenogklinikken. Foratundersøgevoresmuligerelationermedandrevirksomheder, harviinterviewetformandenfordansktandplejerforening, ElisabethGregersen(jf.Appendix1og6).Iinterviewetudtalte Elisabeth,attandklinikkernevilleværeinteresseredeiet samarbejde.samtidigdeltedansktandplejerforeningogsåidéen påderesfacebook[side(jf.appendix2),hvordenblevmodtaget overvejendepositivtmedkommentarersom: [ Rigtig)god)idé ) [ Great) ) [ ) Kunne)da)være)spændende)i)Århus ) IforbindelsemedvoresB2B[relationer,erTandhjuletnødttilat udformeeksklusiveaftalermedtandlægeklinikkerforatsikresin positionpåmarkedet. SomtidligerenævntiFiveForces[modellenforventesderetskifti markedet,hvilketvilgørevoresforhandlingskraftstærkere,ogpå sigtbetydemulighedforbedreaftalermedpartnere. B2B Konkurrentanalyse FalckDentalcare[bestårafenmobiltandlægekliniksomtager udtilfirmaerogtilbyderforebyggende,mindregenopbyggendeog kosmetisketandbehandlinger.kundernebetalerselv,ogdeter hovedsageligtmøntetpåatvirksomhedensmedarbejdereikkeskal brugetidpåtransportnårdeskalhavetjekkettænder Hjemmetandlaegen.dkHerenprivatvirksomhedmedenmobil tandlægekliniksomtagerudtilpersonerderfxpågrundafsygdom, alderdom,gangbesvær,handicaposv.ikkekankommetil tandlægen. KommunerHrundtomkringilandettageroftenon[profit initiativertilatforbedreborgernestilgangtiltandlægebesøg.disse initiativeromfatteroftestældre,handicappedeogbørn. 6"

9 7" EksempelvishardeiFrederiksbergKommuneenmobiltandklinik derfokusererpådeældrepåplejehjem Dentalbus.dkHerenprivatvirksomhedderharspecialiseretsigi atombyggerenaultvarevognesådefremstårsomenfuldt funktionelmobiltandlægeklinikmedalthvaddertilhører. DiversetandklinikkerHAlmindeligetandplejer[og tandlægeklinikkerrundtomkringilandet Benchmarkanalyse IanalysenafTandhjuletskonkurrentererderopstilletforskellige kategoriersomerbaseretpåhvaddeinterviewedeinformanter lagdevægtpåunderdeindledendeinterviews: [ Pris [ Beliggenhed [ Ekstraservice [ Kundeforhold Vedatopstilledisse4kategorierogdereftergivedemenkarakter mellem0og10,bliverdetmuligtatsammenligneogopvejefordele ogulempervedhverkonkurrent. Benchmarktabel Tiltrodsforatdealmindeligetandlægeklinikkerfikflestpointi voresanalyseopfattesdissesomenindirektekonkurrent.den storeforskelliggeriprisenogmådenhvorpåkundenharadgangtil voresservicekontraderes.foratundgårivaliseringvælgerviat samarbejdemedforskelligeklinikker,somvikanhenvisetil,hvis voreskunderskalhaveforetagetetmereavanceretindgrebend tandtjekog[rens.tilgangenomkringsamarbejdefremfor rivaliseringvilogsåbliveforsøgtpraktiseretiforholdtilkommuner DentalbussentilbyderikkesammeservicesomTandhjuletgør,men medtidenkandebliveleverandørerafmobiletandlægeklinikkertil eventuelledirektekonkurrenter. FalckDentalcareogHjemmetandlaegen.dkeriskrivendestunden direktekonkurrentgrundetlighedenmellemderesogvores service.forskellenliggerikundesegmentet. Stakeholders Følgendeerenlisteafstakeholders,deternødvendigtat samarbejdemed.

10 Tandlægeklinikker Tandlægeforeningen Tandplejeforeningen Uddannelsessteder Privateogstatsligefonde Staten Studerende Voresoverordnedemarketingplanerbaseretpåopsøgendesalg, vedattageudtiluddannelsesinstitutionerne.vipositionereros dermedsomenmegetsynligspillerpåmarkedet. Marketingstrategi MarketingMix Produkt Tandhjuleterenservicepåsammeniveausomandreudbydere, menskabermerværdiforforbrugerenvedatværegennemsigtigog udenmuligeprisoverraskelser. Pris Tandhjuletsproduktudvalgogprisstrukturersimpel,hvilketgør detnemtoggennemskueligtforpatienterneatvidehvadde kommertilatbetale.destuderendekanikkeblivekrediteretforen højereprisendhvadderbliverreklameretmed.prisenpåservicen erværdi[baseretiforholdtilbranchenspriser.tandhjulet differentierersigfrarestenafbranchen,daservicenblivertilbudt tilenlavereprissommatcherstuderendesøkonomiskeråderum. Prisstrukturenerdeltopitoversioner,entildestuderendeogen andentilwalk[ins. Promovering Tandhjuletvilfokuserepåatmarkedsføresigselvpåselve uddannelsesstederne.servicenerudelukkendetilgængeligpåselve institutionen,såtandhjuletharikkebehovforatblivemarkedsført gennemtvogandreformerforreklamer.detervigtigtat promoveringenskaberopmærksomhed,hvilketgøresviaplakater, nyhedsbreveoguddannelsesinstitutionernesfacebook[side. Institutionerneskaludnyttesemesterstartperiodentilat eksponereservicentilsåmangenyestuderendesommuligt. Placering Institutionerneskaldeltageiattilbydedestuderendevoresservice ogmindedestuderendeomatbrugetilbuddetsomendelaf institutionenssamledepakkeafdiversefaciliteter.idenkliniske procedurevildeikkeværesamarbejdspartnere. KeyPartnerships Universiteterne Samarbejdetmeduddannelsesinstitutionervilværefordelagtigfor beggeparterdakonceptetkanpromoveressomendelaf institutionenstilbudtilderesstuderendepålinjemedfaciliteter somfitnessogcafé.tandhjuletkandermedgavneinstitutionens egenpromoveringiforbindelsemedoptagelseafnyeeleverved semesterstart. 8"

11 9" Tandklinikker Københavnstandklinikkervilindgåietnetværkssamarbejde,som vildækkeregionhovedstaden,såpatientenkanblivehenvisttil dennærmestekliniktætvedpatientensadresse.denne samarbejdsstrategivilgivetandplejeindustrienadgangtiletnyt kundesegment,ogsamtidigtagedeliløsningenafet sundhedsmæssigtproblemisamfundet. ProprietaryIssues IforbindelsemedpromoveringafTandhjuleterdetvigtigtatvære opmærksompådenlovgivning,derfindesomkringmarkedsføring afsundhedsydelser.sundhedsstyrelsenførertilsynmedatreglerne overholdesbådeindenfordenoffentligeogprivatesektor. Lovgivningenomfatterblandtandet,atdererforbudmodat markedsføresundhedsydelseritv,ogatderkunmåbenyttesfilm ellerandreformerforlevendebillederpåvirksomhedensegen hjemmeside 6.Derudoverforeliggerderkravom,at markedsføringenskalværesaglig,ogatderikkemåanvendes urigtige,vildledendeellermangelfuldeangivelser. HvisovenståenderegleroverskridesharSundhedsstyrelsen mulighedforatudstedebøderellerlukkedenpågældendeklinik. Lovgivningenommarkedsføringafsundhedsydelserkommerikke tilatpåvirketandhjuletsmarketingsstrategi,dadetikkeer nødvendigtatpromoveretandhjuletandrestederendlokaltpå uddannelsesstederne. 6 omraader/markedsfoeringbafbsundhedsydelser Økonomi PriserogService Ifølgetandlægerogtandplejereharpatienternemulighedforkunat fåettandtjekogdereftervalgfritandrens,menoftesthængerdisse toprocedurersammen.tandhjulettilbyderkundisseydelserog yderligereavanceredeprocedurertilbydesvedhenvisningtilandre tandklinikkermedtilhørende10%kommissiontiltandhjulet. Tandtjek200kr.(Studierabat100kr.) Tandrensning200kr.(Studierabat100kr.) Potentiellekunder Studerendepåvideregåendeuddannelserharpåårsbasisflere fridageiformaf ferier,herundereksamensperioder,derforerdet nødvendigtatmedregne60dageekstraomårethvordemuligvis ikkeertilgængeligpåinstitutionen,hvilketbringerdettotaleantal arbejdsdagetil150dageomåret.dererderforreeltkun5måneder omåretsomtandhjuletkanudnytteogdermedanskaffenye potentiellekunder.selvomattalletforarbejdsdageerlavt,viserdet sigatværeprofitableifølgedenfinansiellefremskrivning. Kommission SamarbejdetmedtandklinikkerneiKøbenhavnerbundetgennem enskriftligkontraktmellemtandhjuletogklinikkerne.alle

