Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Størrelse: px
Starte visningen fra side:

Download "Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13"


1 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan (Navn: Eksamen_ pdf) Kursus-hjemmeside: Eksamenssættet består af 6 hoved-emner 1 6 og til hvert emne er der en række spørgsmål som du skal svare på. Ialt er der 13 sider, hvoraf de to sidste er Appendix 1 og 2. Spørgsmålene du skal svare på står med kursiv Hvis du ikke har tilstrækkelig plads på disse sider så svar på et andet stykke papir, men husk at gengive hvilket spørgsmål du svarer på ved at skrive 1b hvis du svarer på spørgsmål b i opgave 1. Læs opgaverne omhyggeligt inden du begynder. Emner (bedømmelses-vægt i procent) Opgave 1: DNA og RNA (15%) Opgave 2: Aminosyrer (20%) Opgave 3: Uniprot (20%) Opgave 4: Sekvens alignment (20 %) Opgave5:SNP SingleNucleotidepolymorphism(15%) Opgave6:PDB 3D strukturoghomologimodellering(10%) Vi vil logge jeres internet under denne eksamen og alt kommunikation med andre personer via mail, tlf og lignende er diskvalificerende.

2 Side2af13 Opgave 1: DNA og RNA (15%) a) Hvad kaldes den proces, hvor DNA oversættes til messenger RNA (DNA -> mrna)? b) Hvad kaldes den proces, hvor messenger RNA oversættes til protein (mrna -> protein)? c) Hvad er 1-bogstavs koderne for kerne-baserne (nukleotiderne) i DNA? d) Hvilke af disse kerne-baser danner hydrogen-bindinger til hinanden (kaldet base parring på engelsk)? Herunder er et stykke genomisk DNA (+ string) kaldet gene1 med læseretning fra venstre mod højre gene1: TTGATTGCAA e) Er den korrekt læseretningen for DNA fra 3 mod 5 enden eller omvendt dvs fra 5 mod 3 enden? f) Der fines 3 stop codons: TAA, TAG og TGA. Benyt sekvensen herunder (genea) til at finde alle stop-codons i alle læserammer. Sekvensen er angivet for + stringen, med læseretning fra venstre mod højre. Skriv læseramme efterfulgt af mulige stopcodons. genea: TTGATTTCAA

3 Side3af13 Opgave 2: Aminosyrer (20%) a) Hvor mange naturligt forekommende aminosyrer findes der? b) En enkelt aminosyre har ikke et chiralt C-alpha atom. Hvad er 1 og 3-bogstavs koderne for denne? Skriv 1 og 3-bogstav koder for aminosyrerne som tilhører de grupper som er listet herunder i spørgsmål c), d) og e) c) Basiske: d) Sure: e) Aromatiske: f) Skriv herunder en korrekt sekvens i FASTA format, med navnet MIN_SEKVENS. Dette korte peptid skal bestå af 5 forskellige aminosyrer som er polære eller hydrophobe benyt 1-bogstavs koder. g) Tegn et di-peptid, hvor du indikerer sidekæden med R. Skriv også navn på de 4 backbone atomer.

4 Side4af13 Opgave 3: Uniprot (20%) Benyt Advanced Search i Uniprot databasen til at lede efter lysozyme hits for organismen Gallus gallus (Chicken). a) Hvor mange reviewed (dvs UniProtKB/Swiss Prot) hits finder du for lysozyme for organismen Chicken, hvor lysozyme er en del af protein navnet (protein name). skriv antal hits du ender op med til sidst og evt antal hits (søgeresultater) du får undervejs? b) Angiv Accession nummer for et af den/de hits du fandt spørgsmål 3a og skriv, med 1-bogstavs kode og position, de aminosyrer som er del af det aktive site i dette protein? c) Det protein du beskrev i spørgsmål 3b, vil det virke indenfor eller udenfor den celle hvor det bliver lavet. Angiv længden af det modne (English: mature) protein, samt hvor det befinder sig (dvs indenfor eller udenfor cellen). Begrund dine svar. d) For proteinet med accession number P00698( 0 eretnulogikkeetbogstav)er derangivetsekundærstruktureniuniprot.kanduudfradenneangivehvilkenaf de5fold klasser(a,b,c,dellere)proteinettilhører? a. All alpha b. All beta c. Alpha+beta d. Alpha/beta e. Fåelleringensekundærstrukturelementer

5 Side5af13 4: Sekvens alignment (20 %) Man har søgt med en protein sekvens mod en stor database af sekvenser vha Blast (i protein mode blastp ) og får 4 forskellige alignments tilbage. Resultaterne fra disse 4 alignments beskrives herunder som Hit 1-4. Normalt benyttes e-værdier (også kaldet e-values eller Expection values) til at udvælge det bedste hit. a) Skriv de 4 hits i en ordnet liste under hinanden, således at det bedste hit står øverst og dårligste hit står nederst. Skriv også hvilke hits du vil betragte som signifikante og hvorfor. Hit 1: e-value = 4e-22 Hit 2: e-value= 0 Hit 3: e-value= 3.2 Hit 4: e-value = 0.01

