27611 Eksamen Sommer 2008

Save this PDF as:
 WORD  PNG  TXT  JPG

Størrelse: px
Starte visningen fra side:

Download "27611 Eksamen Sommer 2008"

Transkript

1 27611 Eksamen Sommer 2008 Dette sæt indeholder 10 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan under selve eksamen ( juni 2008 klokken 15:00-19:00). DNA/Protein sekvenser kan kopieres direkte herfra - det er ikke meningen at sekvenserne skal tastes ind i hånden. Lektionsplan: Svar til opgavesættet skal skrives enten i rå tekst (fx i Notepad/Wordpad) eller i Microsoft Word (.doc) format. Svaret skal uploades på CampusNet under kursus (under "Afleveringer -> Eksamen 2008"). Husk at gemme seneste version af dokumentet inden du uploader svaret. Når du afleverer får du en kode som skal skrives i feltet "Afleveringskode" nedenfor. Dit studienummer skal fremgå af filnavnet (fx. s doc eller s txt) og skal også stå i starten af dokumentet (fx: "Studienummer: s022717") Udfyld denne forside og aflever den til eksamensvagten. Lokalenummer og computernummer skal udfyldes med henblik på kontrol af netværkstrafikken. Navn: Studienummer: Afleveringskode: Lokalenummer: Computernummer: (For eksaminander i lokale , byg skriv nummeret på låget af den bærbære computer. For eksaminander i lokale 052 og 152 i byg. 210, brug oversigten herunder): 1 of 7

2 Hvad gør man hvis en web-server ikke virker: Verificer at input-data er i korrekt format. Forkert inputdata er i næsten alle tilfælde årsagen til problemet. Prøv evt. at finde en alternativ server med samme funktion (Google). Rapporter fejlen til eksamensvagten - den kursusansvarlige vil så blive tilkaldt. 2 of 7

3 Opgave 1 (15%): Efter en farefuld færd i Sydamerikas jungler er det lykkedes dig at hjembringe knoglerne fra en hidtil ukendt dinosaurus-art. Fra knoglerne har du isoleret et lille stykke DNA som du er interesseret i at undersøge nærmere, dels for at finde ud af hvad DNAets funktion er, dels for at lære mere om den mystiske dinosaurus (og derved på sigt blive rig og berømt og få råd til et hus på Bahamas). Du skal i dit svar forklare hvilke værktøjer du har benyttet for at komme frem til svaret, samt hvorfor du benyttede netop dem. Du vil først og fremmest gerne vide noget om DNAets funktion. Er DNA-fragmentet protein-kodende? Hvad er den sandsynlige funktion af dette stykke DNA (eller evt. det protein det koder for)? Du vil også gerne vide noget om hvilken slags nulevende dyr den afdøde dinosaurus mindede om. Det er ret velunderbygget at dinosaurer er tæt beslægtede med fugle, og man ville umiddelbart forvente at i et fylogenetisk træ ville dinosaurer ligge et sted tæt på fugle og krokodiller. Hvilken database-sekvens er tættest beslægtet med dit ukendte DNA-fragment, og hvilken organisme stammer den fra? (Den laborant som ekstraherede DNA-fragmentet for dig er meget, meget glad for skinke-sandwich. Med den information in mente: Tror du der kan være sket en fejl under arbejdet med dit dinosaurus-dna?) >ukendt_sekvens GAAGGATGGCCAGTACCTTCTCAAAATTACTAACTGGCCGCAATGCTTCTTTGTTATTTGCCACCTTGGG CACCGGTGCCCTGACCACCGGGTACTTGATGAATCAGCGGAGCGTGTGTGCTGAGGCCCGGGAGCAGCAC AGGCTGTTCCCGCCAAGCGCAGACTACCCTGATCTACGCAAGCACAACAACTGCATGGCCGAGTGC Opgave 2 (5%): På basis af to forskellige DNA-datasæt, fra to forskellige gener, har du konstrueret de følgende fylogenetiske træer. Viser træerne den samme evolutionære historie eller er der forskelle? Opgave 3 (10%): Du har indsamlet en række relaterede enzym-sekvenser fra forskellige organismer (se herunder), og er nu interesseret i at undersøge i hvor høj grad de ligner hinanden. Lav et multiple alignment af sekvenserne. Find den længste, helt konserverede blok af aminosyrer og angiv hvilke positioner, målt ud fra alignment-nummereringen, denne blok dækker. Hvis man istedet nummererer ud fra sekvensen med navnet NP_067263, hvad er så positionen 3 of 7