12 10" nuværendeogfremtidigekundersomerblevethenvisttilenklinik igennemtandhjuletsadministrativesystem,skalindgåisamme prisniveausomklinikkensprivatekunderdvs.hvispriserne varierermellemklinikkensegnepatienterogdehenvistepatienter, bliverkontraktenbetragtetsombrudt.kontraktenindebærer,aten klinikskalbetale10%afdenprofitdererindtjentperprocedure udførtpådenindividuellepatient.denneordningergældendeien bestemtperiodeafhængigafaftalenmellemklinikkenog Tandhjulet. Kommissionstrategienerbaseretefterdenantagelseat3udafde 15dagligekundervælgeratblivehenvisttilentandlægeklinik.På årsbasisudgørantallettil480kunderhenvisttilandreklinikker igennemtandhjuletssystem. Opstartsomkosninger Juridiskereglerogloveomkringoprettelseaftandplejerklinik omfatteranskaffelsenafetyder[nr 7.Dettenr.skaltilknyttestilen fastadressehvoritandklinikkenskalregistreresiet kommunalregister.årsbudgettetinkludererderforetlille erhvervsregistreretkontorikøbenhavnmedtilhørendemånedlige udgiftersomvand,varmeogel.underopstartsfasenertandhjulet afhængigafenstartkapitalpå kr.somdækkerengangs 7 =&start=&slut=&uid= &side=100&color= købetafdenmobiletandklinik,startlønforentandplejer,etårs forbrugafmaterialertilklinikkenogdepositumtilkontor. Fonde DervilblivesøgtometengangsbeløbfraHelsefondenog Tandlægeforeningensfondiopstartsperioden,ogdersøges muligvisomandrefondeafhængigaføkonomiskeresultaterefter deførsteparmånederiopstartsfasen. UdgifterogDrift DevigtigsteudgifterforTandhjuletliggerivedligeholdelsen.Dette gælderkøretøjet,klinikudstyrogdetadministrativesystem.derfor erdeflesteafudgifternetilvedligeholdelseblevetbudgetteretsom fasteudgifter.medkontinuerligvedligeholdelse,erdetvores formålatminimeredevariableudgifter,såsomreparationer. Despecifikkedetaljerogudgifterkansesidenfinansielle fremskrivning. FinansielFremskrivning Budgetteterudregnetefterrealistisketalogberegninger,hvilket gøratprofitmargeneni5[årsregnskabetikkeviserenstorstigning. Detskalfremhæves,atdenstørsteudgiftliggerIkøbetafden mobiletandklinikogatsandsynlighedenforatantalsolgteydelseri løbetafde5årvilværehøjereendumiddelbarantaget.budgettet kansespånæsteside.

13 Budget 11"

14 Foratnåvirksomhedensmålerdetnødvendigtmedenplanforde milepælederskalopnås.virksomhedensstrategiskemålsætning indebærerblandtandetenhøjgradafformidlingmellemalle stakeholders. Plan%for%key%activities Konklusion Gennemdeindledendeundersøgelserblevdetfastslåetatmange ungemenneskerikkegårtiltandlægenellertandplejer,ogatdette hovedsageligtskyldesøkonomi, dissefaktorerimenteblevideentiltandhjuletudvikletog industrien,markedet,konkurrenter,partnere,markedsføringog økonomienblevanalyseret.tandplejeindustrienpraktiserer hovedsageligtdensammetilgangtildereskundersomaltid,og dennekonservativetilgangkankommetandhjulettilgode.i forbindelsemedanalysenafmarkedetogkonkurrenter,blevdet konstateretatkunfåiskrivendestundtilbyderdensammeservice, menkundesegmenteringen,mobilitetognetværketmed eksisterendetandklinikkergørattandhjuletdifferentierersigfra restenafmarkedet. Devigtigstekeyactivitiesvedopstartafprojektetbliverat oparbejdeetsamarbejdedemedtandklinikkeroguniversiteteri Storkøbenhavnogmarkedsføringenpåuddannelsesstederne.Den finansiellefremskrivningviserprofitpåsjetteår. 12"

15 13" Appendix Appendix1:Citater RelevanteoggodkendtecitaterfrainterviewmedFormandenfor DanskTandplejerforeningElisabethGregersen #00:06:23H8#Interviewer:Trordutandklinikkernevilleværeinteresseretietsamarbejdehvorvihenvistepatientertildem? #00:06:32[7#Elisabeth:Jadettrorjegheltsikkert,detvilleikkevære problemet. [[[[[ #00:08:40H8#Interviewer:Vifandtudafatderermangeungederikkeertilknyttetenfasttandlæge,erdetogsågenereltdenopfattelseihar? #00:08:48[7#Elisabeth:Altsådererihvertfaldmangesomspringerdet over,vikalderdemdrop[out'ere,fordiikommerudsom18[årigefraden kommunaletandpleje,ogfordiisåhørerhistorieromatdetersådyrtog jeresforældreharfåetlavetkronerogbroerogdehardårligetænderosv, såtænkeri'puhadetbliverdyrt'.menmeddetændersomierudstyret med,fordiiharfåetpasserdemogierblevetundervistitandpleje,såhari joikkesådårligetænder.såjerestænderkanrentfaktisknøjesmeden undersøgelseengangomåret,ogsåerdetikkesikkertatibehøvermere. Deterikkeengangallederbehøverentandrensningoverhovedet. [[[[[ #00:10:40H4#Interviewer:Hvadbliverderligenugjortforatfådeungetilatgåtiltandlæge? #00:10:43[3#Elisabeth:Manprøveratlavenoglekampagnerog tandlægeforeningenharlavetkonkurrencerpådtutrorjegdetvar,hvor deskullelavenogetsmartkommunikationsomdekunnebrugei mediernetildeunge.menmanprøverihvertfaldmegetatfåfolkindi foldenigen. [[[[[ #00:11:11[0#Elisabeth:Deterrigtigærgerligtatderersådanenårrække hvordeungeikkefårundersøgtderestænder,fordisåkandetnemlig godtgågalt.deterikkefordiatmanbehøveratkommehverthalveår,der erogsånoglederenddakangåhalvandetårmellembesøgene,menhvis manventeraltforlængesåerderjonogetsommankanhaveoverset. Derforerdetvigtigtatkommetilundersøgelse. [[[[[ #00:12:00H5#Interviewer:Eralleprivatklinikkeregentligstatsstøttet? #00:12:00[9#Elisabeth:Ja,ogpådensamledeøkonomierdetkun omkring17%ellerderomkring,menpåtandplejernesklinikkerhvorvi laveralledeforebyggendeydelsersåerdet50%afvoresellermere.det erfordideterundersøgelser,tandrens,parantosebehandling,deterde klassiskeforebyggendebehandlingerderfårstøtte. [[[[[ #00:14:04H3#Interviewer:Hvadvildusigeerdenstørsteudfordringvedatfåfolktilatgåtiltandlægen? #00:14:07[8#Elisabeth:Jegtrordeterprisen.Deterogsådetjegkan fornemmepåjeresundersøgelser. [[[[[ #00:23:49H2#Interviewer:Trordudetvilleværemuligtatlaveensamarbejdsaftalemedklinikkerneomatmanfikenprocentdelafdetsomkundenbetalerforbehandlingenpåklinikkenefterfølgende.Viskafferjoegentligkundersomdeikkehar. #00:23:57[0#Elisabeth:Jadetviljegtro,detvillejoværerimeligtnok.De vilgerneværeinteresseretiatfånogleflerepatienter.dererselvfølgelig nogledererlukkedefornyepatienter,mengenereltvildegerne.deter

