Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Størrelse: px
Starte visningen fra side:

Download "Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13"

Transkript

1 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan (Navn: Eksamen_ pdf) Kursus-hjemmeside: Eksamenssættet består af 6 hoved-emner 1 6 og til hvert emne er der en række spørgsmål som du skal svare på. Ialt er der 13 sider, hvoraf de to sidste er Appendix 1 og 2. Spørgsmålene du skal svare på står med kursiv Hvis du ikke har tilstrækkelig plads på disse sider så svar på et andet stykke papir, men husk at gengive hvilket spørgsmål du svarer på ved at skrive 1b hvis du svarer på spørgsmål b i opgave 1. Læs opgaverne omhyggeligt inden du begynder. Emner (bedømmelses-vægt i procent) Opgave 1: DNA og RNA (15%) Opgave 2: Aminosyrer (20%) Opgave 3: Uniprot (20%) Opgave 4: Sekvens alignment (20 %) Opgave5:SNP SingleNucleotidepolymorphism(15%) Opgave6:PDB 3D strukturoghomologimodellering(10%) Vi vil logge jeres internet under denne eksamen og alt kommunikation med andre personer via mail, tlf og lignende er diskvalificerende.

2 Side2af13 Opgave 1: DNA og RNA (15%) a) Hvad kaldes den proces, hvor DNA oversættes til messenger RNA (DNA -> mrna)? b) Hvad kaldes den proces, hvor messenger RNA oversættes til protein (mrna -> protein)? c) Hvad er 1-bogstavs koderne for kerne-baserne (nukleotiderne) i DNA? d) Hvilke af disse kerne-baser danner hydrogen-bindinger til hinanden (kaldet base parring på engelsk)? Herunder er et stykke genomisk DNA (+ string) kaldet gene1 med læseretning fra venstre mod højre gene1: TTGATTGCAA e) Er den korrekt læseretningen for DNA fra 3 mod 5 enden eller omvendt dvs fra 5 mod 3 enden? f) Der fines 3 stop codons: TAA, TAG og TGA. Benyt sekvensen herunder (genea) til at finde alle stop-codons i alle læserammer. Sekvensen er angivet for + stringen, med læseretning fra venstre mod højre. Skriv læseramme efterfulgt af mulige stopcodons. genea: TTGATTTCAA

3 Side3af13 Opgave 2: Aminosyrer (20%) a) Hvor mange naturligt forekommende aminosyrer findes der? b) En enkelt aminosyre har ikke et chiralt C-alpha atom. Hvad er 1 og 3-bogstavs koderne for denne? Skriv 1 og 3-bogstav koder for aminosyrerne som tilhører de grupper som er listet herunder i spørgsmål c), d) og e) c) Basiske: d) Sure: e) Aromatiske: f) Skriv herunder en korrekt sekvens i FASTA format, med navnet MIN_SEKVENS. Dette korte peptid skal bestå af 5 forskellige aminosyrer som er polære eller hydrophobe benyt 1-bogstavs koder. g) Tegn et di-peptid, hvor du indikerer sidekæden med R. Skriv også navn på de 4 backbone atomer.

4 Side4af13 Opgave 3: Uniprot (20%) Benyt Advanced Search i Uniprot databasen til at lede efter lysozyme hits for organismen Gallus gallus (Chicken). a) Hvor mange reviewed (dvs UniProtKB/Swiss Prot) hits finder du for lysozyme for organismen Chicken, hvor lysozyme er en del af protein navnet (protein name). skriv antal hits du ender op med til sidst og evt antal hits (søgeresultater) du får undervejs? b) Angiv Accession nummer for et af den/de hits du fandt spørgsmål 3a og skriv, med 1-bogstavs kode og position, de aminosyrer som er del af det aktive site i dette protein? c) Det protein du beskrev i spørgsmål 3b, vil det virke indenfor eller udenfor den celle hvor det bliver lavet. Angiv længden af det modne (English: mature) protein, samt hvor det befinder sig (dvs indenfor eller udenfor cellen). Begrund dine svar. d) For proteinet med accession number P00698( 0 eretnulogikkeetbogstav)er derangivetsekundærstruktureniuniprot.kanduudfradenneangivehvilkenaf de5fold klasser(a,b,c,dellere)proteinettilhører? a. All alpha b. All beta c. Alpha+beta d. Alpha/beta e. Fåelleringensekundærstrukturelementer