4 af den konserverede blok? >NP_ MLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTT KRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEY KDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRS GDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVE TIDDFKVEDFQIEGYNPHPTIKMEMAV >NP_ MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV >NP_ MPDTAVEVTNGHCVNGESKKEETNGGKKEFSLFCDERGYLSLVEFILQNGAKKGDRTGTGVISVFGTQAR YSLRDQFPLLTTKRVFWKGILEELLWFIKGSTNAKDLSEKGVRIWDANGSREFLDKNGFTDREEGDLGPV YGFQWRHFGAEYKDMHTDYSGEGVDQLQKVIDTIKSNPEDRRIIMCAWNPKDLPLMALPPCHALCQFYVS NGELSCQLYQRSGDIGLGVPFNIASYALLTYMIAHITGLKPGDFVHTLGDAHIYTNHIEPLKEQIQREPR PFPKLRIKRKVEQINDFCAEDFEIYDYDPHPTIKMQMAV >NP_ MPVISESTAASSCPEQGAGKAENRDELQYLDQIKYILEHGHRKEDRTGTGTVSVFGMQARYSLRDQFPLL TTKRVFWKGVLEELLWFVKGCTNSKELSAKGVKIWDANGSREFLDKQGFSTREEGDLGPVYGFQWRHFGA EYKDTHTDYSGQGVDQLQHVIDTIKNNPDDRRIIMCSWNPKDISLMALPPCHTLCQFYVVDKELSCQLYQ RSGDMGLGVPFNIASYALLTYMIAHVTGLKPGDFVHTLGDAHVYLNHMEPLKIQLQRSPRPFPKLKILRQ VENIDDFTADDFLIEGYDPHPPIKMEMAV >NP_ MNKENIIADAPSDVVKTVQQQVHLNQDEYKYLKQVEQILREGTRRDDRTGTGTISIFGMQSKYCLRNGTI PLLTTKRVYWKGVLEELLWFISGSTDGKLLMEKNVKIWEKNGDRAFLDNLGFTSREEGDLGPVYGFQWRH FGAKYVDCHTDYSGQGVDQLAEVIRQIKEQPDSRRIIMSAWNPSDLGQMVLPPCHTMCQFYVDNGELSCQ LYQRSGDMGLGVPFNLASYGLLTHMIAKVCGLKPGTLVHTLGDAHVYSNHVDALKIQLDREPYAFPKIRF TRDVASIDDFTSDMIALDDYKCHPKIPMDMAV >NP_ MVLTPTKDGPDQESMPLPADNGESPSKQQAPVNRDEMHYLDLLRHIIANGEQRMDRTEVGTLSVFGSQMR FDMRNSFPLLTTKRVFFRAVAEELLWFVAGKTDAKLLQAKNVHIWDGNSSREFLDKMGFTGRAVGDLGPV YGFQWRHFGAQYGTCDDDYSGKGIDQLRQVIDTIRNNPSDRRIIMSAWNPLDIPKMALPPCHCLAQFYVS EKRGELSCQLYQRSADMGLGVPFNIASYALLTHMIAHVTGLKPGDFVHTMGDTHVYLNHVEPLKEQLERT PRPFPKLIIKRQVQDIEDFRFEDFQIVDYNPHPKIQMDMAV >NP_ MATTTLNDSVTTTLASEPQRTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDITLTTSDSSKKNAVVMG RKTWESIPIKYRPLSGRLNVVLTRSGGFDIANTENVVTCSSVDSALDLLAAPPYCLSIERVFVIGGGDIL REALNRPSCDAIHLTEIDTSVDCDTFIPAIDTSVYQPWSSSFPVTENGLRFCFTTFVRVKSSADESSDES NGSQSLQFDGKKFLFLPKMVFDQHEEFLYLNMVEDIISNGNVKNDRTGTGTLSKFGCQMKFNLRRSFPLL TTKRVFWRGVVEELLWFISGSTNAKVLQEKGIHIWDGNASREYLDGIGLTEREEGDLGPVYGFQWRHFGA KYTDMHADYTGQGFDQLVDVIDKIKNNPDDRRIIMSAWNPSDLKLMALPPCHMFAQFYVAEGELSCQMYQ RSADMGLGVPFNIASYSLLTCMLAHVCDLVPGDFIHVLGDAHVYKTHVRPLQEQLLNLPKPFPVMKINPE KKQIDSFVASDFDLTGYDPHKKIEMKMAV >NP_ MTMDGKNKEEEQYLDLCKRIIDEGEFRPDRTGTGTLSLFAPPQLRFSLRDDTFPLLTTKKVFTRGIILEL LWFLAGDTDANLLSEQGVKIWDGNGSREYLDKMGFKDRKVGDLGPVYGFQWRHFGAKYKTCDDDYTGQGI DQLKQVIHKLKTNPYDRRIIMSAWNPADFDKMALPPCHIFSQFYVSFPKEGEGSGKPRLSCLLYQRSCDM GLGVPFNIASYALLTRMIAKVVDMEPGEFIHTLGDAHVYKDHIDALKEQITRNPRPFPKLKIKRDVKDID DFKLTDFEIEDYNPHPRIQMKMSV Opgave 4 (10%): Du har to sekvenser du gerne vil have alignet, og overvejer nu hvilket af to følgende alignments der er det bedste. Udregn alignment score for alignment 1 og 2 givet det nedenstående scoringssystem (gapscoringssystem + substitutionsmatrix) Hvilket alignment er bedst givet dette scoringssystem? Alignment 1: Alignment 2: KLMNRVATQPTWPR KLMNRVATQP-TWP-R : :::: : : : : : ::: : KVMNRVGTWP--VR K----VMNRVGTWPVR Affint gap-scoringssystem: Gap opening: -4 Gap elongation: -1 4 of 7

5 Substitutionsmatrix: A 5 R -2 7 N D C Q E G H I L K M F P S T W Y V A R N D C Q E G H I L K M F P S T W Y V Opgave 5 (15%): Du har et meget lille alignment med kun en sekvens der ovenikøbet kun består af en enkelt aminosyre: Y Du vil nu konstruere en vægtmatrix på basis af dette "alignment". Gennemgå udregningen af log-odds værdierne for aminosyrerne A og Y ved brug af pseudo-counts. Du kan finde Blosum substitutionsfrekvensmatricen, samt baggrundsfordelingen (background distribution) for de forskellige aminosyrer på dette link: Blosum matrix Du skal i besvarelsen angive mellemregningerne på hvordan du har fundet værdierne. Hvordan stemmer de værdier du finder overens med værdierne for at matche Y med henholdsvis A og Y i Blosum62 substitutionsscorings matricen? Du kan finde Blosum62 substitutionsscorings matricen her: wikipedia Blosum Forklar hvorfor der er den sammenhæng mellem Blosum62 substitutionsscorings værdierne og de værdier du har fundet. Opgave 6 (10%) Du og en af dine medstuderende har været på opdagelsesrejse inde i Amazonas regnskov, og har her været i kontakt med en gruppe indianere der har et usædvanligt MHC (immunsystem) molekyle. I almindelige humane MHC molekyler er bindingsmotivet hovedsageligt bestemt ud fra den og 9. peptidposition. I har været heldige at få en række peptider, der binder til det mærkelige MHC molekyle med hjem. Disse peptider er angivet nedenfor. AMGVNLTSM ASNENMETM AAPDNRETF CSLWNGPHL IQVGNTRTI NSLANPGIA VNIRNCCYI TNLLNDRVL FGISNYCQI KVPRNQDWL RAHYNIVTF ASNENMDAM ASNENMETM ILNHNFCNL FQPQNGQFI Lav et sekvenslogo af bindingsmotivet udfra de 15 peptider. Benyt en metode som anvender pseudo-counts og sekvensvægtning. Hvilke 2 positioner har mest betydning for bindingen, og hvilke aminosyrer har positiv effekt for binding på disse 2 positioner? 5 of 7