16 ogsåfordivorestænderbliversundereogsundere,såderblivermindre ogmindreatlavefordem. [[[[[ #00:26:12[9#Elisabeth:Derernogleheltklarereglerpåområdetfor hvordanmanmåmarkedsføre.dumåikketalegodtomdigselv.dumå godtsigeatdueksisterer,mendumåikkesådanipositivevendinger fortælleatduerfantastisk.dumågodtgørenoget,mendererreglerfor hvaddumå.manmåikkesådanhypesigselv. [[[[[ #00:34:40[2#Elisabeth:Tandlægerneskaltilatvænnesigtilenny verden,forditænderneersåsundesomdeeridag. [[[[[ #00:42:55[2#Elisabeth:Debehandlingersomtandplejerneogsåkanlave, altsåalledeforebyggendebehandlinger,dererprisenheltfastfor tandlægerne,denmådeikkeselvregulere.mensdeandrebehandlinger mådegerneselvsætteprisenfor.derermangederikkeveddet,ogdet betyderatdererrigtigmangederovertræderreglerneligeiøjeblikket. Allededersweetdeals,demåsletikkesælgedetpådenmåde.Manmå ikkesælgeenydelseførmanharindikationforatdeternødvendigt.imå ikkekøbeentandplejningpånettetfx,hvisibetaler1000kr.foratfå blegettændervianettet,såvediikkeengangomiharbehovfordeteller omjerestænderoverhovedetkanbleges.hvismanfx.harenkronepåen tand,såkanmanikkefåblegettandenfordidenharenfastfarve.manmå ikkesælgetingpåforhåndindenforsundhedsydelser.manskalførsthave etbehov. 14"

17 Appendix2:BilledefraFacebook UdklipafpositivekommentarertilkonceptetpåDanskTandplejerforeningsFacebookside 15"

18 Appendix3:ResultaterfraUniinterviews TandlægeHKUA NR #1 24år,Musikvidenskab Gårikkefasttiltandlægendahanikkebrydersigomdet.Prisenspillerogsåenrollemendeter hovedsageligtmildtandlægeskræk.harikkeværettiltandlægenifireår #2 25år,Musikvidenskab Gårnormaltfasttiltandlæge,menharikkeværetafstedietårstid.Detteskyldesathanflyttedeog ikkeharfåettagetsigsammentilatmeldesigtilennytandlæge Tandlægeskræk Pris Praktisk/lokation #3 34år,tidligere studerendepåkua Måtteundværetandlægedahanvarstuderendepågrundaføkonomi.Gikkuntiltandlægenåret problemmeldtesig[ikkerutinetjek Pris #4 21år,Japanstudie Gårikkefasttiltandlæge[hovedsageligtpågrundaftandlægeskræk.Synesdeterfordyrt,mengårtil tandlægenhvisderopstårproblemer.1½årsidensidstetandlægebesøg Tandlægeskræk Pris #5 28år,Historie Gårikkefasttiltandlæge[skyldeshovedsageligtprisen.Mereend5årsidensidstetandlægebesøg Pris #6 27år,Spansk Gårikkefasttiltandlæge[skyldeshovedsageligtprisen.3årsidensidstetandlægebesøg.Kunved akuttetilfælde[visdomstand Pris #7 23år,Musikvidenskab Gårtiltandlægefastengangomåret[rutinetjekogtandrens Fasttjek #8 23år,Musikvidenskab Gårtiltandlægefastengangomåret[rutinetjekogtandrens Fasttjek #9 24år,Litteratur videnskab Svigermorertandlægesåhunblivertjekketnårhunerpåbesøg Fasttjek #10 23år,Litteratur videnskab Tagerafstednårhunbliverindkaldt Fasttjek 16"

19 TandlægeHITU #1 28årEbusiness, Mand #2 27år,GBI, Kvinde #3 22år,GBI, Kvinde Gladfortænderne,børsterx2,mundskyl+tandtråd.Ingenproblemmedtandlægensomerfast,besøges hvert½årvedindkaldelse,begyndteatgåfastpga.fandtentandlægemedspecialeitandlægeskræk. Hadersinetænder,pga.mangeproblemer(knækkettand,rodbehandlingoperationertil13.000og kr),børsterx2+tandtråd.Brydersigikkeomatgåtiltandlæge,somikkeerfast.Rygerudaf systemetpga.manglendeopfølgelse(glemsel).gårtiltandlægenårdererproblemer. Kangodtlidesinetænder,børsterx2,følerattandlægeerennødvendighedogkommertilindkaldelse, somer2gangeomåret.harhunaltidgjort. fasttjek pris,tandlægeskræk, dårligeoplevelser. fasttjek #4 19år,SWU,Mand Gladefortænderne.Børsterkundomaftenenemeni5[10min.Synesdeterubehageligtatgåtil tandlæge,mengåralligevelfastca.hver3måned.erbegyndtfastefterbøjlebehandlingsluttede. #5 25år,SWU,Mand Gladfortænderne.Børsterx2.Tandlægeerfordyr.Gårikke,ogharikkefundetentandlægesidenhan flyttedetilbyen. fasttjek Pris,tilflytning #6 33år,Master software,mand #7 27år,Kandidati æstetik,kvinde. Gladfortænder,børsterx1(omaftenen).Vilhelstslippefortandlægepga.ubehag,harfastsomgårtil hvertandetår.merenuendtidligereaflysertider. Gladfortænder.Børsterx2.Synesdeterengodideatgåtiltandlæge,gørdet2xomåret.Harprøvet mangeforskelligeforhunfandtsinfaste. fasttjek fasttjek #8 22år,SWU,Mand kanlidesinetænderpga.deikkehargivetproblemer.børsterx2.brydersigikkeomgåtiltandlæge, menharfast.gørdetfastogharaltidgjortdet. fasttjek #9 26år,DDK, Kvinde #10 26år,DDK, Kvinde Kanlidehvordanhendestænderserud,mendeirritererhendepga.problemer.Brydersigikkeom tandlægepga.deterfordyrtogdetgørondt.harikkefastefterflytning.gårca.engangomåret. Gladfortænder.Børsterx2+tandtråd+mundskyleftersodavand.Historiemedproblemer(havdefire tænderformegetsombarn),menaltidgodtforholdtiltandlæge.haaltidhaftsammetandlægeogtager stadigtilmønforatfåtjek1[2gangeomåret. Tandlægeskræk,pris, tilflytning. fasttjek,indkaldelse #11 22år,DDK,Mand Gladfortænderne.Børsterx2.Haringenproblemmedtandlægen,somerfastmedtjekhver6[8 månedvedindkaldelse.altidhaftfasttandlæge. #12 22årSWU,Mand Gladfortænderne.Børsterx2.Ingenproblemmedtandlægen,menerlidtdyrt.Gårtogangeomårettil enfasttandlæge,nårhanbliverkaldtind.haftdensammesidenfolkeskolen. fasttjek,indkaldelse fasttjek,indkaldelse 17"