5 Side5af13 4: Sekvens alignment (20 %) Man har søgt med en protein sekvens mod en stor database af sekvenser vha Blast (i protein mode blastp ) og får 4 forskellige alignments tilbage. Resultaterne fra disse 4 alignments beskrives herunder som Hit 1-4. Normalt benyttes e-værdier (også kaldet e-values eller Expection values) til at udvælge det bedste hit. a) Skriv de 4 hits i en ordnet liste under hinanden, således at det bedste hit står øverst og dårligste hit står nederst. Skriv også hvilke hits du vil betragte som signifikante og hvorfor. Hit 1: e-value = 4e-22 Hit 2: e-value= 0 Hit 3: e-value= 3.2 Hit 4: e-value = 0.01

6 Side6af13 To protein sekvenser kan alignes såfremt man har en substitutions-matrix og et mål for hvad det koster at lave gaps. Herunder er et alignment, hvor Query er en betegnelse for den sekvens man har søgt med, mens Sbjct repræsenterer et hit fundet i en sekvens-database. Affine gap-scores Når man laver et alignment kan man benytte sig af en simple procedure, hvor alle gaps koster det same eller man kan benytte en procedure med affine gap-scores, som er den måde Blast benytter. Når man anvender affine gap-scores, koster det en pris for at åbne et gap (gap-opening) og en anden pris for de næste gaps (gap-next). Gap-opening er altså den pris det koster i en situation hvor man indsætter et gap i et alignment og positionen lige før er ikke et gap. Gap-next er den pris det koster i den situation hvor man indsætter et gap i et alignment og positionen lige før er også et gap. Her skal vi benytte denne procedure med affine gap-scores. Gap-opening score: -11 Gap-next score: -1 b) Hvad er alignment scoren for det hypotetiske alignment som er vist. Benyt Blosum62 matrix i Appendix 1 og proceduren som beskrevet ovenfor i Affine gapscores. Husk at skrive mellem-regninger, ikke kun et tal. pos: 8 15 Query: P R - - Q C K S S Sbjct: P R R E R C R Q T S Pos: 3 12 c)derfindesoverordnettoforskelligetyperafalignments.hvadkaldesdentype alignmentsomervistispørgsmål4b?

7 Side7af13 d) Herunderer2kortepeptiderSeq1ogSeq2. Seq1:RDVNT Seq2:KIQS Dissesekvenserskalalignesvhaendynamiskalignmentalgoritme,hvoralle gapshverisærkoster2point(dvsenscorepå 2),menssubstitutions scoren fåsudfradenblosum62matrixderfindesiappendix1.duselvbestemme hvilkenafde2hoved alignmenttyperduvælger,menskrivditvalg herunder. d1)jegvælgeralignmenttype: Udfyldherefteralignment matrixpånæstesidehvordetopeptideralignes.

8 Side8af13 Alignmentmatrix K I Q S R 2 D 4 V 6 N 8 T 10 d2)skrivedetfærdigealignmentherundersamtalignment scoren:

9 Side9af13 5:SNP SingleNucleotidepolymorphism(15%) Herundersessekvensenfordenkodenderegionafetkortgenmedenlængdepå 51bp.Læseretningenerfravenstremodhøjre.Derfindes2SNP sindenfordette område,snp1(g/t)påposition6ogsnp2(t/a)påposition15.rna translation tabelleniappendix2kanbenyttestilnogleafspørgsmålene. SNP1SNP2 ATGCAGCCTATGTGTAACGTGGTCACCCTGATCCGATCGTATGTTTTATTT a) Hvaderforskellenpåensynonym(Eng:synonomous)SNPogenikkesynonym (Eng:non synonomous)snp? b) VilSNP1havenogenindflydelse/ændrepådetproteinproduktsomlavesog hvorlangtbliverproteinsekvensen(begrundditsvar)? c) VilSNP2havenogenindflydelsepådetproteinproduktsomlavesoghvorlangt bliverproteinsekvensen(begrundditsvar)?

10 Side10af13 6:PDB 3D strukturoghomologimodellering(10%) a) Deforskelligelagafinformationforetproteinbeskrivesoftenmed4ord: primær,sekundær,tertiærogkvaternærstruktur. Beskrivkortbetydningenafdisseord Duskaltilatbyggeenhomologimodelafetprotein.Vedhjælpafen sekvenssøgningipdbhardufundetseksstrukturertilformålet.strukturernes kvalitetsparametreogalignment scorererangivetnedenforitabel1(side11): b)forklarudfraparametreneitabel1(side11),hvilkenstruktur(enellerflere) dervilværebedstatbaseredinmodelpå.begrundditvalg.