6 På position 5 i de 15 peptider er der udelukkende N. Forklar hvorfor logo'et ranker D højere end E? Ud over de 15 peptider ovenfor, har I også fået et sæt data med blandede peptider. Hvilket af nedenstående peptider vil sandsynligvis IKKE kunne binde til jeres MHC molekyle? AAFFNKTEF AELSLFTTE YAPVSPIVI Opgave 7 (10%) Du skal brug BLAST og PSI-BLAST til at lære mere om funktion og struktur af følgende protein. (Hvis PSI-BLAST kommer op med en fejlmeddelse i rødt, skal du bare fortsætte. Det betyder ingenting.) Du skal i dit svar forklare hvilke værktøjer du har benyttet for at komme frem til svaret, samt hvorfor du benyttede netop dem. >gi ref NP_ hypothetical protein LOC [Homo sapiens] MTPESRDTTDLSPGGTQEMEGIVIVKVEEEDEEDHFQKERNKVESSPQVLSRSTTMNERALLSSYLVAYR VAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF AIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLFTELENCLLGQYKLNWKHCKGIS SDGTANMTGKHSRLTEKLLEATHNNAVWNHCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRL LEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNEIYIFLVEKQSHLANIFEDDIWVTKLAYLSDI FGILNELSLKMQGKNNDIFQYLEHILGFQKTLLLWQARLKSNRPSYYMFPTLLQHIEENIINEDCLKEIK LEILLHLTSLSQTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLSSSFTLKNYY KILSLSAFWIKIKDDFPLLSRKSILLLLPFTTTYLCELGFSILTRLKTKKRNRLNSAPDMRVALSSCVPD WKELMNRQAHPSH Hvad er funktionen af dette protein? Hvor mange PSI-BLAST iterationer skal der køres for at finde et signifikant PDB hit (E-value < 0.005)? 4. Hvad er E-værdien af det signifikante PDB hit, og hvad er dets PDB identifier? Hvad er det mest brugte sekundærstrukturelement i denne PDB struktur? Opgave 8 (5%): Du har kørt en BLAST søgning med et protein, og har fået 3 hits. Hvilket af de følgende tre hits vil du vælge og hvorfor? %ID=30, E-value=0.1 %ID=10, E-value=2 %ID=10, E-value=0.001 Opgave 9 (10%) En patient er blevet indlagt på Hvidovre Hospitals afdeling for infektionssygdomme med en farlig viral infektion. I har fået virusen sekventeret, og skal nu finde ud af hvilken infektion det handler om. Du skal for hvert spørgsmål forklare hvordan du fandt frem til svaret. Genomet er blevet indlagt i Genbank med følgende Genbank ID: NC_00172 Hvilken organisme stammer dette genom fra? Hvor mange baser indeholder genomet? Hvor mange proteiner koder genomet for? 4. Hvor langt er det korteste protein og hvad hedder det? 6 of 7

7 Opgave 10 (10%) Et Ramachandran plot er en metode der kan bruges til at visualisere kvaliteten af en proteinstruktur. Nedenfor er vist et Ramachandran plot for proteinet 1deo Hvilke protein sekundærstrukturelementer findes primært i de tre områder A), B) og C) i figuren? Beskriv kort hvordan du ville bruge Ramachandran plots til at validere kvaliteten af en protein struktur Hvilke af følgende udsagn er rigtige: Beta-sheets dannes af lokale interaktioner Beta-sheets dannes af ikke-lokale interaktioner alpha-helices dannes af lokale interaktioner 4. alpha-helices dannes af ikke-lokale interaktioner 5. Et proteins kerne (core) er fyldt med ladede aminosyrer 7 of 7

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 af 1 Danmarks Tekniske Universitet Side 1 af 11 sider Skriftlig prøve, den 27/5-2010 Kursus navn: Kursus nr. 27611 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 16 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik Danmarks Tekniske Universitet Løsningsforslag til Øvelse i Immonologisk Bioinformatik Indledning De følgende sider giver en gennemgang af de øverlser i har lavet under jeres besøg på DTU, som en del af

Læs mere

Side 1 af 14. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 14. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side 1 af 14 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 13 Danmarks Tekniske Universitet Skriftlig prøve, den 22/2-2013 Kursus navn: Introduktion til SystemBiologi Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle opgaver. Kursusansvarlig

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 af 8 Danmarks Tekniske Universitet Side 1 af 8 sider Skriftlig prøve, den 29/5-2009 Kursus navn: Kursus nr. 27611 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved

Læs mere

Immunologisk bioinformatik

Immunologisk bioinformatik Immunologisk bioinformatik Øvelsesvejledning Introduktion til øvelsen Når man i dagligdagen taler om influenza, bliver virussen ofte forbundet med forbigående og ufarlig sygdom. Som regel har mennesker

Læs mere

Introduktion til de praktiske øvelser

Introduktion til de praktiske øvelser Introduktion til de praktiske øvelser Vi vil i dag fokusere på tre forskellige online software til SNP analyser snptree NDtree CSIphylogony Introduktion til SNP analyser http://cge.cbs.dtu.dk/services/all.php

Læs mere

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Isa Kirk Biotech Academy Institut for Systembiologi, Danmarks Tekniske Universitet 2. november 2010 1 Indhold 1 Introduktion

Læs mere

Genetiske afstande og afstandsmatricer

Genetiske afstande og afstandsmatricer Genetiske afstande og afstandsmatricer Denne vejledning indeholder en række små øvelser og opgaver der illustrerer, hvordan man ud fra genetiske sekvenser kan udregne en gennemsnitlig evolutionær afstand

Læs mere

Introduktion til de praktiske øvelser

Introduktion til de praktiske øvelser Introduktion til de praktiske øvelser Vi vil i dag fokusere på tre forskellige online so4ware 6l SNP analyser snptree NDtree CSIphylogony Introduktion til SNP analyser h@p://cge.cbs.dtu.dk/services/all.php

Læs mere

Databasesøgning med BLAST

Databasesøgning med BLAST Databasesøgning med BLAST Denne vejledning giver en introduktion til databasesøgning med forskellige programmer i BLAST-familien. Vejledningen indeholder først en grundig introduktion og gennemgang af

Læs mere

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Per Tøfting 23. september 2008 Speciale i softwarekonstruktion IT-Vest Aarhus Universitet Agenda Formål microrna Strategien

Læs mere

Version august 2012 Side 1 af 7

Version august 2012 Side 1 af 7 Side 1 af 7 Indholdsfortegnelse Indholdsfortegnelse... 2 7. Valgmuligheder ved skriftlige prøver... 3 8.Generelle regler vedrørende skriftlige prøver... 3 9. Specifikke regler vedrørende elektronisk aflevering

Læs mere

Skruedyrenes evolution

Skruedyrenes evolution Skruedyrenes evolution Materialer: 8 forskellige søm og skruer per hold. Formål: At tegne et slægtskabstræ udfra morfologiske karaktertræk Når arterne er blevet indsamlet og identificeret, skal de systematiseres.