20 #13 23år,SWU,Mand Gladfortænder,børsterx2,Ikkefast,giderikkebrugepengepådet. Pris. TandlægeHCBS NR #1 20,mand,International Business #2 33,mand,MasterofSocial Science AltidboetiKøbenhavn.Hanharfasttandlæge,mendetharvarieretlidtpga.dårlig service.hansynesdeterfordyrtogtagernogengangetilsverigefordideterbilligere ogbedre.vartiltandrensningforetårsiden. Børsterx2,halvårligttandtjekhosfasttandlægeihjembyeniNordsjælland.Bruger ca.700kromåret Pris,Sverige,dårligeoplevelser Fasttjekihjemby #3 25,kvinde,SOL???? Børsterx2ogbrugertandtråd,ingenfasttandlægemengårtiltandlægencaengang omåret.benyttersigaftilbudpådealsiderogstudentertilbud.brugerca.200krper gang. Pris,tilbud #4 30,kvinde(Græker),arbjder påcbs #5 23,kvinde,Business, LanguageandCulture #6 25,mand(ikke[dansk), *Uforståeligt*andScience Harhaftstoreproblemermedhendestænderfordihunharenlillekæbe,hendes tænderbliverskubbetsammen.ikkegladforsinetænderogutilfredsmeddedyre tandlægeridanmark.harskiftettandlægefleregange,menhunergladforhamhun harnu. FlyttettilKbhfor4årsiden.FasttandlægeiKbhnu,menbeholdtesintandlægei Jyllanddeførstetreår.Tandeftersynfor4månedersiden.Billigtandlægepga sygeforsikringdanmark. LigeflyttettilKøbenhavnfor8månedersiden.Harikkenogentilknyttettandlæge. Hanharkunværettiltandlægenéngangfordienvisdomstandvarpåvejud.Menfik ikketagetdenudpga.prisen.300kronerkostededettjek.havdeenfasttandlægei UK,menhansynesdeterfordyrtiDK. Større (operationer)/problemer Fasttjek,sygeforsikring Pris,tilflyttet #7 24,mand,cand.merc.auc? BoriRødovreogharfasttandlæge.Deterlidtdyrtogharværettiltandlægenforetår sidenfordihanfiken indkaldelse.hanhavdeetlillehulibeggevisdomstænder.det kostede3000kr. Pris,indkaldelse,fasttandlæge #8 22,kvinde,*uforståeligt*[ business FlyttettilfraSvendborgfor2årsiden.HarfasttandlægeiOdense[hendesstedfar. Hunfårdetderforgratis.Hunskullehavelavetrodbehandlingforenmånedsiden. Fasttjekihjemby,gratispga. tandlægeifamilien 18"


SUBMISSION OF WRITTEN WORK I UNIVERSIY OF COPENHAGEN SUBMISSION OF WRIEN WORK Class code: Name of course: Course manager: Course e-portfolio: hesis or project title: Supervisor: Full Name: Birthdate (dd/mm-yyyy): E-mail: 1.

Læs mere

Ansøgning til Studienævn for Farmaci om godkendelse af SPECIALEKONTRAKT for FARMACEUTUDDANNELSEN

Ansøgning til Studienævn for Farmaci om godkendelse af SPECIALEKONTRAKT for FARMACEUTUDDANNELSEN Ansøgning til Studienævn for Farmaci om godkendelse af SPECIALEKONTRAKT for FARMACEUTUDDANNELSEN Læs vejledningen først 1. Personoplysninger / personal information Navn / name: Gade, husnummer, postnummer

Læs mere



Læs mere

Dagsorden. 1.Sidste nyt fra uddannelsen. 3.Markedsføring og deltagelse på uddannelsesmesser. 4.Praktik i efterårssemesteret 2009

Dagsorden. 1.Sidste nyt fra uddannelsen. 3.Markedsføring og deltagelse på uddannelsesmesser. 4.Praktik i efterårssemesteret 2009 Dagsorden 1.Sidste nyt fra uddannelsen 2.Valg Vl af formand for udvalget 3.Markedsføring og deltagelse på uddannelsesmesser 4.Praktik i efterårssemesteret 2009 5.Valg af faglige repræsentanter til udvalget

Læs mere

The Thesis M.Sc. In Technical IT (Civilingeniør)

The Thesis M.Sc. In Technical IT (Civilingeniør) 27. OCTOBER The Thesis M.Sc. In Technical IT (Civilingeniør) Electrical Engineering and ICT Who are we? Henrik Karstoft ( Ingeniørdocent @ASE, Leading the group in Signal Processing and Control@ASE/EICT

Læs mere

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. og

Engelsk. Niveau C. De Merkantile Erhvervsuddannelser September 2005. Casebaseret eksamen. og 052430_EngelskC 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau C og Indhold: Opgave 1 Presentation

Læs mere

The Thesis M.Sc. In Technical IT (Civilingeniør)

The Thesis M.Sc. In Technical IT (Civilingeniør) 27. OCTOBER The Thesis M.Sc. In Technical IT (Civilingeniør) Electrical and Computer Engineering Who am I? Henrik Karstoft ( Ingeniørdocent @ ASE, Leading the group in Signal Processing and

Læs mere

Innovation - en styret proces

Innovation - en styret proces Copenhagen School of Innovation - en styret proces Entrepreneurship Copenhagen School of Entrepreneurship (CSE) Entrepreneurship in prac4ce - Innovation & Entrepreneurship in practice Innovation en styret

Læs mere

Consortium Agreement

Consortium Agreement Research & Innovation Consortium Agreement Gardermoen 29. april 2014 Poul Petersen Senior Executive Officer Research & Innovation EU Office Universitetsparken 1 2100 Copenhagen N Denmark +45 35 32 28 10

Læs mere

Unges brug af tandpleje

Unges brug af tandpleje Grafikrapport Unges brug af tandpleje Undersøgelse om unges brug af tandpleje Gennemført af CEM Institute Voxmeter for TANDLÆGEFORENINGEN Metode Undersøgelsen er baseret på 500 interview med et nationalt

Læs mere

WEIB. WEIB 2014 Wave Energy Innovation and Business2Business event

WEIB. WEIB 2014 Wave Energy Innovation and Business2Business event WEIB WEIB 2014 Wave Energy Innovation and Business2Business event Danmarks største, nationale klyngeorganisation med mere end 280 medlemmer National kompetencecenter & innovation netværk for dansk offshore

Læs mere

HHX fyr op under. ambitionerne. En moderne gymnasial uddannelse med fokus på samfundet, økonomi, kultur og det internationale.

HHX fyr op under. ambitionerne. En moderne gymnasial uddannelse med fokus på samfundet, økonomi, kultur og det internationale. fyr op under 09102014 ambitionerne En moderne gymnasial uddannelse med fokus på samfundet, økonomi, kultur og det internationale. 2 Velkommen til IBC Handels- gymnasiet Fredericia/Middelfart IBC HANDELSGYMNASIET

Læs mere

AKTIVITETSKALENDER for HD 2. del i Marketing Management 2015/2016

AKTIVITETSKALENDER for HD 2. del i Marketing Management 2015/2016 AKTIVITETSKALENDER for HD 2. del i Marketing Management 2015/2016 Semesterstart: I efteråret 2015 starter alle hold i uge 35-36 I foråret 2016 starter 2. semester i uge 5-6. På 4. semester skrives det

Læs mere

Masters Thesis - registration form Kandidatafhandling registreringsformular

Masters Thesis - registration form Kandidatafhandling registreringsformular Masters Thesis - registration form Kandidatafhandling registreringsformular Godkendelse af emne for hovedopgave af vejleder og undervisningskoordinator. Læs venligst retningslinjerne sidst i dette dokument

Læs mere

Udkast til afslag på godkendelse

Udkast til afslag på godkendelse CBS Udkast til afslag på godkendelse Uddannelses- og forskningsministeren har på baggrund af gennemført prækvalifikation af CBS ansøgning om godkendelse af ny uddannelse, truffet følgende udkast

Læs mere



Læs mere

Evaluering af klinisk kursus i almen medicin. 6. semester kandidat, Medicin. Foråret 2015

Evaluering af klinisk kursus i almen medicin. 6. semester kandidat, Medicin. Foråret 2015 Evaluering af klinisk kursus i almen medicin 6. semester kandidat, Medicin Foråret 2015 Læsevejledning: Alle skalaspørgsmål præsenteres ved to diagrammer, først en tabel med gennemsnittet for det samlede