11 Side11af13 c)forklarudfraparametreneitabel1(side11),hvilketrestrukturer,dervilvære dedårligstevalg.begrundditvalg. Tabel1 Struktur A B C D E F E værdi(eng.evalues) 1,0E 09 1,0E 02 1,0E 10 1,0E 12 1,0E 11 1,0E 10 Sekvens id(%) Metode* X X X X N N Opløsningsevne 2,3 1,4 2,4 4,0 n/a n/a Resolution(Å) R værdi 0,22 0,16 0,24 0,30 n/a n/a R free ,20 0,27 0,35 n/a n/a RMSD** n/a n/a n/a n/a 0,3 0,4 Ramachandran statistik(% outliers) 3,0 1,0 2,0 5,0 5,0 2,5 *X=x ray/røntgenkrystallografi,n=nmr,**forensemblet

12 Side12af13 Appendix1 Blosum62matrix

13 Side13af13 Appendix2 RNAtranslationtable

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Databasesøgning med BLAST

Databasesøgning med BLAST Databasesøgning med BLAST Denne vejledning giver en introduktion til databasesøgning med forskellige programmer i BLAST-familien. Vejledningen indeholder først en grundig introduktion og gennemgang af

Læs mere

Immunologisk bioinformatik

Immunologisk bioinformatik Immunologisk bioinformatik Øvelsesvejledning Introduktion til øvelsen Når man i dagligdagen taler om influenza, bliver virussen ofte forbundet med forbigående og ufarlig sygdom. Som regel har mennesker

Læs mere

Opgaver. Notater. Opgave 1: Find kursus hjemmeside og bladre lidt rundt på siderne.

Opgaver. Notater. Opgave 1: Find kursus hjemmeside og bladre lidt rundt på siderne. Opgaver Opgaverne er stillet i henhold til medleverede brugervejledning, og som er en facitliste for opgaverne. Brug den undervejs til at løse opgaverne med, og kom med de punkter som den måtte mangle,

Læs mere

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle BIOINFORMATIK Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle indhold DNA 2 Hvilke databaser skal man vælge? 2 Søgning på en nukleotidsekvens 2 Proteiner 4 Søgning på

Læs mere

Mini-vejledning til. PubMed

Mini-vejledning til. PubMed Mini-vejledning til PubMed Udarbejdet af bibliotekar Helen Grundtvig Kristensen. Revideret Januar 2010 1 Indholdsfortegnelse Pubmed: introduktionsside side 3 Enkel søgning side 4 Advanced Search side 4

Læs mere

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste 1 Forside Tre sideopsætninger: 1 Forside 2 Standard 3 Liste 2 Underside 3 Liste Ret indhold på en side I systemet kan du let rette tekst, link og billeder på hjemmesiden Først skal du logge ind i systemet

Læs mere

Arbejd videre med statistik

Arbejd videre med statistik Danmarks Statistik databanker@dst.dk Arbejd videre med statistik Vejledning i PC-AXIS og Statistikbanken Danmarks Statistik juni 2003 1 www.dst.dk www.statistikbanken.dk Indholdsfortegnelse INDHOLDSFORTEGNELSE...2

Læs mere

Vejledning Bilindretning

Vejledning Bilindretning http://vanconfig.raaco.com Klik for at acceptere installation af TurnTool værktøj. Start med at lave en ny konfiguration ved at klikke på Start indretning. Du har mulighed for at vælge disse sprog og valuta

Læs mere

Indholdsfortegnelse. Indledning System krav side 1

Indholdsfortegnelse. Indledning System krav side 1 Indholdsfortegnelse Indledning System krav side 1 Brugerflade Hovedvindue side 2 Sprog side 2 Funktionsknapper side 2 Programmér kort side 3 Rapport side 4 Program menu Comport, login side 5 Rev.1.1 2014

Læs mere

TILBAGE TIL DANSK AGAPORNIS KLUB

TILBAGE TIL DANSK AGAPORNIS KLUB TILBAGE TIL DANSK AGAPORNIS KLUB Bemærk! Klubben har ikke noget med testene at gøre og Dansk Agapornis Klub får ikke provision eller lignende. Eneste forpligtigelse er, at vi reklamere på vores webside

Læs mere

vejman.dk Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9

vejman.dk Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Indholdsfortegnelse 1 Indledning... 3 1.1 Anbefalinger... 4 1.2 Datahjælp... 4 1.3 Brugerindstillinger... 5 2 Generel funktionalitet... 6 2.1