Læs mere

Qbrick s krav til video filtyper

Qbrick s krav til video filtyper Indhold Qbrick s krav til video filtyper... 1 Krav til ordningen/området... 1 Qbrick s krav til video leverandør... 1 Video og billede størrelser i WCM:... 1 Upload en video... 2 Trin 1: Mediefiler...

Læs mere

Bioinformatik Open Source Software i biologiens tjeneste

Bioinformatik Open Source Software i biologiens tjeneste Bioinformatik Open Source Software i biologiens tjeneste Kenneth Geisshirt kneth@silex.dk Silex Science ApS Bioinformatik p.1/19 Om Silex Science ApS Grundlagt maj 2002 Ejeren er Cortex Holding Fokusområderne

Læs mere

Eksamen i Lineær Algebra

Eksamen i Lineær Algebra Eksamen i Lineær Algebra Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet & Det Sundhedsvidenskabelige Fakultet Tirsdag den 4 januar, 2 Kl 9-3 Nærværende eksamenssæt består af 8 nummererede

Læs mere

Reeksamen i Diskret Matematik

Reeksamen i Diskret Matematik Reeksamen i Diskret Matematik Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet Torsdag den 9. august, 202. Kl. 9-3. Nærværende eksamenssæt består af 9 nummererede sider med ialt 2 opgaver.

Læs mere

Eksamen i Lineær Algebra

Eksamen i Lineær Algebra Eksamen i Lineær Algebra Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet & Det Sundhedsvidenskabelige Fakultet Onsdag den. januar,. Kl. 9-3. Nærværende eksamenssæt består af 8 nummererede

Læs mere

(Prøve)eksamen i Lineær Algebra

(Prøve)eksamen i Lineær Algebra (Prøve)eksamen i Lineær Algebra Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet & Det Sundhedsvidenskabelige Fakultet Nærværende eksamenssæt bestaår af 9 nummererede sider med ialt 15 opgaver.

Læs mere

Fronter for elever - Første undervisning

Fronter for elever - Første undervisning Fronter for elever - Første undervisning Fronter for elever - Første undervisning 1 Kom godt i gang 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 1.10 1.11 0) Nulstille unilogin i UMS - (Elev) 4 1) Logge på Fronter

Læs mere

vejledning sådan ARBejdeR du i ebg s RAppoRTvæRKTøj

vejledning sådan ARBejdeR du i ebg s RAppoRTvæRKTøj vejledning sådan arbejder du i ebg s rapportværktøj Vejledning for 2013/2014 Sådan arbejder du i EBG's rapportværktøj www.business-games.dk Indholdsfortegnelse: Forord... 2 Login... 2 Rapportværktøjet...

Læs mere

Eksamen i Lineær Algebra

Eksamen i Lineær Algebra Eksamen i Lineær Algebra Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet & Det Sundhedsvidenskabelige Fakultet Tirsdag den 8 januar, Kl 9- Nærværende eksamenssæt består af 8 nummererede sider

Læs mere

Håndtering af lokale hjemmesider (pr )

Håndtering af lokale hjemmesider (pr ) Håndtering af lokale hjemmesider (pr. 21.12.2016) Forsiden Side 1 A. Skift øverste store foto Side 1 B. Kredsens / afdelingens navn i øverste foto Side 1 C. Kommende Åbne haver Side 2 D. Kommende Arrangementer

Læs mere

Immunologisk Bioinformatik

Immunologisk Bioinformatik Immunologisk Bioinformatik Et undervisningsmateriale til de danske gymnasier Af Isa Kristina Kirk Materialet er lavet af Isa Kristina Kirk for Biotech Academy ved Danmarks Tekniske Universitet, DTU, i

Læs mere

Brugsanvisning til SyreN ph Rapport.

Brugsanvisning til SyreN ph Rapport. Brugsanvisning til SyreN ph Rapport. For at installere SyreN ph Rapport, indsæt BioCover USB stik i computer. Nedenstående program forefindes på USB: Ved at klikke på SyreN ph Rapport mappen åbnes mappen

Læs mere

Eksamen forår og sommer 2015

Eksamen forår og sommer 2015 Eksamen forår og sommer 2015 Prøvestart og varighed En prøve er begyndt, når uddelingen af opgaverne er begyndt, eller når eksaminanden er blevet gjort bekendt forberedelsesmaterialet eller lignende. Særlige

Læs mere

SmartWeb Brugermanual

SmartWeb Brugermanual SmartWeb Brugermanual Table of Content Table of Content... 1 Best Practice SmartWeb:... 2 Implementering... 4 Egenskaber:... 5 Filer:... 7 Oprettelse af Kategori... 9 Sider og Tekster:... 11 Slideshow...

Læs mere

Det sprogpædagogiske kørekort 2012/2013. Modul 3: Lydfiler (basis)

Det sprogpædagogiske kørekort 2012/2013. Modul 3: Lydfiler (basis) Det sprogpædagogiske kørekort 2012/2013 Modul 3: Lydfiler (basis) Sabine Kramer Indholdsfortegnelse side Download Audacity og hjælpeprogrammet Lame (punkt 1-10) 3 Installér Audacity og Lame (punkt 11-14)..