Læs mere i Maritim Teknologi i Maritim Teknologi i Maritim Teknologi Indlæg om SDUs nye kandidatuddannelse Udvikling samt indhold Overvejelser, der er blevet gjort i forbindelse med at rette en kandidatuddannelse mod de maritime professionsbachelorer,

Læs mere

Aflevering af OIOXML-skemaer Dokumentation

Aflevering af OIOXML-skemaer Dokumentation Aflevering af OIOXML-skemaer Dokumentation 2 Indholdsfortegnelse Projektbeskrivelse... 3 Projektansvarlig... 3 Formål... 3 Namespace... 3 Skemafiler... 3 Beskrivelse af elementer... 4 3 Projektbeskrivelse

Læs mere


SUPPLERINGSORDNINGER. OVERSIGT OVER STUDIFORLØB SUPPLERINGSORDNINGER. OVERSIGT OVER STUDIFORLØB Indholdsfortegnelse Finansøkonomer... 2 Financial Controller... 3 Markedsføringsøkonomer med statistik og driftsøkonomi... 4 Market Economists/Marketing

Læs mere


SUPPLERINGSORDNINGER. OVERSIGT OVER STUDIFORLØB SUPPLERINGSORDNINGER. OVERSIGT OVER STUDIFORLØB Indholdsfortegnelse Finansøkonomer... 2 Markedsføringsøkonomer med statistik og driftsøkonomi... 3 Market Economists/Marketing Management with statistics

Læs mere


Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin sommer 15 Institution VUC-vestegnen Uddannelse Fag og niveau Lærer(e) Hold Hf Erhvervsøkonomi C Kofi Mensah

Læs mere

Guidelines to tenderer. Appendix 2.m contains copies of letters to 15 year olds, one for each region.

Guidelines to tenderer. Appendix 2.m contains copies of letters to 15 year olds, one for each region. Guidelines to tenderer Appendix 2.m contains copies of letters to 15 year olds, one for each region. The tender is not supposed to fill in or complete this appendix. The aapendix, in its entirely, is a

Læs mere

Kriterie for at bestå: Deltagelse i undervisningstiden, udarbejdelse af e-magasin, deltagelse i fælles fremlægning.

Kriterie for at bestå: Deltagelse i undervisningstiden, udarbejdelse af e-magasin, deltagelse i fælles fremlægning. 1. E-MAGASINER (Herning) Hvem kan deltage: Studerende i Herning Kriterie for at bestå: Deltagelse i undervisningstiden, udarbejdelse af e-magasin, deltagelse i fælles fremlægning. På kurset lærer du at

Læs mere

Google Plus Link:

Google Plus Link: Business Name: Godt Smil Tandlæge Horsens Address: Ormhøjgårdvej 1, 8700 Horsens Phone: +45 44 22 41 01 Website: Hours : Mon-Thurs 8am-4pm, Fri 8am-3pm Description: Godt

Læs mere

ANALYSE. Udviklingen i HD-uddannelsernes prisniveau - 2012.

ANALYSE. Udviklingen i HD-uddannelsernes prisniveau - 2012. Udviklingen i HD-uddannelsernes prisniveau - 2012 ANALYSE FSR - danske revisorer er en brancheorganisation for godkendte revisorer i Danmark. Foreningen varetager revisorernes interesser fagligt

Læs mere

Profilbeskrivelse for International Marketing International Marketing

Profilbeskrivelse for International Marketing International Marketing Profilbeskrivelse for International Marketing International Marketing Bilag til studieordningen for kandidatuddannelsen i erhvervsøkonomi (cand.merc.) Odense 2009 1 af 7 Denne profilbeskrivelse er udarbejdet

Læs mere

Cand. Scient. San. Projektfysioterapeut Ph.d stud Morten Quist UCSF

Cand. Scient. San. Projektfysioterapeut Ph.d stud Morten Quist UCSF Cand. Scient. San. Projektfysioterapeut Ph.d stud Morten Quist UCSF LUFT November 2011 UCSF Forskerkursus Afsluttende skriftlig rapport Rapporten Kursisternes individuelle arbejde med selvvalgt klinisk

Læs mere

Profilbeskrivelse for International Marketing International Marketing (udbydes for sidste gang i efteråret 2011)

Profilbeskrivelse for International Marketing International Marketing (udbydes for sidste gang i efteråret 2011) Profilbeskrivelse for International Marketing International Marketing (udbydes for sidste gang i efteret 2011) Bilag til studieordningen for kandidatuddannelsen i erhvervsøkonomi (cand.merc.) Odense Sept.

Læs mere

En forsknings og businesspark inden for sundhedsteknologi og videnskab i Nord Danmark

En forsknings og businesspark inden for sundhedsteknologi og videnskab i Nord Danmark Introduktion til Eir En forsknings og businesspark inden for sundhedsteknologi og videnskab i Nord Danmark Eir samler og udnytter synergierne mellem den basale og anvendelsesorienterede sundhedsteknologiske

Læs mere

Tilfredshed med tandlæger

Tilfredshed med tandlæger Grafikrapport Tilfredshed med tandlæger Undersøgelse om tilfredshed med tandlæger. Gennemført af CEM Institute Voxmeter for TANDLÆGEFORENINGEN Metode Undersøgelsen er baseret på 1000 interview med et nationalt

Læs mere

HD 1.del. HD oversigt over alternativer til det normerede 2-årige samlede forløb. HD 1.del på 1 år. Sep Okt Nov Dec Jan Feb Mar Apr Maj

HD 1.del. HD oversigt over alternativer til det normerede 2-årige samlede forløb. HD 1.del på 1 år. Sep Okt Nov Dec Jan Feb Mar Apr Maj HD 1.del HD 1.del på 1 år Erhvervsøkonomi (15 ECTS) Dataanalyse (5 ECTS) Samfundsøkonomi (10 ECTS) Erhvervsret (5 ECTS) Erhvervsøk. metode (5 ECTS) (5 ECTS) (5 ECTS) Afsluttende Proj. (10 ECTS) 1.semester

Læs mere



Læs mere

Faktaark: Studiemiljø

Faktaark: Studiemiljø Faktaark: Studiemiljø Dette faktaark omhandler studiemiljøet på uddannelsesstederne blandt Djøf Studerendes medlemmer. Resultaterne stammer fra Djøfs studielivsundersøgelse. Undersøgelsen er foretaget

Læs mere

Innovation i Horizon 2020 Klima

Innovation i Horizon 2020 Klima Innovation i Horizon 2020 Klima Stefanie Bondy Jørgensen, EuroCenter o NCP for Klima, Rummelige Samfund og Videnskab med og for samfundet i Horizon 2020 o Medlem af programkomitéen for Klima Horizon 2020

Læs mere


BECOME A GLOBAL DAIRY AND FOOD EXPERT BECOME A GLOBAL DAIRY AND FOOD EXPERT Sidsel Nørregaard, 26 år Innovation Engineer, SPX Innovation Centre Projektarbejde i sverige Mads Aamann, 34 år Research scientist Chr. Hansen

Læs mere

Cand. Tech. i Maritim Teknologi. Syddansk Universitet

Cand. Tech. i Maritim Teknologi. Syddansk Universitet Cand. Tech. i Maritim Teknologi Syddansk Universitet SDU - Det Tekniske Fakultet Etableret i 2006 fusion mellem SDU og IOT Uddannelse og forskning i Odense og Sønderborg 4 institutter Institut for Teknologi

Læs mere

Udkast til budget 2011 for IT-Universitetet i København

Udkast til budget 2011 for IT-Universitetet i København Bilag 6 Økonomisektionen Ref.: Georg Dam Steffensen 05. november 2010 Udkast til budget 2011 for IT-Universitetet i København På baggrund af bestyrelsens godkendelse af de overordnede budgetrammer for

Læs mere

Stamoplysninger og undervisningsbeskrivelse. Oversigt over gennemførte undervisningsforløb

Stamoplysninger og undervisningsbeskrivelse. Oversigt over gennemførte undervisningsforløb Stamoplysninger og undervisningsbeskrivelse Termin Juni 2014 Institution Uddannelse VUC Vestegnen Hf enkeltfag Fag og niveau Erhvervsøkonomi C, Hf-bekendtgørelsen af 2010 Lærer Hold Kasper Qvist Færgemann

Læs mere

What Characterises Danish Investments in Africa?