6 Side6af13 To protein sekvenser kan alignes såfremt man har en substitutions-matrix og et mål for hvad det koster at lave gaps. Herunder er et alignment, hvor Query er en betegnelse for den sekvens man har søgt med, mens Sbjct repræsenterer et hit fundet i en sekvens-database. Affine gap-scores Når man laver et alignment kan man benytte sig af en simple procedure, hvor alle gaps koster det same eller man kan benytte en procedure med affine gap-scores, som er den måde Blast benytter. Når man anvender affine gap-scores, koster det en pris for at åbne et gap (gap-opening) og en anden pris for de næste gaps (gap-next). Gap-opening er altså den pris det koster i en situation hvor man indsætter et gap i et alignment og positionen lige før er ikke et gap. Gap-next er den pris det koster i den situation hvor man indsætter et gap i et alignment og positionen lige før er også et gap. Her skal vi benytte denne procedure med affine gap-scores. Gap-opening score: -11 Gap-next score: -1 b) Hvad er alignment scoren for det hypotetiske alignment som er vist. Benyt Blosum62 matrix i Appendix 1 og proceduren som beskrevet ovenfor i Affine gapscores. Husk at skrive mellem-regninger, ikke kun et tal. pos: 8 15 Query: P R - - Q C K S S Sbjct: P R R E R C R Q T S Pos: 3 12 c)derfindesoverordnettoforskelligetyperafalignments.hvadkaldesdentype alignmentsomervistispørgsmål4b?

7 Side7af13 d) Herunderer2kortepeptiderSeq1ogSeq2. Seq1:RDVNT Seq2:KIQS Dissesekvenserskalalignesvhaendynamiskalignmentalgoritme,hvoralle gapshverisærkoster2point(dvsenscorepå 2),menssubstitutions scoren fåsudfradenblosum62matrixderfindesiappendix1.duselvbestemme hvilkenafde2hoved alignmenttyperduvælger,menskrivditvalg herunder. d1)jegvælgeralignmenttype: Udfyldherefteralignment matrixpånæstesidehvordetopeptideralignes.

8 Side8af13 Alignmentmatrix K I Q S R 2 D 4 V 6 N 8 T 10 d2)skrivedetfærdigealignmentherundersamtalignment scoren:

9 Side9af13 5:SNP SingleNucleotidepolymorphism(15%) Herundersessekvensenfordenkodenderegionafetkortgenmedenlængdepå 51bp.Læseretningenerfravenstremodhøjre.Derfindes2SNP sindenfordette område,snp1(g/t)påposition6ogsnp2(t/a)påposition15.rna translation tabelleniappendix2kanbenyttestilnogleafspørgsmålene. SNP1SNP2 ATGCAGCCTATGTGTAACGTGGTCACCCTGATCCGATCGTATGTTTTATTT a) Hvaderforskellenpåensynonym(Eng:synonomous)SNPogenikkesynonym (Eng:non synonomous)snp? b) VilSNP1havenogenindflydelse/ændrepådetproteinproduktsomlavesog hvorlangtbliverproteinsekvensen(begrundditsvar)? c) VilSNP2havenogenindflydelsepådetproteinproduktsomlavesoghvorlangt bliverproteinsekvensen(begrundditsvar)?

10 Side10af13 6:PDB 3D strukturoghomologimodellering(10%) a) Deforskelligelagafinformationforetproteinbeskrivesoftenmed4ord: primær,sekundær,tertiærogkvaternærstruktur. Beskrivkortbetydningenafdisseord Duskaltilatbyggeenhomologimodelafetprotein.Vedhjælpafen sekvenssøgningipdbhardufundetseksstrukturertilformålet.strukturernes kvalitetsparametreogalignment scorererangivetnedenforitabel1(side11): b)forklarudfraparametreneitabel1(side11),hvilkenstruktur(enellerflere) dervilværebedstatbaseredinmodelpå.begrundditvalg.

11 Side11af13 c)forklarudfraparametreneitabel1(side11),hvilketrestrukturer,dervilvære dedårligstevalg.begrundditvalg. Tabel1 Struktur A B C D E F E værdi(eng.evalues) 1,0E 09 1,0E 02 1,0E 10 1,0E 12 1,0E 11 1,0E 10 Sekvens id(%) Metode* X X X X N N Opløsningsevne 2,3 1,4 2,4 4,0 n/a n/a Resolution(Å) R værdi 0,22 0,16 0,24 0,30 n/a n/a R free ,20 0,27 0,35 n/a n/a RMSD** n/a n/a n/a n/a 0,3 0,4 Ramachandran statistik(% outliers) 3,0 1,0 2,0 5,0 5,0 2,5 *X=x ray/røntgenkrystallografi,n=nmr,**forensemblet

12 Side12af13 Appendix1 Blosum62matrix

13 Side13af13 Appendix2 RNAtranslationtable

Side 1 af 14. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 14. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side 1 af 14 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 16 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 14 Danmarks Tekniske Universitet Skriftlig prøve, den 26/1-2012 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

27611 Eksamen Sommer 2008

27611 Eksamen Sommer 2008 27611 Eksamen Sommer 2008 Dette sæt indeholder 10 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan under selve eksamen ( juni 2008 klokken 15:00-19:00). DNA/Protein

Læs mere

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Immunologisk Bioinformatik

Immunologisk Bioinformatik Immunologisk Bioinformatik Et undervisningsmateriale til de danske gymnasier Af Isa Kristina Kirk Materialet er lavet af Isa Kristina Kirk for Biotech Academy ved Danmarks Tekniske Universitet, DTU, i

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 af 1 Danmarks Tekniske Universitet Side 1 af 11 sider Skriftlig prøve, den 27/5-2010 Kursus navn: Kursus nr. 27611 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved

Læs mere

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer)

at du trænes i at genkende aminosyrer i en simpel proteinstruktur (pentapeptid = lille protein bestående af 5 (penta) aminosyrer) Elevvejledning til det Virtuelle Kræftlaboratorium Det Virtuelle Kræftlaboratorium stiller krav til en grundig forståelse af det centrale dogme inden for molekylærbiologien, hvordan DNA oversættes til

Læs mere

Databasesøgning med BLAST

Databasesøgning med BLAST Databasesøgning med BLAST Denne vejledning giver en introduktion til databasesøgning med forskellige programmer i BLAST-familien. Vejledningen indeholder først en grundig introduktion og gennemgang af

Læs mere

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik

Danmarks Tekniske Universitet. Løsningsforslag til Øvelse i Immonologisk Bioinformatik Danmarks Tekniske Universitet Løsningsforslag til Øvelse i Immonologisk Bioinformatik Indledning De følgende sider giver en gennemgang af de øverlser i har lavet under jeres besøg på DTU, som en del af

Læs mere

Immunologisk bioinformatik

Immunologisk bioinformatik Immunologisk bioinformatik Øvelsesvejledning Introduktion til øvelsen Når man i dagligdagen taler om influenza, bliver virussen ofte forbundet med forbigående og ufarlig sygdom. Som regel har mennesker

Læs mere

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et:

En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: F2011-Opgave 1. En forsker har lavet et cdna insert vha PCR og har anvendt det følgende primer sæt, som producerer hele den åbne læseramme af cdna et: Forward primer: 5 CC ATG GGT ATG AAG CTT TGC AGC CTT

Læs mere

Bioinformatik Open Source Software i biologiens tjeneste

Bioinformatik Open Source Software i biologiens tjeneste Bioinformatik Open Source Software i biologiens tjeneste Kenneth Geisshirt Silex Science ApS Bioinformatik p.1/19 Om Silex Science ApS Grundlagt maj 2002 Ejeren er Cortex Holding Fokusområderne

Læs mere

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier

Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Immunologisk bioinformatik - et undervisningsprojekt til de danske gymnasier Isa Kirk Biotech Academy Institut for Systembiologi, Danmarks Tekniske Universitet 2. november 2010 1 Indhold 1 Introduktion

Læs mere

Søgevejledning til Cinahl Plus with Full Text (Ebsco) Bibliotekerne i Professionshøjskolen Metropol. Søgevejledning til CINAHL Plus with Full Text

Søgevejledning til Cinahl Plus with Full Text (Ebsco) Bibliotekerne i Professionshøjskolen Metropol. Søgevejledning til CINAHL Plus with Full Text Søgevejledning til CINAHL Plus with Full Text Revideret af: Vibeke Witt, Professionshøjskolen Metropol, August 2013 1 Indholdsfortegnelse Databasens indhold... 3 Adgang til Cinahl... 3 Søgning i Cinahl

Læs mere

I denne manual kan du finde en hurtig introduktion til hvordan du:

I denne manual kan du finde en hurtig introduktion til hvordan du: VORES NORDSJÆLLAND HURTIGT I GANG MANUAL 01: Bruger HVAD INDEHOLDER DENNE MANUAL? I denne manual kan du finde en hurtig introduktion til hvordan du: 1. Finder Vores Nordsjælland hjemmesiden 2. Opretter

Læs mere

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste 1 Forside Tre sideopsætninger: 1 Forside 2 Standard 3 Liste 2 Underside 3 Liste Ret indhold på en side I systemet kan du let rette tekst, link og billeder på hjemmesiden Først skal du logge ind i systemet

Læs mere Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Indholdsfortegnelse 1 Indledning... 3 1.1 Anbefalinger... 4 1.2 Datahjælp... 4 1.3 Brugerindstillinger... 5 2 Generel funktionalitet... 6 2.1

Læs mere

Opgaver. Notater. Opgave 1: Find kursus hjemmeside og bladre lidt rundt på siderne.

Opgaver. Notater. Opgave 1: Find kursus hjemmeside og bladre lidt rundt på siderne. Opgaver Opgaverne er stillet i henhold til medleverede brugervejledning, og som er en facitliste for opgaverne. Brug den undervejs til at løse opgaverne med, og kom med de punkter som den måtte mangle,

Læs mere

Hvorfor er genfinding et vanskeligt problem?

Hvorfor er genfinding et vanskeligt problem? 19th January 2005 Genfinding og skjulte Markov-modeller Af Asger Hobolth og Leif Schauser Indledning I disse år kortlægges en række organismers arvelige materiale. Det humane om blev kortlagt i 2001, og

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 af 8 Danmarks Tekniske Universitet Side 1 af 8 sider Skriftlig prøve, den 29/5-2009 Kursus navn: Kursus nr. 27611 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved

Læs mere

Søgevejledning til SocINDEX with Full Text - 1

Søgevejledning til SocINDEX with Full Text - 1 Søgevejledning til SocINDEX with Full Text Søgevejledning til SocINDEX with Full Text Indholdsfortegnelse Søgning i SocINDEX Advanced Search Felter der afgrænser søgningen Søgehistorie Kombinatorisk søgning

Læs mere

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle BIOINFORMATIK Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle indhold DNA 2 Hvilke databaser skal man vælge? 2 Søgning på en nukleotidsekvens 2 Proteiner 4 Søgning på

Læs mere

Indledning. På de følgende sider vises, primært i tegneserieform, lidt om mulighederne i PC-AXIS for Windows.