Læs mere

Eksamen i Lineær Algebra

Eksamen i Lineær Algebra To find the English version of the exam, please read from the other end Eksamen i Lineær Algebra Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet & Det Sundhedsvidenskabelige Fakultet Onsdag

Læs mere

Brugermanual til Assignment hand in

Brugermanual til Assignment hand in Brugermanual til Assignment hand in Indhold: Undervisere:...2 Hvor finder jeg Assignment hand in?...2 Opret en opgave...4 Slet en opgave...5 Rediger en opgave...5 Hvor finder jeg de afleverede filer?...5

Læs mere

Prøveeksamen A i Lineær Algebra

Prøveeksamen A i Lineær Algebra Prøveeksamen A i Lineær Algebra Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet og Det Sundhedsvidenskabelige Fakultet Der må gøres brug af bøger, noter mv Der må ikke benyttes lommeregner,

Læs mere

ViKoSys. Virksomheds Kontakt System

ViKoSys. Virksomheds Kontakt System ViKoSys Virksomheds Kontakt System 1 Hvad er det? Virksomheds Kontakt System er udviklet som et hjælpeværkstøj til iværksættere og andre virksomheder som gerne vil have et værktøj hvor de kan finde og

Læs mere

Brugermanual til Assignment Hand In

Brugermanual til Assignment Hand In Brugermanual til Assignment Hand In Indhold: Undervisere:... 2 Hvor finder jeg Assignment hand in?... 2 Opret en opgave... 3 Slet en opgave... 4 Rediger en opgave... 4 Hvor finder jeg de afleverede filer?...

Læs mere

Eksamen forår og sommer 2014

Eksamen forår og sommer 2014 Eksamen forår og sommer 2014 Prøvestart og varighed En prøve er begyndt, når uddelingen af opgaverne er begyndt, eller når eksaminanden er blevet gjort bekendt forberedelsesmaterialet eller lignende. Særlige

Læs mere

Vejledning til. LearnSpace

Vejledning til. LearnSpace Vejledning til LearnSpace Version 13. 08. 2015 Indholdsfortegnelse Om LearnSpace... 2 Oprette et nyt kursus i egen afdeling... 3 Aktivere selvtilmelding til et kursus... 5 Tilmelde undervisere der må redigere

Læs mere

LinkGRC. Dokumenter. Brugermanual

LinkGRC. Dokumenter. Brugermanual Brugermanual 1 INDHOLD 1. Navigation 2. Dashboard 3. 4. Support 2 NAVIGATION 1 På forsiden finder du dine installerede moduler i LinkGRC løsningen og du kan her vælge hvilket modul du ønsker at arbejde

Læs mere

FSFIs lynguide til DFRs elektronisk bevissystem

FSFIs lynguide til DFRs elektronisk bevissystem FSFIs lynguide til DFRs elektronisk bevissystem Dette er en kort guide i anvendelsen af Dansk Førstehjælpsråd elektroniske bevissystem. Guiden viser og forklarer hvordan du som instruktør og medlem af

Læs mere

Eksamen i Lineær Algebra

Eksamen i Lineær Algebra To find the English version of the exam, please read from the other end Eksamen i Lineær Algebra Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet & Det Sundhedsvidenskabelige Fakultet Fredag

Læs mere

ExtraNet. Sider beskyttet med kodeord i OLO

ExtraNet. Sider beskyttet med kodeord i OLO ExtraNet Sider beskyttet med kodeord i OLO Side 1 af 16 For brugeren af din hjemmeside Fra forsiden kan du indsætte en knap, som henviser til en side, som kræver en kode. Side 2 af 16 Login er nødvendigt

Læs mere

Vejledning til opbygning af hjemmesider

Vejledning til opbygning af hjemmesider Side 1 af 9 Vejledning til opbygning af hjemmesider Hvis du er inde på din klubs hjemmeside, fx på forsiden, kan du nu gå i gang med at redigere. For at få redigeringsværktøjet frem, skal du klikke på

Læs mere

Manual til brug af youtube

Manual til brug af youtube Manual til brug af youtube For at kunne bruge din nye video på din hjemmeside, facebook med videre, skal du først uploade den til youtube. Vi gennem gennemgår hele processen her i fire nemme trin. 1. Sådan

Læs mere

FSFI s guide til DFR s elektronisk bevissystem

FSFI s guide til DFR s elektronisk bevissystem FSFI s guide til DFR s elektronisk bevissystem Dette er en kort guide i anvendelsen af Dansk Førstehjælpsråd elektroniske bevissystem. Guiden viser og forklarer, hvordan du som instruktør og medlem af

Læs mere

Google Apps. Lær at oprette, organisere, dele og slette dokumenter. Udarbejdet af PLC, version 2013!!!!!!! Side 1 af 9

Google Apps. Lær at oprette, organisere, dele og slette dokumenter. Udarbejdet af PLC, version 2013!!!!!!! Side 1 af 9 Lær at oprette, organisere, dele og slette dokumenter. Udarbejdet af PLC, version 2013!!!!!!! Side 1 af 9 Arbejde i faner Google Apps arbejder i faner, derfor er det vigtigt, du er bekendt med det. Mappen

Læs mere

BM121 Resume af tirsdags forlæsningen, Uge 47

BM121 Resume af tirsdags forlæsningen, Uge 47 BM121 Resume af tirsdags forlæsningen, Uge 47 Morten Källberg (kallberg@imada.sdu.dk) 22/11-2005 1 Probabilistiske modeller Vi vil i det følgende betragte to forskellige måder at evaluerer en given model

Læs mere

Studienummer: MeDIS Exam 2015. Husk at opgive studienummer ikke navn og cpr.nr. på alle ark, der skal medtages i bedømmelsen

Studienummer: MeDIS Exam 2015. Husk at opgive studienummer ikke navn og cpr.nr. på alle ark, der skal medtages i bedømmelsen MeDIS Exam 2015 Titel på kursus: Uddannelse: Semester: Videregående biokemi og medicinudvikling Bachelor i Medis 5. semester Eksamensdato: 26-01-2015 Tid: kl. 09.00-11.00 Bedømmelsesform 7-trin Vigtige

Læs mere

Sommereksamen 2012 Med korte, vejledende svar

Sommereksamen 2012 Med korte, vejledende svar 1 Sommereksamen 2012 Med korte, vejledende svar Titel på kursus: Uddannelse: Semester: ksamensdato: Tid: Bedømmelsesform Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin

Læs mere

Netprøver.dk. Brugervejledning for elever

Netprøver.dk. Brugervejledning for elever Netprøver.dk Brugervejledning for elever 25. oktober 2017 Indhold 1 Dine forberedelser i Netprøver.dk før prøvedagen... 3 1.1 Sådan tjekker du dit it udstyr... 3 1.2 Sådan logger du på Netprøver.dk...