What Characterises Danish Investments in Africa? What Characterises Danish Investments in Africa? Master s Thesis Business and Development Studies Supervisor: Stine Haakonsson Copenhagen Business School 3 June 2015 Mette Ravn Number of pages: 78 Number

Læs mere

Studieordning, Kandidatuddannelsen Oqaasilerineq, atuakkialerineq tusagassiuutilerinerlu Sprog, Litteratur og Medier

Studieordning, Kandidatuddannelsen Oqaasilerineq, atuakkialerineq tusagassiuutilerinerlu Sprog, Litteratur og Medier Studieordning, Kandidatuddannelsen Oqaasilerineq, atuakkialerineq tusagassiuutilerinerlu Sprog, Litteratur og Medier Kulturimik, Oqaatsinik Oqaluttuarisaanermillu Ilisimatusarfik Institut for Kultur, Sprog

Læs mere

Målrettet talentforløb på de videregående uddannelser

Målrettet talentforløb på de videregående uddannelser Målrettet talentforløb på de videregående uddannelser Støtte og stimuering af talenter med henblik på at skabe en ny generation af vækstorienterede entreprenører og intraprenører Pål Fernvall, Projektleder,

Læs mere

Evaluering af Master in Leadership and Innovation in Complex Systems

Evaluering af Master in Leadership and Innovation in Complex Systems Evaluering af Master in Leadership and Innovation in Complex Systems På masteruddannelsen i Leadership and Innovation in Complex Systems blev der i efteråret 2009 udbudt undervisning i følgende to moduler:

Læs mere

Bestyrelseshåndbog 2013 Holsted Speedway Klub

Bestyrelseshåndbog 2013 Holsted Speedway Klub Bestyrelsen Økonomiudvalg HSK Elite Kioskudvalg Sportsudvalg Officials Bane og Anlæg Beskrivelse af ansvarsområder Bestyrelsen Rudi Steen Hansen - Bjarne F. Thomsen - Dennis Mortensen - Lene Busk Jensen

Læs mere

HR/ Personalerekruttering

HR/ Personalerekruttering HR/ Personalerekruttering VI HJÆLPER JER MED REKRUTTERING AF NYE MEDARBEJDERE Kandidatprofiler Et udvalg Februar 2012 VI HAR KANDIDATERNE! Søger I kvalificeret, flersproget personale i Tyskland eller Danmark?

Læs mere

Workshop plan for Next Step foråret 2017

Workshop plan for Next Step foråret 2017 Workshop plan for Next Step foråret 2017 Læringsmål Der arbejdes gennem forløbet med fire overordnede dimensioner:,, og (Fonden for Entreprenørskab, 2015). Disse kan ses i til formålene samt i forhold

Læs mere

Forretningsmodeller i praksis - Forskerperspektivet DI Konference om Cirkulær Økonomi 30. oktober 2014

Forretningsmodeller i praksis - Forskerperspektivet DI Konference om Cirkulær Økonomi 30. oktober 2014 Forretningsmodeller i praksis - Forskerperspektivet DI Konference om Cirkulær Økonomi 30. oktober 2014 Niki Bey DTU Management Engineering, Division of Quantitative Sustainability Assessment

Læs mere

Det Tekniske Fakultet på Syddansk Universitet. Kort sagt 28. maj 2013

Det Tekniske Fakultet på Syddansk Universitet. Kort sagt 28. maj 2013 Det Tekniske Fakultet på Syddansk Universitet Kort sagt 28. maj 2013 Syddansk Universitet Facts Oprettet i 1966 Indtægter: 2.800 mill. kr. 5 fakulteter: Det Tekniske Fakultet Det Naturvidenskabelige Fakultet

Læs mere

ANALYSE. Udviklingen i HD-uddannelsernes prisniveau - 2012.

ANALYSE. Udviklingen i HD-uddannelsernes prisniveau - 2012. Udviklingen i HD-uddannelsernes prisniveau - 2012 ANALYSE FSR - danske revisorer er en brancheorganisation for godkendte revisorer i Danmark. Foreningen varetager revisorernes interesser fagligt

Læs mere


MEDARBEJDER- TILFREDSHEDS- UNDERSØGELSER SOM TEMPERATURMÅLING 18. MAJ 2015 MEDARBEJDER- TILFREDSHEDS- UNDERSØGELSER SOM TEMPERATURMÅLING 18. MAJ 2015 Fakultetskontoret for Det Teknisk-Naturvidenskabelige Fakultet og Det Sundhedsvidenskabelige Fakultet Det Teknisk-Naturvidenskabelige

Læs mere

Results by Class Report Show #20153 Ride In 2015 Regstrup, Denmark 14-06-2015

Results by Class Report Show #20153 Ride In 2015 Regstrup, Denmark 14-06-2015 -0-0 Page: Show #0 Ride In 0-0-0 Showbill: 9 Class: AQHA 0 AllBreed, Lead Line - Trail shown Go: entered Judge(s): Ricardo Melanie Toft Gerdes-Hansen st Judge: -0-0 Page: Show #0 Ride In 0-0-0 Showbill:

Læs mere


KENDSKAB TIL MARKETING AUTOMATION RAPPORT MARTS 2017 KENDSKAB TIL MARKETING AUTOMATION RAPPORT MARTS 2017 HOVEDRESULTATER Selvom marketing automation er et fokusområde blandt 33% af de deltagende virksomheder, er det kun en lille gruppe der siger deres virksomhed

Læs mere

Adgangskrav for Digital Design og Kommunikation (optagelse august 2018)

Adgangskrav for Digital Design og Kommunikation (optagelse august 2018) Adgangskrav for Digital Design og Kommunikation (optagelse august 2018) For at søge om optagelse på IT-Universitetets kandidatuddannelse i Digital Design og Kommunikation skal du have en universitets-bacheloruddannelse

Læs mere


WP2-2C 10.d. RESEARCH STUDY EXECUTIVE SUMMARY EUROPEAN CULTURAL LEARNING NETWORK LEONARD DA VINCI ECLN Grant agreement: 2012-3657 / 001-001 WP2-2C 10.d. RESEARCH STUDY EXECUTIVE SUMMARY (Danish) ECLNResearchStudy ExecutiveSummary Danish 1 Overordnetresumé

Læs mere

Introduktion til NNIT

Introduktion til NNIT Introduktion til NNIT IT-kontraktsnetværk 18. august 2014 PUBLIC Kort fortalt En af Danmarks fire største leverandører af itservices Vi leverer udvikling, implementering og drift til life sciences, finanssektoren,

Læs mere


HR/Personalerekruttering HR/Personalerekruttering VI HJÆLPER JER MED REKRUTTERING AF NYE MEDARBEJDERE Kandidatprofiler et udvalg Juli 2012 Side 1 af 7 Søger I kvalificeret, flersproget personale i Tyskland eller Danmark? VI HAR

Læs mere

Ansøgning til Studienævn for farmaci om godkendelse af kontrakt for INDIVIDUEL STUDIEAKTIVITET

Ansøgning til Studienævn for farmaci om godkendelse af kontrakt for INDIVIDUEL STUDIEAKTIVITET Ansøgning til Studienævn for farmaci om godkendelse af kontrakt for INDIVIDUEL STUDIEAKTIVITET mellem studerende og institut / Application to the Study Board at the Faculty of Science Concerning an Approval

Læs mere

CETREA Erfaringer med offentligprivat innovation og hvad det førte til. Jakob E. Bardram, professor, forskningsdirektør

CETREA Erfaringer med offentligprivat innovation og hvad det førte til. Jakob E. Bardram, professor, forskningsdirektør CETREA Erfaringer med offentligprivat innovation og hvad det førte til Jakob E. Bardram, professor, forskningsdirektør Agenda Klinisk Logis/k hvad er klinisk logis/k hvordan passer det ind i et hospitals

Læs mere


Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Maj-juni 2015 Institution Campus Vejle Uddannelse Fag og niveau Lærer(e) Hold HHX Afsætning B Jacob Lund HH16busa14

Læs mere

Tabel 1 Optaget på Syddansk Universitet og Aalborg Universitet Esbjerg fordelt på fakultetsniveau 2000 2011

Tabel 1 Optaget på Syddansk Universitet og Aalborg Universitet Esbjerg fordelt på fakultetsniveau 2000 2011 Bilag 18 Oversigt over optaget på videregående uddannelser I bilaget findes en oversigt over optaget på de videregående uddannelser i Syddanmark, fordelt henholdsvis på geografi og Uddannelse/fakultet.