Læs mere

Struktur og funktion af gener

Struktur og funktion af gener Molekylærbiologi og genetik S4, F2008 f Malene Munk Jørgensen Emne: Struktur og funktion af gener Link: undervisningsplanen for S4-molekylærbiologi og genetik MMJ, VI niversity ollege Bioanalytikeruddannelsen

Læs mere

Start i cirklen med nummer 1 - følg derefter pilene:

Start i cirklen med nummer 1 - følg derefter pilene: Bogstaver Bogstavet a Skriv bogstavet a i skrivehusene: Farv den figur som starter med a: Bogstavet b Skriv bogstavet b i skrivehusene: Farv den figur som starter med b: Bogstavet c Skriv bogstavet c i

Læs mere

Indledning. På de følgende sider vises, primært i tegneserieform, lidt om mulighederne i PC-AXIS for Windows.

Indledning. På de følgende sider vises, primært i tegneserieform, lidt om mulighederne i PC-AXIS for Windows. Indledning PC-AXIS for Windows er et talbehandlingsprogram, der kan håndtere store mængder statistisk materiale. PC-AXIS giver mulighed for at arbejde videre med det statistiske materiale i egne programmer

Læs mere

Genomics og big data sikrer ny indsigt i sygdom og nye muligheder for sundhedsvæsenet

Genomics og big data sikrer ny indsigt i sygdom og nye muligheder for sundhedsvæsenet Genomics og big data sikrer ny indsigt i sygdom og nye muligheder for sundhedsvæsenet Exiqons cloud-løsning hjælper forskere med at analysere og forstå genomics og big data Hvad er genomics? Genomics er

Læs mere

Nr 1. Fra gen til protein

Nr 1. Fra gen til protein Nr 1 Fra gen til protein Med udgangspunkt i vedlagte illustrationer bedes du besvare følgende: Hvordan er sammenhængen mellem DNA ets nukleotider og proteinets aminosyrer? Beskriv hvad der sker ved henholdsvis

Læs mere

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler.

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler. 0 Indholdsfortegnelse 1) Basens indhold... 1 2) Adgang til basen... 1 3) Søgemetoder... 2 a. Fritekstsøgning... 2 a. i. Muligheder for afgrænsning... 5 a. ii. Adgang til den fulde tekst eller ej / Ændring

Læs mere

matematik Demo excel trin 1 preben bernitt bernitt-matematik.dk 1 excel 1 2007 by bernitt-matematik.dk

matematik Demo excel trin 1 preben bernitt bernitt-matematik.dk 1 excel 1 2007 by bernitt-matematik.dk matematik excel trin 1 preben bernitt bernitt-matematik.dk 1 excel 1 2007 by bernitt-matematik.dk matematik excel 1 1. udgave som E-bog 2007 by bernitt-matematik.dk Kopiering af denne bog er kun tilladt

Læs mere

Vejledning for opdatering af hjemmesiden opbygget med. KlubCMS

Vejledning for opdatering af hjemmesiden opbygget med. KlubCMS Vejledning for opdatering af hjemmesiden opbygget med KlubCMS Indholdsfortegnelse Indhold Indholdsfortegnelse... 2 Indledning... 3 Lidt generelt om KlubCMS... 3 Sideopbygning:... 4 Brugere/Brugergrupper...

Læs mere

mit KODA EN GUiDE KODA

mit KODA EN GUiDE KODA mit KODA EN GUIDE koda 1 / LOG PÅ 3 / VELKOMMEN Log på Mit KODA Gå ind på KODA s hjemmeside www.koda.dk/mit-koda. Log på Mit KODA Her får du adgang til dine egne musikværker, afregningsbilag og mulighed

Læs mere

Tlf. +45 7027 1699 Fax + 45 7027 1899

Tlf. +45 7027 1699 Fax + 45 7027 1899 Firmaordninger I firmaoversigten kan du holde styr på dit kundekartotek samt disses bookinger. Der kan desuden oprettes andre firmaer end dit eget. Herved kan der udbydes særlige ydelser på med egne arbejdstider.

Læs mere

MakeRoute. Bruger manual

MakeRoute. Bruger manual MakeRoute Bruger manual Indholdsfortegnelse MakeRoute... 3 MakeRoute hjemmesiden... 4 Log på hjemmeside... 6 Opret tur... 7 Se ture... 9 Indtast adresse... 11 Upload tur... 13 MakeRoute app... 14 Download

Læs mere

Redaktørvejledning for www.bredstrup-pjedsted.dk Skriv en artikel

Redaktørvejledning for www.bredstrup-pjedsted.dk Skriv en artikel Arbejdsgang - Skriv artiklens tekst - Gør billeder klar - Log-in på hjemmesiden - Opret ny artikel - Vælg kategori - Skriv overskrift - Indsæt tekst - Tilføj billeder - Gennemgå artiklens indstillinger

Læs mere

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature.