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet DTU. Kursus 02511. Forside + 25 sider. 30. Maj 2011. 1 Danmarks Tekniske Universitet Skriftlig prøve, den 30. maj 2011 Kursus navn: Indledende Medicinsk Billedanalyse Kursusnr: 02511 Varighed: 4 timer

Læs mere

Reeksamen i Diskret Matematik

Reeksamen i Diskret Matematik Reeksamen i Diskret Matematik Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet 21. august 2015 Nærværende eksamenssæt består af 10 nummererede sider med ialt 17 opgaver. Tilladte hjælpemidler:

Læs mere

VELKOMMEN 3. KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9

VELKOMMEN 3. KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9 VEJLEDNING 1.0 Indhold VELKOMMEN 3 KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9 SÅDAN OPRETTER DU EN QUIZ 10 Quiz info 11 Tilføj spørgsmål 12 Tilføj formel til

Læs mere

Modul 8: Clouds (Lagring af filer)

Modul 8: Clouds (Lagring af filer) Det sprogpædagogiske kørekort 2012/2013 Modul 8: Clouds (Lagring af filer) Del II Sabine Kramer Indholdsfortegnelse side Opret en Google konto (punkt 1-4).. 3 Upload filer fra computeren til Google docs

Læs mere

Kom godt i gang med OneDrive

Kom godt i gang med OneDrive Kom godt i gang med OneDrive Office365 er en mulighed for lærere og elever at bruge en office-pakke på egne enheder - man kan downloade det til brug på pc - mac - tablets og smartphones, i alt op til 5

Læs mere

Brug af IT-udstyr ved skriftlig eksamen

Brug af IT-udstyr ved skriftlig eksamen Brug af IT-udstyr ved skriftlig eksamen Ved brug af skolens IT-udstyr til skriftlig eksamen skal du: Medbringe dit UNI-login Oprette sidehoved/-fod til dine dokumenter (skolen har en færdig skabelon, som

Læs mere

Vejledning til brug af Y s Men s klubintranet administrator guide

Vejledning til brug af Y s Men s klubintranet administrator guide Vejledning til brug af Y s Men s klubintranet administrator guide Systemet tilbyder klubberne i Y s Men Danmark at have et sted hvor de kan dele filer f.eks. Word, pdf, billeder mv. mellem de medlemmer

Læs mere

Retningslinjer for studerende som skal til skriftlig eksamen på Samfundsvidenskab

Retningslinjer for studerende som skal til skriftlig eksamen på Samfundsvidenskab Retningslinjer for studerende som skal til skriftlig eksamen på Samfundsvidenskab September 2013 Bemærk at denne vejledning er et tillæg til SDU s regelsæt for brug af computer ved skriftlige stedprøver.

Læs mere

Versionsbrev. LUDUS Web version 2.28.0. Den 8. august 2012. J.nr. 4004-V1046-12

Versionsbrev. LUDUS Web version 2.28.0. Den 8. august 2012. J.nr. 4004-V1046-12 Versionsbrev LUDUS Web version 2.28.0 Den 8. august 2012 J.nr. 4004-V1046-12 CSC Scandihealth A/S, P.O. Pedersens Vej 2, DK-8200 Århus N Tlf. +45 3614 4000, fax +45 3614 7324, www.csc.com/ludus, sc-ludus@csc.com

Læs mere

Vejledning På bordene ligger omslag til din besvarelse, med dit navn på. Sæt dig ved bordet med dit omslag.

Vejledning På bordene ligger omslag til din besvarelse, med dit navn på. Sæt dig ved bordet med dit omslag. Vejledning 2017 Eksamen Indhold: 1. Ved prøvens begyndelse 2. Under prøven 3. Aflevering af din besvarelse 4. Regler for eksamen generelt 5. Brug af computer 6. Brug af ordbøger 7. Udeblivelse og snyd

Læs mere

DTU M.SC. SKRIFTLIG EKSAMEN Reviderede Spørgsmål

DTU M.SC. SKRIFTLIG EKSAMEN Reviderede Spørgsmål Skriftlig prøve, 9. januar 1997. Kursus navn : 04250 - Indledende billedbehandling. Tilladte hjælpemidler : Alle sædvanling. "Vægtning" : Alle opgaver vægtes ligeligt. Navn :.................................................

Læs mere

5. OPSÆTNING DOKUMENTSKABELONER 5.1 TRIN

5. OPSÆTNING DOKUMENTSKABELONER 5.1 TRIN 5. OPSÆTNING DOKUMENTSKABELONER Under fanen Dok. skabeloner kan du arbejde med de skabeloner som du har i systemet, eller du kan oprette nye. I denne vejledning kigger vi på hvordan du kan tilrette selve

Læs mere

Velkommen Immunologisk Bioinformatik

Velkommen Immunologisk Bioinformatik Velkommen Immunologisk Bioinformatik EduForce undervisere: Hvem er vi? 2 DTU Systembiologi, Danmarks Tekniske Universitet Hvem er I? 3 DTU Systembiologi, Danmarks Tekniske Universitet Dagens Program Kl.

Læs mere

Sådan tager du grundkurset i hjv.dk

Sådan tager du grundkurset i hjv.dk Sådan tager du grundkurset i hjv.dk Hjemmeværnskompagni Jyske Ås 30. april 2015 1 Kom i gang med Forsvarets Elektroniske Skole (FELS) Alle medlemmer i HJV skal tage et grundkursus i at bruge hjv.dk. Dette

Læs mere

Digital Eksamen Når du er logget ind i Digital Eksamen, bliver du mødt med en oversigt som vist nedenfor:

Digital Eksamen Når du er logget ind i Digital Eksamen, bliver du mødt med en oversigt som vist nedenfor: Bedømmerguide til Digital Eksamen Indhold Bedømmerguide til Digital Eksamen... 1 Oversigten... 1 Prøven... 2 Download og upload af besvarelserne... 4 Annoteringsværktøjet... 6 Noter og feedback... 8 Oversigten

Læs mere

EVALUERING I SURVEYXACT TRIN FOR TRIN

EVALUERING I SURVEYXACT TRIN FOR TRIN EVALUERING I SURVEYXACT TRIN FOR TRIN LÆR AT TACKLE 2015 KOMITEEN FOR SUNDHEDSOPLYSNING 1 INDLEDNING Komiteen for Sundhedsoplysning stiller SurveyXact et internetbaseret redskab til kvalitetssikring til

Læs mere

Quick Guide til Visit Gæstesystem i Backend.