Indledning. På de følgende sider vises, primært i tegneserieform, lidt om mulighederne i PC-AXIS for Windows. Indledning PC-AXIS for Windows er et talbehandlingsprogram, der kan håndtere store mængder statistisk materiale. PC-AXIS giver mulighed for at arbejde videre med det statistiske materiale i egne programmer

Læs mere

Indholdsfortegnelse. Indledning System krav side 1

Indholdsfortegnelse. Indledning System krav side 1 Indholdsfortegnelse Indledning System krav side 1 Brugerflade Hovedvindue side 2 Sprog side 2 Funktionsknapper side 2 Programmér kort side 3 Rapport side 4 Program menu Comport, login side 5 Rev.1.1 2014

Læs mere

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse

Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Identifikation af potentielle microrna gener ved hjælp af komparativ genomanalyse Per Tøfting 23. september 2008 Speciale i softwarekonstruktion IT-Vest Aarhus Universitet Agenda Formål microrna Strategien

Læs mere


TILBAGE TIL DANSK AGAPORNIS KLUB TILBAGE TIL DANSK AGAPORNIS KLUB Bemærk! Klubben har ikke noget med testene at gøre og Dansk Agapornis Klub får ikke provision eller lignende. Eneste forpligtigelse er, at vi reklamere på vores webside

Læs mere

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013

Proteiner: en introduktion. Modul 1; F13 Rolf Andersen, 18/2-2013 Proteiner: en introduktion Modul 1; F13 Rolf Andersen, 18/2-2013 4 facts om proteiner Proteiner udgør én af de vigtigste stofgrupper i vores organisme; de varetager en lang række forskellige funktioner.

Læs mere

BM121 Resume af tirsdags forlæsningen, Uge 47

BM121 Resume af tirsdags forlæsningen, Uge 47 BM121 Resume af tirsdags forlæsningen, Uge 47 Morten Källberg ( 22/11-2005 1 Probabilistiske modeller Vi vil i det følgende betragte to forskellige måder at evaluerer en given model

Læs mere

Velkommen. Test dit eget DNA med PCR. Undervisningsdag på DTU Systembiologi. Undervisere: Sebastian, Louise og Ana

Velkommen. Test dit eget DNA med PCR. Undervisningsdag på DTU Systembiologi. Undervisere: Sebastian, Louise og Ana Velkommen Test dit eget DNA med PCR Undervisningsdag på DTU Systembiologi Undervisere: Sebastian, Louise og Ana Hvem er I? 2 DTU Systembiologi, Danmarks Tekniske Universitet Dagens program 9:00 10:00 Introduktion

Læs mere

Mini-vejledning til. PubMed

Mini-vejledning til. PubMed Mini-vejledning til PubMed Udarbejdet af bibliotekar Helen Grundtvig Kristensen. Revideret Januar 2010 1 Indholdsfortegnelse Pubmed: introduktionsside side 3 Enkel søgning side 4 Advanced Search side 4

Læs mere

Velkommen Immunologisk Bioinformatik

Velkommen Immunologisk Bioinformatik Velkommen Immunologisk Bioinformatik EduForce undervisere: Hvem er vi? 2 DTU Systembiologi, Danmarks Tekniske Universitet Hvem er I? 3 DTU Systembiologi, Danmarks Tekniske Universitet Dagens Program Kl.

Læs mere

Vejledning til den skrevne patientinformation i Hospitalsenheden Vest

Vejledning til den skrevne patientinformation i Hospitalsenheden Vest Vejledning til den skrevne patientinformation i Hospitalsenheden Vest November 2015 /Kommunikation Inden du går i gang: Er det første gang, du skal bruge den fælles skabelon for den skrevne patientinformation

Læs mere

Genetiske afstande og afstandsmatricer

Genetiske afstande og afstandsmatricer Genetiske afstande og afstandsmatricer Denne vejledning indeholder en række små øvelser og opgaver der illustrerer, hvordan man ud fra genetiske sekvenser kan udregne en gennemsnitlig evolutionær afstand

Læs mere

Struktur og funktion af gener

Struktur og funktion af gener Molekylærbiologi og genetik S4, F2008 f Malene Munk Jørgensen Emne: Struktur og funktion af gener Link: undervisningsplanen for S4-molekylærbiologi og genetik MMJ, VI niversity ollege Bioanalytikeruddannelsen

Læs mere

Guide til din private side på Netstambogen

Guide til din private side på Netstambogen Guide til din private side på Netstambogen Når du slår Netstambogen op på Internettet, får du dette billede: For dem, der ikke er velbevandret i spansk, så kan man vælge den engelske udgave.

Læs mere

Kom godt i gang med I-bogen

Kom godt i gang med I-bogen Kom godt i gang med I-bogen At åbne bogen Det allerførste, du skal gøre, for at kunne arbejde med i-bogen, er at aktivere den. Det gøres ved at oprette en konto på og derefter aktivere bogen

Læs mere

Vejledning til sæsonbooking

Vejledning til sæsonbooking Indholdsfortegnelse Vejledning til sæsonbooking Indledning.. side 2 Login.. side 3 Søg ny sæsontid.. side 4 Side 1 Indledning Dette er en vejledning der beskriver, hvordan Folkeoplysende foreninger kan

Læs mere

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature.