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature. 0 Indhold 1) Basens indhold... 1 2) Adgang til basen... 1 3) Sign In / My EBSCOhost... 2 4) Søgemetoder... 3 4.a Fritekstsøgning... 3 4. b Begrænsning / afgrænsning... 4 4.c Er der adgang til artiklens

Læs mere

Statistik på Geocaching.com

Statistik på Geocaching.com Statistik på Geocaching.com Hvis vi gerne vil have statistik på vores profil på Geocaching.com, vel at mærke en statistik der er lidt mere spændende end den der findes der i forvejen, kan vi genere en

Læs mere

FairSSL Fair priser fair support

FairSSL Fair priser fair support Exchange 2010 SSL certifikat administration Følgende vejledning beskriver hvordan man vælger hvilke adresser der skal være i ens Exchange 2010 SAN SSL certifikat. Derudover er der tekniske guides til at

Læs mere

Vejledning til online ansøgning om lokaler i Netbooking

Vejledning til online ansøgning om lokaler i Netbooking Vejledning til online ansøgning om lokaler i Netbooking Det er nu muligt at booke lokaler i Høje-Taastrup Kommune via Internettet og kommunens hjemmeside. Du får adgang til siden ved at følge nedenstående

Læs mere

Tilpas: Hurtig adgang

Tilpas: Hurtig adgang Tilpas: Hurtig adgang Genveje, Se skærmtips Se tips Hold alt tasten nede. Og brug bogstaver Word Fanen Filer PDF dokument Brug skabelon Visninger Husk Luk ved fuldskærmsvisning Brug zoom skyder Marker,

Læs mere

Annemette Søgaard Hansen/www.dinwebvejleder.dk

Annemette Søgaard Hansen/www.dinwebvejleder.dk Google Docs Dokumenter Indholdsfortegnelse Værktøjer... Side 3 Menuer... Side 5 Opgave... Side 8 Få adgang til filerne fra din computer... Side 16 Vejledende løsning... Side 17 GoogleDocs Dokumenter 2

Læs mere

Gør det selv. Vejledning. Skift adgangskode til Norddjurs PC og Citrix fra Citrix IT-AFDELINGEN

Gør det selv. Vejledning. Skift adgangskode til Norddjurs PC og Citrix fra Citrix IT-AFDELINGEN Af: Anders C. H. Pedersen E-mail: Achp@norddjurs.dk Revideret: 12. november 2014 IT-AFDELINGEN Vejledning Gør det selv Skift adgangskode til Norddjurs PC og Citrix fra Citrix Norddjurs Kommune. Torvet

Læs mere

MailMax / Web v4.1. Brugsvejledning til webmail. Copyright 2003 Gullestrup.net

MailMax / Web v4.1. Brugsvejledning til webmail. Copyright 2003 Gullestrup.net MailMax / Web v4.1 Copyright 2003 Gullestrup.net Log ind på webmailen Start med at gå ind på http://webmail.gullestrup.net i din browser. Indtast din Email-adresse samt Adgangskode, som hører til din konto.

Læs mere

Ansvarlig Oprettet 22-11-2011 Projekt: Maskindatabase over forsøgsudstyr Side 1 af 9

Ansvarlig Oprettet 22-11-2011 Projekt: Maskindatabase over forsøgsudstyr Side 1 af 9 Notat Ansvarlig HJB Oprettet 22-11-2011 Projekt: Maskindatabase over forsøgsudstyr Side 1 af 9 Sådan bruger du SharePoint til Maskindatabasen Maskindatabasen er oprettet i et program der hedder SharePoint

Læs mere

Indhold Basen dækker sygepleje(videnskab), samt til en vis grad ergoterapi, fysioterapi, diætetik, radiografi, audiologi, rehabilitering

Indhold Basen dækker sygepleje(videnskab), samt til en vis grad ergoterapi, fysioterapi, diætetik, radiografi, audiologi, rehabilitering CINAHL Plus Udgiver Cinahl Information Systems, California Indhold Basen dækker sygepleje(videnskab), samt til en vis grad ergoterapi, fysioterapi, diætetik, radiografi, audiologi, rehabilitering Omfang