Quick Guide til Visit Gæstesystem i Backend. Quick Guide til Visit Gæstesystem i Backend. Version: 2.1.7 Licens informations Her kan man se licens periode & info på funktioner, samt firma information. Upload logo Her har man mulighed for at oploade

Læs mere

Forårseksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering

Forårseksamen Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 1 Forårseksamen 2015 Titel på kursus: Uddannelse: Semester: Det hæmatologiske system og immunsystemet Bacheloruddannelsen i Medicin/Medicin med industriel specialisering 2. semester Eksamensdato: 10. april

Læs mere

EVALUERING I SURVEYXACT TRIN FOR TRIN

EVALUERING I SURVEYXACT TRIN FOR TRIN EVALUERING I SURVEYXACT TRIN FOR TRIN LÆR AT TACKLE 2015 KOMITEEN FOR SUNDHEDSOPLYSNING 1 INDLEDNING Komiteen for Sundhedsoplysning stiller SurveyXact et internetbaseret redskab til kvalitetssikring til

Læs mere

DATALOGISK INSTITUT, AARHUS UNIVERSITET. Det Naturvidenskabelige Fakultet EKSAMEN. Grundkurser i Datalogi

DATALOGISK INSTITUT, AARHUS UNIVERSITET. Det Naturvidenskabelige Fakultet EKSAMEN. Grundkurser i Datalogi DATALOGISK INSTITUT, AARHUS UNIVERSITET Det Naturvidenskabelige Fakultet EKSAMEN Grundkurser i Datalogi Antal sider i opgavesættet (incl. forsiden): 1 (tretten) Eksamensdag: Tirsdag den 8. april 2008,

Læs mere

(Prøve)Eksamen i Calculus

(Prøve)Eksamen i Calculus (Prøve)Eksamen i Calculus Sæt 1, april 2011 Første Studieår ved Det Teknisk-Naturvidenskabelige Fakultet og Det Sundhedsvidenskabelige Fakultet Nærværende (prøve)eksamenssæt består af 7 nummererede sider

Læs mere

OPBYGNING AF INSTRUMENTER. Online Designeren Record ID Felttyper Validering og variabelnavne

OPBYGNING AF INSTRUMENTER. Online Designeren Record ID Felttyper Validering og variabelnavne OPBYGNING AF INSTRUMENTER Online Designeren Record ID Felttyper Validering og variabelnavne Online Designer Online designeren er det primære værktøj til at opbygge skemaet til dataindsamling. I REDCap

Læs mere

Integration med Microsoft SharePoint

Integration med Microsoft SharePoint Integration med Microsoft SharePoint Kom godt i gang med opsætning af integrationen Integration med SharePoint Kom godt fra start I TimeLog Project er der mulighed for at integrere til Microsoft SharePoint,

Læs mere

Herunder er vist en afstandsmatrice for fem pattedyr: Ulv (U), moskusokse (M), kænguru (K), isbjørn (I) og vildsvin (V).

Herunder er vist en afstandsmatrice for fem pattedyr: Ulv (U), moskusokse (M), kænguru (K), isbjørn (I) og vildsvin (V). Fylogenetiske træer Dette dokument indeholder først et eksempel på hvordan man kan bruge UPGMA-metoden til at danne fylogenetiske træer ud fra en afstandsmatrice, og derefter en række øvelser der illustrerer

Læs mere

BørneIntra hjemmesidekursus

BørneIntra hjemmesidekursus BørneIntra hjemmesidekursus hjemmesidekursus Januar 2012 Indhold 1 Introduktion... 5 1.1 Kursets formål... 5 1.2 Hjemmesiden opbygges i PersonaleIntra... 5 2 Hjemmesidens indhold... 6 2.1 Hjemmesidens

Læs mere

BIOLOGI A-NIVEAU NY ORDNING. Tirsdag den 19. august 2008. Kl. 09.00 14.00 STX082-BIA STUDENTEREKSAMEN AUGUST 2008

BIOLOGI A-NIVEAU NY ORDNING. Tirsdag den 19. august 2008. Kl. 09.00 14.00 STX082-BIA STUDENTEREKSAMEN AUGUST 2008 STUDENTEREKSAMEN AUGUST 2008 BIOLOGI A-NIVEAU Tirsdag den 19. august 2008 NY ORDNING Kl. 09.00 14.00 Af opgaverne 1, 2, 3 og 4 skal tre og kun tre af opgaverne besvares STX082-BIA Undervisningsministeriet

Læs mere

Rapport generator til Microsoft C5

Rapport generator til Microsoft C5 Generelt Rapportgeneratoren til C5 kan benyttes sammen med alle versioner af C5 og kræver INGEN tillægsmoduler eller tilkøb af C5. Den kører på: C5 version 1.5x, 1.6x, 2.x, 3.x, 4.x, 2008, 2010 og 2012.

Læs mere

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer)

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer) Elevvejledning til det Virtuelle Kræftlaboratorium Det Virtuelle Kræftlaboratorium stiller krav til en grundig forståelse af det centrale dogme inden for molekylærbiologien, hvordan DNA oversættes til

Læs mere

SDBF QUICKGUIDE SKOLERNES DIGITALE BLANKET FLOW - BRUGER-GUIDE -

SDBF QUICKGUIDE SKOLERNES DIGITALE BLANKET FLOW - BRUGER-GUIDE - SDBF QUICKGUIDE SKOLERNES DIGITALE BLANKET FLOW - BRUGER-GUIDE - INTRODUKTION TIL SKOLERNES DIGITALE BLANKET FLOW Vi er glade for at kunne byde velkommen til opdateret udgave af KEAs nye, automatiske blanket-system.