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature. 0 Indhold 1) Basens indhold... 1 2) Adgang til basen... 1 3) Sign In / My EBSCOhost... 2 4) Søgemetoder... 3 4.a Fritekstsøgning... 3 4. b Begrænsning / afgrænsning... 4 4.c Er der adgang til artiklens

Læs mere

Modul 2 Database projekt Multimediedesign 3. semester Gruppe 3 IRF/TUJE

Modul 2 Database projekt Multimediedesign 3. semester Gruppe 3 IRF/TUJE Modul 2 Database projekt Multimediedesign 3. semester Gruppe 3 IRF/TUJE Fact sheet Indholdsfortegnelse Fact Sheet Gantt kort Valgt af virksomhed Brainstorm Attribut tabel ER-diagram Skitse MySQLWorkbench

Læs mere

Dansk resumé for begyndere

Dansk resumé for begyndere Dansk resumé for begyndere Dansk resumé for begyndere Dette afsnit introducerer bakteriel genregulation for enhver uden forudgående kendskab til dette emne. Alle nødvendige, videnskabelige betegnelser

Læs mere

Quick Guide for TopSURV RTK

Quick Guide for TopSURV RTK Quick Guide for TopSURV RTK GRS-1 GNSS og TopSURV v7.x Version 1.00 August 2010 1 Topcon hurtig guide til GNSS GRS-1 GPS+Glonass Modtager. GRS-1 Skrivebord, Windows mobile 6.1 Start for navigering til

Læs mere

Vejledning til den skrevne patientinformation i HEV August 2013 /Kommunikation

Vejledning til den skrevne patientinformation i HEV August 2013 /Kommunikation Vejledning til den skrevne patientinformation i HEV August 2013 /Kommunikation Inden du går i gang: Er det første gang, du skal bruge den fælles skabelon for den skrevne patientinformation i Hospitalsenheden

Læs mere

Betjeningsvejledning. for. UniRace

Betjeningsvejledning. for. UniRace Betjeningsvejledning for UniRace 2007 Et konkurrence indtastningsprogram. Indholdsfortegnelse Indholdsfortegnelse... 2 Figur fortegnelse... 3 Indledning... 4 Race info... 4 Indtastning af deltagere...

Læs mere

Vejledning Bilindretning

Vejledning Bilindretning Klik for at acceptere installation af TurnTool værktøj. Start med at lave en ny konfiguration ved at klikke på Start indretning. Du har mulighed for at vælge disse sprog og valuta

Læs mere

Protein syntese. return

Protein syntese. return Protein syntese. I artiklen redegøres for principperne i, hvordan octapeptidet SCHTFGDI kan syntetiseres. Som yderligere illustration heraf kan peptidet opbygges og visualiseres i Chem3D-Pro. Herved kan

Læs mere

BONUSINFORMATIONER i forbindelse med emnet Billeder og grafik

BONUSINFORMATIONER i forbindelse med emnet Billeder og grafik BONUSINFORMATIONER i forbindelse med emnet Billeder og grafik Dette dokument indeholder yderligere informationer, tips og råd angående: Tabelfunktionen SmartArtfunktionen Billedfunktionen Samt en ekstra

Læs mere

Elevvejledning til Stop Madspild Produktion

Elevvejledning til Stop Madspild Produktion Elevvejledning til Stop Madspild Produktion VELKOMMEN TIL Stop Madspilds digitale forum sørger for, at du og dine klassekammerater hele tiden har overblik over jeres produktioner fra første idé til den

Læs mere

Installation af DATABOKS online backup manager

Installation af DATABOKS online backup manager Installation af DATABOKS online backup manager For at kunne tage fjern-backup skal du installere en online backup manager på din maskine. Den skal bl.a. bruges til at bestemme hvilke filer, databaser og

Læs mere

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler.

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler. 0 Indholdsfortegnelse 1) Basens indhold... 1 2) Adgang til basen... 1 3) Søgemetoder... 2 a. Fritekstsøgning... 2 a. i. Muligheder for afgrænsning... 5 a. ii. Adgang til den fulde tekst eller ej / Ændring

Læs mere

Start i cirklen med nummer 1 - følg derefter pilene:

Start i cirklen med nummer 1 - følg derefter pilene: Bogstaver Bogstavet a Skriv bogstavet a i skrivehusene: Farv den figur som starter med a: Bogstavet b Skriv bogstavet b i skrivehusene: Farv den figur som starter med b: Bogstavet c Skriv bogstavet c i

Læs mere

Guide til upload af ruter og interessepunkter på Endomondo

Guide til upload af ruter og interessepunkter på Endomondo Guide til upload af ruter og interessepunkter på Endomondo Denne guide indeholder følgende emner: A. Rettigheder B. Oprettelse af profil på Endomondo C. Oprettelse af selve ruten D. Redigering af oprettet

Læs mere

Login. I denne lille folder beskrives nogle af de vigtigste funktoner i ForældreIntra:

Login. I denne lille folder beskrives nogle af de vigtigste funktoner i ForældreIntra: Login I denne lille folder beskrives nogle af de vigtigste funktoner i : Man finder som et link nederst til venstre på skolens offentlige Informationsportal. Adressen er:

Læs mere

Opgaveteknisk vejledning Word 2016 til Mac. Tornbjerg Gymnasium 10. december 2015

Opgaveteknisk vejledning Word 2016 til Mac. Tornbjerg Gymnasium 10. december 2015 Opgaveteknisk vejledning Word 2016 til Mac Tornbjerg Gymnasium 10. december 2015 Gem!!! Så snart et dokument er oprettet skal det gemmes under et fornuftigt navn, gør det til en vane at gemme hele tiden