Læs mere

http://www.tinglysningsretten.dk/tinglysning/nyvejledninger/documents/generelle/upload%20og%20vedh%c3%a6ft% 20bilag.pdf

http://www.tinglysningsretten.dk/tinglysning/nyvejledninger/documents/generelle/upload%20og%20vedh%c3%a6ft% 20bilag.pdf Start på Tinglysningens hjemmeside tinglysning.dk. Tinglysningen er en noget lang proces, som forløber over 10 trin med diverse udflugter undervejs. Samtidig bliver man automatisk logget af systemet, hvis

Læs mere

VELKOMMEN 3. KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9

VELKOMMEN 3. KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9 VEJLEDNING 1.0 Indhold VELKOMMEN 3 KOM GODT I GANG 4 Log ind 5 Kontrolpanel 6 Tilpas profil 7 Tilknyt hold 8 Tilknyt fag 9 SÅDAN OPRETTER DU EN QUIZ 10 Quiz info 11 Tilføj spørgsmål 12 Tilføj formel til

Læs mere

Quick Guide for TopSURV RTK

Quick Guide for TopSURV RTK Quick Guide for TopSURV RTK GRS-1 GNSS og TopSURV v7.x Version 1.00 August 2010 1 Topcon hurtig guide til GNSS GRS-1 GPS+Glonass Modtager. GRS-1 Skrivebord, Windows mobile 6.1 Start for navigering til

Læs mere

Graph brugermanual til matematik C

Graph brugermanual til matematik C Graph brugermanual til matematik C Forord Efterfølgende er en guide til programmet GRAPH. Programmet kan downloades gratis fra nettet og gemmes på computeren/et usb-stik. Det betyder, det også kan anvendes

Læs mere

SÅDAN BRUGER DU REGNEARK INTRODUKTION

SÅDAN BRUGER DU REGNEARK INTRODUKTION SÅDAN BRUGER DU REGNEARK INTRODUKTION I vejledningen bruger vi det gratis program Calc fra OpenOffice som eksempel til at vise, hvordan man bruger nogle helt grundlæggende funktioner i regneark. De øvrige

Læs mere

Vejledning til Club Counsellor i brug af RYE Database 2008

Vejledning til Club Counsellor i brug af RYE Database 2008 Vejledning til Club Counsellor i brug af RYE Database 2008 Indledning Multi District Denmark har udviklet en database til brug ved administration af udvekslingsstudenter. Databasen kan åbnes fra alle pc

Læs mere

Vælg det emneord, du vil bruge og klik på Continue. Nu vises de subheadings som knytter sig til emneordet:

Vælg det emneord, du vil bruge og klik på Continue. Nu vises de subheadings som knytter sig til emneordet: Embase Quick Guide Fritekstsøgning (Basic Search) Skriv dine søgeord i søgefeltet og klik på Search. Der er mulighed for at gøre søgningen bredere ved at vælge Include Related Terms". Avanceret søgnng

Læs mere

xgalleri Mulige filtyper Installation web-version

xgalleri Mulige filtyper Installation web-version xgalleri xgalleri opstod ud fra ønsket om at lægge en større samling billeder på nettet. Der findes mange programmer, som kan bruges til at lægge datafiler på nettet; men de fungerer typisk på den måde,

Læs mere

Fagligt indhold. Oplæg fra underviser Ar)kel Film Del af fagbog. Rammesætning. Indhold Form Evt. midler Distribu)on Deadline(s) Produk)on

Fagligt indhold. Oplæg fra underviser Ar)kel Film Del af fagbog. Rammesætning. Indhold Form Evt. midler Distribu)on Deadline(s) Produk)on En didaktisk model til ipadagogik Fagligt indhold Oplæg fra underviser Ar)kel Film Del af fagbog Rammesætning Indhold Form Evt. midler Distribu)on Deadline(s) Kobling )l praksis Produk)on Individuelt Gruppe

Læs mere

1. Opret din nye Google konto

1. Opret din nye Google konto Indhold 1. Opret din nye Google konto... 2 2. Test din nye konto... 5 3. Kom i gang med Gmail indstil sprog til dansk... 6 4. Gmail indhold på skærmen... 8 5. Skriv og send en mail... 9 Til:... 9 Cc:...