Læs mere


Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Sommer 2016 Institution Vid Gymnasier/HHX Rønde Uddannelse Fag og niveau Lærer(e) Hold HHX Afsætningsøkonomi

Læs mere

TA BUSSEN - LINIE 888 - HURTIGT BILLIGT BEHAGELIGT NEMT KØBENHAVN SILKEBORG ÅRHUS THISTED AALBORG KUN 120 KR. til Århus og Silkeborg. Aalborg og Thisted kun 140 kr. Ovenstående priser er for studerende

Læs mere

Information Meeting, Department of Management. Last meeting 27 May 2011

Information Meeting, Department of Management. Last meeting 27 May 2011 Information Meeting Department of Management Last meeting Agenda News/Announcements The Ph.D.-school: new Ph.D.-students? New Head of Department, Department of Business Administration New Administrative

Læs mere


MARKEDSFØRINGS- PLAN MARKEDSFØRINGS- PLAN Karatbars Program for Affiliate Partnere Det er dig, der bestemmer hvilken type indkomst, du ønsker at få. Der er 7 muligheder at tjene penge på. 7 Indkomstmuligheder 1. Direkte Provision

Læs mere

Væksthus Nordjylland. Væksthus Nordjylland Tlf. 70 21 08 08

Væksthus Nordjylland. Væksthus Nordjylland Tlf. 70 21 08 08 Væksthus Nordjylland Business Region North Denmark Regionalt Vækstforum Væksthus Nordjylland EU-kontor Kommunal erhvervsservice Væksthus Nordjylland Væksthus Nordjylland holder til i NOVI Science Park,

Læs mere

Roskilde Tandklinik. Sjælland

Roskilde Tandklinik. Sjælland Antal invitationer Antal svar Svar andel,% Antal anonyme 0 Anonyme andel Roskilde Tandklinik Sjælland Behandler Betina Laustsen Behandler A- dintandlæge PTU-0-000 Roskilde Tandklinik Hvordan var den eller

Læs mere

Novo Nordisk erfaringer med ErhvervsPhD

Novo Nordisk erfaringer med ErhvervsPhD Presentation title Novo Nordisk erfaringer med ErhvervsPhD Jørgen Dirach, MD, MBA, FFPM Director Corporate Research Affairs Novo Nordisk A/S Novo Nordisk Your Protein Partner 6 May

Læs mere

Hvis incidents er dyre og besværlige...

Hvis incidents er dyre og besværlige... Hvis incidents er dyre og besværlige... 2013-03 DKKNS Page 1 Transition Management Agenda Hvem er Coloplast? Hvem er jeg? Transition management basics Transition i Coloplast Ifølge Gartner er årsagen til

Læs mere

Studieordning for bacheloruddannelsen i global virksomhedsinformatik ved IT-Universitetet i København

Studieordning for bacheloruddannelsen i global virksomhedsinformatik ved IT-Universitetet i København Studieordning for bacheloruddannelsen i global virksomhedsinformatik ved IT-Universitetet i København Studieordning af 10. juni 2010 Revideret den 19. august 2015 Indhold Indledning Kapitel 1. Uddannelsens

Læs mere



Læs mere

2012/1 LSF 37 (Gældende) Udskriftsdato: 4. juli 2016. Forslag. til

2012/1 LSF 37 (Gældende) Udskriftsdato: 4. juli 2016. Forslag. til 2012/1 LSF 37 (Gældende) Udskriftsdato: 4. juli 2016 Ministerium: Ministeriet for Forskning, Innovation og Videregående Uddannelser Journalnummer: Ministeriet for Forskning, Innovation og Videregående

Læs mere

Bliv synlig på nettet!

Bliv synlig på nettet! Bliv synlig på nettet! Østfyns Erhvervsråd Sinatur Hotel Storebælt Nyborg d. 8. september 2015 Sanne Schibsbye IBIZ-Center +45 7220 1751 Morgenens program Introduktion til online synlighed

Læs mere

Profilbeskrivelse for MBA i Innovation Management

Profilbeskrivelse for MBA i Innovation Management Det elige Fakultet Profilbeskrivelse for MBA i Innovation Management Odense 2012 1 af 7 Det elige Fakultet Denne profilbeskrivelse er udarbejdet som et bilag, tilknyttet studieordningen for Master of Business

Læs mere

ANALYSE. Prisudviklingen på HD-uddannelser - 2014.

ANALYSE. Prisudviklingen på HD-uddannelser - 2014. udviklingen på HD-uddannelser - 2014 ANALYSE FSR - danske revisorer er en brancheorganisation for godkendte revisorer i Danmark. Foreningen varetager revisorernes interesser fagligt og politisk.

Læs mere


Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Sommer 2016 Institution Vid Gymnasier/HHX Rønde Uddannelse Fag og niveau Lærer(e) Hold HHX Afsætningsøkonomi

Læs mere


HR/Personalerekruttering HR/Personalerekruttering VI HJÆLPER JER MED REKRUTTERING AF NYE MEDARBEJDERE Kandidatprofiler et udvalg August 2012 Side 1 af 9 Søger I kvalificeret, flersproget personale i Tyskland eller Danmark? VI

Læs mere

Peak Consulting Group er en førende skandinavisk management konsulentvirksomhed

Peak Consulting Group er en førende skandinavisk management konsulentvirksomhed Styregrupper Styregrupper er en af de største barrierer for effektiv program- og projektudførelse, hør hvordan vi har adresseret denne udfordring i både offentligt og privat regi Helle Russel Falholt Projektværktøjsdagen

Læs mere

Kommunikations-/SEO-praktikant Lær om SEO samt resultatskabende online kommunikation og -markedsføring.

Kommunikations-/SEO-praktikant Lær om SEO samt resultatskabende online kommunikation og -markedsføring. AW Media ApS Høffdingsvej 34 2500 Valby Kommunikations-/SEO-praktikant Lær om SEO samt resultatskabende online kommunikation og -markedsføring. AW Media søger praktikant med talent for kommunikation til

Læs mere

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen. og

Engelsk. Niveau D. De Merkantile Erhvervsuddannelser September Casebaseret eksamen.  og 052431_EngelskD 08/09/05 13:29 Side 1 De Merkantile Erhvervsuddannelser September 2005 Side 1 af 4 sider Casebaseret eksamen Engelsk Niveau D og Indhold: Opgave 1 Presentation

Læs mere

Århus 7. april Regionalt netværksmøde 2011 Offshore Center Danmark Århus Universitet. Manager Oil & Gas Tommy Petersen

Århus 7. april Regionalt netværksmøde 2011 Offshore Center Danmark Århus Universitet. Manager Oil & Gas Tommy Petersen Århus 7. april 2011 Regionalt netværksmøde 2011 Offshore Center Danmark Århus Universitet Manager Oil & Gas Tommy Petersen 1 Dagsorden Dagens program Velkommen ved Manager Oil & gas Tommy Petersen Velkommen

Læs mere

Modediagnoser og indikationsskred. IRFs stormøde Michael Lange, Head Public Affairs Scandinavian København 5. februar 2013