Læs mere

Velkommen. Test dit eget DNA med PCR. Undervisningsdag på DTU Systembiologi. Undervisere:

Velkommen. Test dit eget DNA med PCR. Undervisningsdag på DTU Systembiologi. Undervisere: Velkommen Test dit eget DNA med PCR Undervisningsdag på DTU Systembiologi Undervisere: Hvem er I? 2 DTU Systembiologi, Danmarks Tekniske Universitet Hvilke baser indgår i DNA? A. Adenin, Guanin, Cytosin,

Læs mere

LCD Character display Intro

LCD Character display Intro LCD Character display Intro Der findes flere typer af LCD karakter-displays, fra forskellige firmaer. Her er vist en type, der er blå. Pins: Nummer 1 fra venstre Her er vist en nærmere beskrivelse af de

Læs mere

MakeRoute. Bruger manual

MakeRoute. Bruger manual MakeRoute Bruger manual Indholdsfortegnelse MakeRoute... 3 MakeRoute hjemmesiden... 4 Log på hjemmeside... 6 Opret tur... 7 Se ture... 9 Indtast adresse... 11 Upload tur... 13 MakeRoute app... 14 Download

Læs mere

Oprettelse af en Gmail-konto

Oprettelse af en Gmail-konto Oprettelse af en Gmail-konto 1. Åbn startsiden til Gmail fra adressen: I højre side af skærmen får du nu følgende skærmbillede: De to øverste bjælker, markeret med Brugernavn og Adgangskoder,

Læs mere

Vejledning til CINAHL Plus with Full Text

Vejledning til CINAHL Plus with Full Text Vejledning til CINAHL Plus with Full Text Vibeke Witt, Professionshøjskolen Metropol, 2013 Revideret af: Ester Hørmann, Professionshøjskolen Metropol, september 2015 Indholdsfortegnelse Databasens indhold...

Læs mere

Skabelonfilen er udarbejdet i Word til Windows (Office 2010) og er også afprøvet i Word til Mac.

Skabelonfilen er udarbejdet i Word til Windows (Office 2010) og er også afprøvet i Word til Mac. Nordiske Studier i Leksikografi 13 (København 2015) Brug af stilark Vi vil gerne have at alle forfattere benytter den Word-fil som redaktionen har udarbejdet og sendt ud, både forfattere og redaktører

Læs mere

Arbejd videre med statistik

Arbejd videre med statistik Danmarks Statistik Arbejd videre med statistik Vejledning i PC-AXIS og Statistikbanken Danmarks Statistik juni 2003 1 Indholdsfortegnelse INDHOLDSFORTEGNELSE...2

Læs mere


HR-Centret NOTAT HR-Centret 13-08-2013 Vejledning af tillidsrepræsentanter i brug af KRL 1. brugernavn og password for at få adgang til Kommuners og Regioners Løndata skal TR sende en mail til lønkonsulent Inge Møller,

Læs mere

Microsoft Word 2003 - fremgangsmåde til Blomsterhuset Side 1 af 11

Microsoft Word 2003 - fremgangsmåde til Blomsterhuset Side 1 af 11 Microsoft Word 2003 - fremgangsmåde til Blomsterhuset Side 1 af 11 Åbn Word 2003 Skriv: Blomsterhuset A/S - tryk enter en gang Skriv: Blomster for alle - tryk enter 5 gange Skriv: I anledning af at - tryk

Læs mere

Opgaveteknisk vejledning Word 2011 til Mac. Tornbjerg Gymnasium 10. december 2015

Opgaveteknisk vejledning Word 2011 til Mac. Tornbjerg Gymnasium 10. december 2015 Opgaveteknisk vejledning Word 2011 til Mac Tornbjerg Gymnasium 10. december 2015 Gem!!! Så snart et dokument er oprettet skal det gemmes under et fornuftigt navn, gør det til en vane at gemme hele tiden

Læs mere


STADS DANS OPSLAG AF ANSØGNINGER TIL FAGLIG BEHANDLING STADS DANS OPSLAG AF ANSØGNINGER TIL FAGLIG BEHANDLING STADS-DANS Introduktion / Opslag af ansøgninger til faglig behandling Formålet med denne vejledning er at give en enkel anvisning til opslag af studerendes

Læs mere

Annemette Søgaard Hansen/

Annemette Søgaard Hansen/ Google Docs Regneark Indholdsfortegnelse Værktøjer... Side 3 Menuer... Side 6 Opgave... Side 13 Få adgang til filerne fra din computer... Side 19 Vejledende løsning... Side 20 GoogleDocs Regneark 2 Google

Læs mere

Genomics og big data sikrer ny indsigt i sygdom og nye muligheder for sundhedsvæsenet

Genomics og big data sikrer ny indsigt i sygdom og nye muligheder for sundhedsvæsenet Genomics og big data sikrer ny indsigt i sygdom og nye muligheder for sundhedsvæsenet Exiqons cloud-løsning hjælper forskere med at analysere og forstå genomics og big data Hvad er genomics? Genomics er

Læs mere

WORKCYCLUS. Handlingsplan. Vers 4.0. Juni 2013. Workcompany A/S. Amagertorvet 33, 4.sal. DK-1160 København K.