Læs mere

Brug af Office365 med Onedrive, nyeste Officepakke mv

Brug af Office365 med Onedrive, nyeste Officepakke mv Egedal Gymnasium og HF september 2014 Brug af Office365 med Onedrive, nyeste Officepakke mv Dette dokument beskriver, hvordan du kan opnå adgang til nogle resurser i skyen og hente ny software. Hvordan

Læs mere

Motto-Captura ApS, 2006. Ordblinde PDA. Lyt - lær - husk. Motto-Captura ApS, 2006 www.motto-catura.eu info@motto-captura.eu

Motto-Captura ApS, 2006. Ordblinde PDA. Lyt - lær - husk. Motto-Captura ApS, 2006 www.motto-catura.eu info@motto-captura.eu p1 Ordblinde PDA Lyt - lær - husk www.motto-catura.eu info@motto-captura.eu p2 p3 Vi håber meget, at du vil få glæde af løsningen. Du må meget gerne sende os forslag eller ringe til os. p4 Start Når du

Læs mere

FORMATERING AF REGNEARK

FORMATERING AF REGNEARK FORMATERING AF REGNEARK Indtil nu har vi set på, hvordan du kan udføre beregninger i dit regneark, og hvordan du kan redigere i regnearket, for hurtigt at få opstillet modellerne. Vi har derimod overhovedet

Læs mere

PubMed Vejledning. Fritekstsøgning (Basic search) Fremvisningsformater

PubMed Vejledning. Fritekstsøgning (Basic search) Fremvisningsformater PubMed Vejledning Vælg PubMed fra Fagbibliotekets hjemmeside. Så får du samtidig adgang til mange artikler i fuldtekst. Udenfor hospitalets netværk skal du gå ind via fjernadgang til DEFF. (www.tidsskrifter.deff.dk

Læs mere

Kom godt i gang med Quickpay

Kom godt i gang med Quickpay Kom godt i gang med Quickpay Quickpay er en betalingsløsning til at integrere alle gængse betalingskort på din webshop. På denne side kan du læse, hvordan du logger ind og sætter Quickpay-modulet på din

Læs mere

Vejledning til Kilometer Registrering

Vejledning til Kilometer Registrering Vejledning til Kilometer Registrering iphone Appen som holder styr på dit firma og privat kørsel. Udviklet af Trisect Development 2011. www.trisect.dk For iphone version 4.2 og nyere. Med Kilometer Registrering

Læs mere

Database "opbygning"

Database opbygning Database "opbygning" Dette områder falder mest under en DBA's ansvarsområde. Det kan sagtens tænkes at en database udvikler i nogle situationer vil blive nød til at oprette produktions og test) databaser,

Læs mere

15. oktober. Maskine Udlejning. Jacob Weng, Jeppe Boese og Mads Anthony. Udlejningsvirksomhed. Roskilde Tekniske Gymnasium 3.4

15. oktober. Maskine Udlejning. Jacob Weng, Jeppe Boese og Mads Anthony. Udlejningsvirksomhed. Roskilde Tekniske Gymnasium 3.4 Maskine Udlejning 15. oktober 2010 Jacob Weng, Jeppe Boese og Mads Anthony Roskilde Tekniske Gymnasium Udlejningsvirksomhed 3.4 Indholdsfortegnelse Problemformulering:... 2 Planlægning:... 2 Analyse af

Læs mere

Login. www.samsoegades-skole.skoleintra.dk. I denne lille folder beskrives nogle af de vigtigste funktoner i ForældreIntra:

Login. www.samsoegades-skole.skoleintra.dk. I denne lille folder beskrives nogle af de vigtigste funktoner i ForældreIntra: Login I denne lille folder beskrives nogle af de vigtigste funktoner i : Man finder som et link nederst til venstre på skolens offentlige Informationsportal. Adressen er: www.samsoegades-skole.skoleintra.dk

Læs mere

Forskningsnyheder om Huntingtons Sygdom På hverdagssprog Skrevet af forskere. Til det globale HS-fællesskab En baglæns besked gemt i HD-genet?

Forskningsnyheder om Huntingtons Sygdom På hverdagssprog Skrevet af forskere. Til det globale HS-fællesskab En baglæns besked gemt i HD-genet? Forskningsnyheder om Huntingtons Sygdom På hverdagssprog Skrevet af forskere. Til det globale HS-fællesskab En baglæns besked gemt i HD-genet? Lyn dine gener op! En baglæns besked, gemt i 'backup-dna'et'

Læs mere

Vejledning til teknisk serviceleder

Vejledning til teknisk serviceleder Indholdsfortegnelse Vejledning til teknisk serviceleder Indledning.. side 2 Login.. side 3 Mine anlæg... side 4 Søg ledig tid enkeltbooking side 6 Søg ny sæsontid.. side 11 Side 1 Indledning Det er vigtigt,

Læs mere

Kom godt i gang med NIS

Kom godt i gang med NIS Kom godt i gang med NIS Viden med videre Kom godt i gang Velkommen til NIS Kommuneinformations internetbaserede lovsystem. Denne lille folder giver dig en kort introduktion til arbejdet med NIS, så du

Læs mere

Guide - Sådan opretter du en backup

Guide - Sådan opretter du en backup Guide - Varighed: ca. 10 min Denne guide gennemgår hvordan en backup oprettes i Excovery. Guiden vil trinvist lede dig igennem processen og vil undervejs introducere de grundlæggende indstillingsmuligheder.