Læs mere

MANUAL - Joomla! Version 1

MANUAL - Joomla! Version 1 MANUAL - Joomla! Version 1 Indhold Retningslinjer for hjemmesiden... 3 Log ind... 3 Ret i en artikel, der allerede er oprettet... 4 Opret ny artikel... 8 a) Skriv direkte i tekstfelt... 9 b) Indsæt tekst

Læs mere

Når du har logget dig ind, ser du Randers Kommunes byvåben midt på siden. I venstre side er der en række mapper:

Når du har logget dig ind, ser du Randers Kommunes byvåben midt på siden. I venstre side er der en række mapper: DXP vejledning Generelt: DXP er et værktøj til at fremstille præsentationsmaterialer (foldere, brochurer, løbesedler mv.) DXP egner sig kun til mindre brochurer og lign., da den største skabelon kan rumme

Læs mere

DNA analyse af mulige odderekskrementer

DNA analyse af mulige odderekskrementer DNA analyse af mulige odderekskrementer indsamlet på Sjælland Notat fra DCE - Nationalt Center for Miljø og Energi Dato: 7. august 2017 Liselotte Wesley Andersen & Bjarne Søgaard Institut for Bioscience

Læs mere

DI Online løsning: Quick guide til oprettelse af oprindelsescertifikater

DI Online løsning: Quick guide til oprettelse af oprindelsescertifikater DI Online løsning: Quick guide til oprettelse af oprindelsescertifikater Dette dokument er en introduktion til Dansk Industris online løsning til oprettelse og bestilling af oprindelsescertifikater. Dokumentet

Læs mere

DATALOGISK INSTITUT, AARHUS UNIVERSITET

DATALOGISK INSTITUT, AARHUS UNIVERSITET DATALOGISK INSTITUT, AARHUS UNIVERSITET Det Naturvidenskabelige Fakultet EKSAMEN Grundkurser i Datalogi Antal sider i opgavesættet (incl. forsiden): 6 (seks) Eksamensdag: Fredag den 25. juni 200, kl. 9.00-.00

Læs mere

KOMBIT Byg og Miljø FAQ. Byg og Miljø. Version 1.1 24. januar 2014 BHE

KOMBIT Byg og Miljø FAQ. Byg og Miljø. Version 1.1 24. januar 2014 BHE KOMBIT Byg og Miljø FAQ Byg og Miljø Version 1.1 24. januar 2014 BHE Indhold Login og rettigheder... 3 Aktiviteter, sager, projekter... 4 Regler... 5 Proces... 6 Kommunikation... 7 Filer... 8 Integration

Læs mere

MANUAL - Joomla! Version 1

MANUAL - Joomla! Version 1 MANUAL - Joomla! Version 1 Indhold Retningslinjer for hjemmesiden... 2 Log ind... 2 Ret i en artikel, der allerede er oprettet... 3 Opret ny artikel... 6 a) Skriv direkte i tekstfelt... 7 b) Indsæt tekst

Læs mere

Information til studerende som skal til skriftlig eksamen på Samfundsvidenskab

Information til studerende som skal til skriftlig eksamen på Samfundsvidenskab Information til studerende som skal til skriftlig eksamen på Samfundsvidenskab Bemærk at disse retningslinjer er et tillæg til SDU s regelsæt for brug af computer ved skriftlige stedprøver Når du tilmelder

Læs mere

Velkommen. Test dit eget DNA med PCR. Undervisningsdag på DTU Systembiologi. Undervisere: Sebastian, Louise og Ana

Velkommen. Test dit eget DNA med PCR. Undervisningsdag på DTU Systembiologi. Undervisere: Sebastian, Louise og Ana Velkommen Test dit eget DNA med PCR Undervisningsdag på DTU Systembiologi Undervisere: Sebastian, Louise og Ana Hvem er I? 2 DTU Systembiologi, Danmarks Tekniske Universitet Dagens program 9:00 10:00 Introduktion

Læs mere

GRAFISK WORKFLOW. 1 Grafisk workflow

GRAFISK WORKFLOW. 1 Grafisk workflow GRAFISK WORKFLOW 1 Opgavebeskrivelse I forbindelse med et nyt online koncept Web in a box skulle jeg lave en Photoshop-skabelon, der kan eksportere materiale til en hjemmeside automatisk. Selve konceptet

Læs mere

Vejledning 2015. På bordene ligger omslag til din besvarelse, med dit navn på. Sæt dig ved bordet med dit omslag.

Vejledning 2015. På bordene ligger omslag til din besvarelse, med dit navn på. Sæt dig ved bordet med dit omslag. Vejledning 2015 Eksamen Indhold: 1. Ved prøvens begyndelse 2. Under prøven 3. Aflevering af din besvarelse 4. Regler for eksamen generelt 5. Brug af computer 6. Brug af ordbøger 7. Udeblivelse og snyd

Læs mere

Opret CFU-kursusevaluering i Survey Xact

Opret CFU-kursusevaluering i Survey Xact Printvenlig side for Forsidetekst Opret CFU-kursusevaluering i Survey Xact www.survey-xact.dk Oprettelsen af en kursusevaluering består af flg. trin: 1. Oprettelse af spørgeskema ud fra en skabelon 2.

Læs mere

Danhost Webshop. Bliv fundet på Google

Danhost Webshop. Bliv fundet på Google Danhost Webshop Bliv fundet på Google SEO - Søgemaskineoptimering Når du arbejder med SEO, er det med henblik på, at din hjemmeside eller webshop skal dukke op i søgeresultaterne på f.eks. Google når en

Læs mere

Sådan opretter du en elektronisk aflevering

Sådan opretter du en elektronisk aflevering Sådan arbejder du med opgaver i Gradebook/karakterbog Denne vejledning indeholder en detaljeret beskrivelse af hvordan du bruger gradebook/karakterbogen når du vil arbejde med opgaver og give karakterer

Læs mere

Nedenstående oversigt viser elementerne i den meddelelse, der skal overføres fra fødeafdeling til kirkekontor/sogn.

Nedenstående oversigt viser elementerne i den meddelelse, der skal overføres fra fødeafdeling til kirkekontor/sogn. Teknisk oversigt over elementer i fødselsanmeldelsen Nedenstående oversigt viser elementerne i den meddelelse, der skal overføres fra fødeafdeling til kirkekontor/sogn. Der anvendes XML. Denne version

Læs mere

Lav din egen forside i webtrees

Lav din egen forside i webtrees Lav din egen forside i webtrees Du behøver ikke at kunne kode eller gøre noget advanceret for at designe din helt egen forside i webtrees. Alt du skal gøre er bare at gøre brug af den indbygget editor.

Læs mere