Modediagnoser og indikationsskred. IRFs stormøde Michael Lange, Head Public Affairs Scandinavian København 5. februar 2013 Modediagnoser og indikationsskred IRFs stormøde Michael Lange, Head Public Affairs Scandinavian København 5. februar 2013 Hvad vil jeg sige noget om! Tænker industrien i modediagnoser? Har industrien legitimitet

Læs mere

Opsamling - Møde i Uddannelsesudvalget den 9. januar 2014

Opsamling - Møde i Uddannelsesudvalget den 9. januar 2014 17.01.2014/JMH Opsamling - Møde i Uddannelsesudvalget den 9. januar 2014 Deltagere: Udpeget af bestyrelsen: Thomas Jordan Johannesen, Business Manager, Rambøll Udpeget af uddannelsernes Advisory Boards:

Læs mere

Authors: Katja Gjevnøe Andersen & Majken Gjevnøe Andersen. MA: Cand.ling.merc. (interpreter, French) Institution: Copenhagen Business School (CBS)

Authors: Katja Gjevnøe Andersen & Majken Gjevnøe Andersen. MA: Cand.ling.merc. (interpreter, French) Institution: Copenhagen Business School (CBS) Anvendelsen af infinitte verbalformer i franske og danske SugarTexts samt ækvivalerende udtryk i danske SugarTexts [The use of infinite verb forms in French and Danish SugarTexts and equivalent expressions

Læs mere

Struktur for samkøring af Family Tables og Top Down Design under brug af Wildfire 5.0/Creo 1.0

Struktur for samkøring af Family Tables og Top Down Design under brug af Wildfire 5.0/Creo 1.0 Downloaded from on: Jan 10, 2017 Struktur for samkøring af Family Tables og Top Down Design under brug af Wildfire 5.0/Creo 1.0 Christensen, Georg Kronborg Publication date: 2012 Document

Læs mere


Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Sommer 2013 Institution Frederikshavn Handelsskole Uddannelse Fag og niveau Lærer(e) Hold Hhx Afsætning B

Læs mere

Den uddannede har viden om: Den uddannede kan:

Den uddannede har viden om: Den uddannede kan: Den uddannede har viden om: Den uddannede kan: Den uddannede kan: Den studerende har udviklingsbaseret viden om og forståelse for Den studerende kan Den studerende kan Den studerende har udviklingsbaseret

Læs mere


Undervisningsbeskrivelse Undervisningsbeskrivelse Stamoplysninger til brug ved prøver til gymnasiale uddannelser Termin Sommer 2017 Institution Vestegnen HF-VUC Uddannelse Fag og niveau Lærer(e) Hold Hf Erhvervsøkonomi C Kofi

Læs mere


MULTIMEDIEDESIGNER 1. ÅRS PRØVE MULTIMEDIEDESIGNER 1. ÅRS PRØVE Eksamensprojekt, 2. semester, forår 2010 TEMA: E-HANDEL Erhvervsakademiet København Nord Udleveret mandag d. 3. maj 2010 Afleveres i 4 eksemplarer senest d. 28. maj kl.

Læs mere

ANALYSE. Prisudviklingen på HD-uddannelser FSR - danske revisorer er en brancheorganisation for godkendte revisorer i Danmark.

ANALYSE. Prisudviklingen på HD-uddannelser FSR - danske revisorer er en brancheorganisation for godkendte revisorer i Danmark. udviklingen på HD-uddannelser - 2013 ANALYSE FSR - danske revisorer er en brancheorganisation for godkendte revisorer i Danmark. Foreningen varetager revisorernes interesser fagligt og politisk.

Læs mere

Webredaktør/Webmaster som bygger online medier der involverer, engagerer og beriger

Webredaktør/Webmaster som bygger online medier der involverer, engagerer og beriger Morten Vium Webredaktør/Webmaster som bygger online medier der involverer, engagerer og beriger Summary Jeg starter ting. Det har jeg altid gjort, og det vil jeg altid gøre. Internettet

Læs mere

Fonden Overskrift for Entreprenørskab dfgdffghfg. Young Enterprise

Fonden Overskrift for Entreprenørskab dfgdffghfg. Young Enterprise Fonden for Entreprenørskab Young Enterprise Fonden for Entreprenørskab Young Enterprise April 2012 Fonden for Entreprenørskab Young Enterprise Støttet af Større danske erhvervsvirksomheder og organisationer

Læs mere

Nøgletal for Den Samfundsvidenskabelige Ph.d.-skole, Ph.d.-bestand

Nøgletal for Den Samfundsvidenskabelige Ph.d.-skole, Ph.d.-bestand Nøgletal for Den Samfundsvidenskabelige Ph.d.-skole, 212 1. Ph.d.-bestand 1.1 Nuværende bestand på Samf.-AAU Nedenstående er udtryk for den samlede ph.d.-bestand pr. 31.12 212. Program 1 : SOC STATS I

Læs mere

Katalog med eksempler

Katalog med eksempler Katalog med eksempler Eksamensgruppen under styregruppen for uddannelse, nov. -dec. 2012 Eksamensformer hænger nært sammen med faglige mål, som formuleres inden for rammerne af viden, færdigheder og kompetencer.

Læs mere


THE SCANDINAVIA-JAPAN SASAKAWA FOUNDATION THE SCANDINAVIA-JAPAN SASAKAWA FOUNDATION Report Udfyldes på dansk eller engelsk Denne forside findes også i elektronisk form på vores webside. Vi foretrækker at modtage en digital version, såfremt beretningen

Læs mere

Profilbeskrivelse for Styring og ledelse

Profilbeskrivelse for Styring og ledelse Profilbeskrivelse for Styring og ledelse Bilag til studieordningen for kandidatuddannelsen i Erhvervsøkonomi Kolding 1.sep. 2012 1 af 8 Denne profilbeskrivelse er udarbejdet som et bilag, tilknyttet studieordningen

Læs mere

HR/ Personalerekruttering

HR/ Personalerekruttering HR/ Personalerekruttering VI HJÆLPER JER MED REKRUTTERING AF NYE MEDARBEJDERE Kandidatprofiler Et udvalg September 2012 Side 1 af 10 VI HAR KANDIDATERNE! Søger I kvalificeret, flersproget personale i Tyskland

Læs mere

2 Udsendelse af tilbud og afslag

2 Udsendelse af tilbud og afslag 2 Udsendelse af tilbud og afslag Denne guide beskriver, hvordan man udsender tilbud og afslag, når ph.d. skoleudvalgets behandling af de kvalificerede ansøgere er afsluttet. Forud for denne ligger vejledningen

Læs mere

Profilbeskrivelse for Styring og ledelse

Profilbeskrivelse for Styring og ledelse Profilbeskrivelse for Styring og ledelse Bilag til studieordningen for kandidatuddannelsen i Erhvervsøkonomi Kolding 1.sep. 2016 1 af 9 Denne profilbeskrivelse er udarbejdet som et bilag, tilknyttet studieordningen

Læs mere

Profilbeskrivelse for MBA i Supply Chain Management

Profilbeskrivelse for MBA i Supply Chain Management Det elige Fakultet Profilbeskrivelse for MBA i Supply Chain Management Odense 2012 1 af 7 Det elige Fakultet Denne profilbeskrivelse er udarbejdet som et bilag, tilknyttet studieordningen for Master of

Læs mere

KLAR TIL KLYNGE FACILITATOR TRÆNING 2.0 3.-5. SEPTEMBER 2012 & 1.-3. OKTOBER 2012. REG X - Det Danske Klyngeakademi

KLAR TIL KLYNGE FACILITATOR TRÆNING 2.0 3.-5. SEPTEMBER 2012 & 1.-3. OKTOBER 2012. REG X - Det Danske Klyngeakademi KLAR TIL KLYNGE FACILITATOR TRÆNING 2.0 3.-5. SEPTEMBER 2012 & 1.-3. OKTOBER 2012 REG X - Det Danske Klyngeakademi OM PROGRAMMET I dag betragtes udvikling af klynger som en af de vigtigste

Læs mere