WORKCYCLUS. Handlingsplan. Vers 4.0. Juni 2013. Workcompany A/S. Amagertorvet 33, 4.sal. DK-1160 København K. WORKCYCLUS Handlingsplan Vers 4.0 Juni 2013 Workcompany A/S Amagertorvet 33, 4.sal DK-1160 København K 1. Indholdsfortegnelse Handlingsplan... 3 Overblik på indsatsområder på handlingsplan...

Læs mere

Redaktørvejledning for Skriv en artikel

Redaktørvejledning for Skriv en artikel Arbejdsgang - Skriv artiklens tekst - Gør billeder klar - Log-in på hjemmesiden - Opret ny artikel - Vælg kategori - Skriv overskrift - Indsæt tekst - Tilføj billeder - Gennemgå artiklens indstillinger

Læs mere

NR. 92 PDF-formularer med OpenOffice DEN 4. MARTS 2015

NR. 92 PDF-formularer med OpenOffice DEN 4. MARTS 2015 NR. 92 PDF-formularer med OpenOffice DEN 4. MARTS 2015 PDF-formularer med OpenOffice til LUDUS Web Målet med dette Tips & Tricks er at beskrive, hvordan man laver PDF-formularer til brug i LUDUS Web. Læs

Læs mere

Over- og merarbejde med måneds- og år-til-dato forbrug (Rapport-ID: 71)

Over- og merarbejde med måneds- og år-til-dato forbrug (Rapport-ID: 71) Over- og merarbejde med måneds- og år-til-dato forbrug (Rapport-ID: 71) Indhold 1. Hvad er formålet med rapporten?... 1 2. Overblik over rapporten... 1 3. Den færdige rapport... 2 4. Faste indbyggede filtre

Læs mere

WordPress Brugernavn: Password:

WordPress Brugernavn: Password: WordPress Brugernavn: Password: April, 2015 Generelt Du kan benytte WordPress fra alle platforme. Det vil sige, du kan redigere jeres hjemmeside fra din computer, din

Læs mere

15. oktober. Maskine Udlejning. Jacob Weng, Jeppe Boese og Mads Anthony. Udlejningsvirksomhed. Roskilde Tekniske Gymnasium 3.4

15. oktober. Maskine Udlejning. Jacob Weng, Jeppe Boese og Mads Anthony. Udlejningsvirksomhed. Roskilde Tekniske Gymnasium 3.4 Maskine Udlejning 15. oktober 2010 Jacob Weng, Jeppe Boese og Mads Anthony Roskilde Tekniske Gymnasium Udlejningsvirksomhed 3.4 Indholdsfortegnelse Problemformulering:... 2 Planlægning:... 2 Analyse af

Læs mere

Lønstigning mellem to selvvalgte perioder (Rapport-ID: 67)

Lønstigning mellem to selvvalgte perioder (Rapport-ID: 67) Lønstigning mellem to selvvalgte perioder (Rapport-ID: 67) 1. Hvad er formålet med rapporten? I denne rapport kan du sammenligne lønnen på to forskellige selvvalgte tidspunkter (to løngenerationer) pr.

Læs mere

FairSSL Fair priser fair support

FairSSL Fair priser fair support Exchange 2010 SSL certifikat administration Følgende vejledning beskriver hvordan man vælger hvilke adresser der skal være i ens Exchange 2010 SAN SSL certifikat. Derudover er der tekniske guides til at

Læs mere

Brugermanual til Wordpress 3.2.x Content Management System

Brugermanual til Wordpress 3.2.x Content Management System Indhold Brugermanual til Wordpress 3.2.x Content Management System Kontrolpanelet 2 Brugerniveauer 2 Log ud 3 Profil 4 Generel Info (vigtigt) 5 Tilføj nyt indlæg(1) 6 Tilføj nyt indlæg(2) 7 Tilføj nyt

Læs mere

Annemette Søgaard Hansen/

Annemette Søgaard Hansen/ Google Docs Dokumenter Indholdsfortegnelse Værktøjer... Side 3 Menuer... Side 5 Opgave... Side 8 Få adgang til filerne fra din computer... Side 16 Vejledende løsning... Side 17 GoogleDocs Dokumenter 2

Læs mere


MANUAL TIL ANDST.INFO: MANUAL TIL ANDST.INFO: Sådan kan du få din foreningshjemmeside på Eksempel: domænet peger på hallens side på - LOGIN: Gå til (Man

Læs mere

TrivselAPV 2010 Teknisk guide til sikkerhedsgrupperne 1

TrivselAPV 2010 Teknisk guide til sikkerhedsgrupperne 1 TrivselAPV 2010 Teknisk guide til sikkerhedsgrupperne 1 DEL 1: Igangsætning af kortlægning Inden I går i gang med TrivselMeter, skal I oprettet en Excel-fil med jeres målgruppe dvs. en mailliste over de

Læs mere



Læs mere

Søgning i Betalingsservice arkiv

Søgning i Betalingsservice arkiv Søgning i Betalingsservice arkiv Indhold Log på... Søgebilledet... Søgeresultater... 4 Se flere regninger til samme kunde... 4 Finde Kunde... 5 Søgeresultater fra kundenummersøgningen... 6 Søgning i Betalingsservice

Læs mere

Vejledning til at søge Erhvervsuddannelse for voksne (EUV) Brugervejledning

Vejledning til at søge Erhvervsuddannelse for voksne (EUV) Brugervejledning Vejledning til at søge Erhvervsuddannelse for voksne (EUV) Brugervejledning Vejledning til at søge Erhvervsuddannelse for voksne (EUV) Brugervejledning Forfatter: Tine Kanne Sørensen Styrelsen for It og

Læs mere


TYPO3 TRIN FOR TRIN 3 TYPO3 TRIN FOR TRIN 3 De indledende øvelser er fuldstændig de samme som i TYPO3 TRIN FOR TRIN 1 side 1-2. Du åbner altså din browser, skriver i Adressefeltet, og klikker på ordet Side i menuen

Læs mere

Søgeeksempel i PubMed:

Søgeeksempel i PubMed: 1 Søgeeksempel i PubMed: Tværfagligt samarbejde omkring genoptræning efter udskrivning fra hospital Første skridt: Opløs problemformuleringen i de søgeord som dækker problemstillingen og endelig ikke flere

Læs mere

OPBYGNING AF INSTRUMENTER. Online Designeren Record ID Felttyper Validering og variabelnavne

OPBYGNING AF INSTRUMENTER. Online Designeren Record ID Felttyper Validering og variabelnavne OPBYGNING AF INSTRUMENTER Online Designeren Record ID Felttyper Validering og variabelnavne Online Designer Online designeren er det primære værktøj til at opbygge skemaet til dataindsamling. I REDCap

Læs mere

Opgaveteknisk vejledning Word 2013. Tornbjerg Gymnasium 10. december 2015

Opgaveteknisk vejledning Word 2013. Tornbjerg Gymnasium 10. december 2015 Opgaveteknisk vejledning Word 2013 Tornbjerg Gymnasium 10. december 2015 Gem!!! Så snart et dokument er oprettet skal det gemmes under et fornuftigt navn, gør det til en vane at gemme hele tiden mens man

Læs mere

Billeder på hjemmeside

Billeder på hjemmeside Billeder på hjemmeside Indholdsfortegnelse Emne 1. Billedredigering (Microsoft Picture Manager) Side 3 a. Komprimer billeder b. Beskæring af billeder 3 9 2. Billeder og tekst ved hjælp af en skabelon (Template

Læs mere

Nye funktioner i FamilySearch FamilyTree

Nye funktioner i FamilySearch FamilyTree Nye funktioner i FamilySearch FamilyTree Login og få nye funktioner til rådighed Hvis du tidligere har haft et login til FamilySearch (, kan du umiddelbart tage de nye funktioner

Læs mere

matematik Demo excel trin 1 preben bernitt 1 excel 1 2007 by

matematik Demo excel trin 1 preben bernitt 1 excel 1 2007 by matematik excel trin 1 preben bernitt 1 excel 1 2007 by matematik excel 1 1. udgave som E-bog 2007 by Kopiering af denne bog er kun tilladt

Læs mere

På nedenstående billede skal du finde den figur som optræder nøjagtig 3 gange.

På nedenstående billede skal du finde den figur som optræder nøjagtig 3 gange. Navn: Klasse: Materiale ID: PIC.33.1.1.da Lærer: Dato: Klasse: Materiale ID: PIC.33.1.1.da Navn: Klasse: Materiale ID: PIC.33.2.1.da Lærer: Dato: Klasse: Materiale ID: PIC.33.2.1.da Navn: Klasse: Materiale

Læs mere

Personalefortegnelse (Rapport-ID: 49)

Personalefortegnelse (Rapport-ID: 49) Personalefortegnelse (Rapport-ID: 49) Indhold 1. Hvad er formålet med rapporten?... 1 2. Overblik over rapporten... 1 3. Den færdige rapport... 2 4. Faste, indbyggede filtre / betingelser i rapporten...

Læs mere

Nr 1. Fra gen til protein

Nr 1. Fra gen til protein Nr 1 Fra gen til protein Med udgangspunkt i vedlagte illustrationer bedes du besvare følgende: Hvordan er sammenhængen mellem DNA ets nukleotider og proteinets aminosyrer? Beskriv hvad der sker ved henholdsvis

Læs mere

Delta SOLIVIA Webmonitor G1 Kvik guide

Delta SOLIVIA Webmonitor G1 Kvik guide Delta SOLIVIA Webmonitor G1 Kvik guide Delta SOLIVIA Webmonitor G1 Gå ind på: Klik på Register i den grønne cirkel Hvis din browser nu skriver, at den ikke

Læs mere

Vejledning til teknisk serviceleder

Vejledning til teknisk serviceleder Indholdsfortegnelse Vejledning til teknisk serviceleder Indledning.. side 2 Login.. side 3 Mine anlæg... side 4 Søg ledig tid enkeltbooking side 6 Søg ny sæsontid.. side 11 Side 1 Indledning Det er vigtigt,

Læs mere

Klasse 1.4 Michael Jokil 03-05-2010

Klasse 1.4 Michael Jokil 03-05-2010 HTX I ROSKILDE Afsluttende opgave Kommunikation og IT Klasse 1.4 Michael Jokil 03-05-2010 Indholdsfortegnelse Indledning... 3 Formål... 3 Planlægning... 4 Kommunikationsplan... 4 Kanylemodellen... 4 Teknisk

Læs mere

Motto-Captura ApS, 2006. Ordblinde PDA. Lyt - lær - husk. Motto-Captura ApS, 2006

Motto-Captura ApS, 2006. Ordblinde PDA. Lyt - lær - husk. Motto-Captura ApS, 2006 p1 Ordblinde PDA Lyt - lær - husk p2 p3 Vi håber meget, at du vil få glæde af løsningen. Du må meget gerne sende os forslag eller ringe til os. p4 Start Når du

Læs mere