Læs mere

FSFIs lynguide til DFRs elektronisk bevissystem

FSFIs lynguide til DFRs elektronisk bevissystem FSFIs lynguide til DFRs elektronisk bevissystem Dette er en kort guide i anvendelsen af Dansk Førstehjælpsråd elektroniske bevissystem. Guiden viser og forklarer hvordan du som instruktør og medlem af

Læs mere

Opsætning af brugere og temaer i GIS4Mobile

Opsætning af brugere og temaer i GIS4Mobile Opsætning af brugere og temaer i GIS4Mobile Brugerne og deres adgang til data konfigureres gennem et webinterface, som nås via dette link: http://www.geosms.dk/g4m_websetup Grundlæggende skal det fremhæves

Læs mere

Brugervejledning til Højkvalitetsdokumentationen og Dialogforummet på Danmarks Statistiks hjemmeside

Brugervejledning til Højkvalitetsdokumentationen og Dialogforummet på Danmarks Statistiks hjemmeside Brugervejledning til Højkvalitetsdokumentationen og Dialogforummet på Danmarks Statistiks hjemmeside Forord Denne vejledning beskriver baggrunden for begreber og sammenhænge i Danmarks Statistiks dokumentationssystem

Læs mere

Ministeriet for Børn og Undervisnings forfattervejledning til ministeriets publikationer

Ministeriet for Børn og Undervisnings forfattervejledning til ministeriets publikationer Ministeriet for Børn og Undervisnings forfattervejledning til ministeriets publikationer Denne forfattervejledning er et bilag til de interne retningslinjer for udarbejdelse af publikationer Sammen med

Læs mere

Boringer PC Jupiter XL Import program

Boringer PC Jupiter XL Import program Boringer PC Jupiter XL Import program Dette særskilte program i det følgende kaldet importprogrammet - kan impotere diverse boringsoplysninger fra en JUPITER Access database til GE Boringer. Selve programmet

Læs mere

Lederguide INNOMATE HR - Oplæg. Log på Log på https://www.innomate.com/innomate/oceanteam/default.aspx med: MUS

Lederguide INNOMATE HR - Oplæg. Log på Log på https://www.innomate.com/innomate/oceanteam/default.aspx med: MUS Lederguide INNOMATE HR - Oplæg Log på Log på https://www.innomate.com/innomate/oceanteam/default.aspx med: Bruger ID: personalenummer Password: (eget password) INNOMATE HR er et Internetbaseret system,

Læs mere

Sådan får du en kirkegård på nettet i DKI-modellen!

Sådan får du en kirkegård på nettet i DKI-modellen! v./stegemüller & Sepstrup Side 1 09-04-2007 Sådan får du en kirkegård på nettet i DKI-modellen! Vi beskriver ret detaljeret, hvordan du kommer fra dit regneark med informationer fra gravsten til en hjemmeside,

Læs mere

BEC Selfservice (Internt)

BEC Selfservice (Internt) BEC Selfservice (Internt) Adgang: http://selfservice.bec.dk Jeg kan huske mit Windows-password Jeg kan huske mit etoken-password Husk at isætte et oken Jeg har udfyldt Questionnaire i SAM Self Service

Læs mere

Betinget formatering med fremhævning af celler der passer overens med betingelser

Betinget formatering med fremhævning af celler der passer overens med betingelser BETINGET FORMATERING Betinget formatering er en af de funktionaliteter i Excel 2007 som indeholder væsentlige ændringer, den er blevet mere grafisk og der kan skabes bedre visuelle effekter der kan anvendes

Læs mere

Kom i gang med... Kapitel 11 Math: Formelredigering med OpenOffice.org. OpenOffice.org

Kom i gang med... Kapitel 11 Math: Formelredigering med OpenOffice.org. OpenOffice.org Kom i gang med... Kapitel 11 Math: Formelredigering med OpenOffice.org OpenOffice.org Rettigheder Dette dokument er beskyttet af Copyright 2005 til bidragsyderne som er oplistet i afsnittet Forfattere.

Læs mere

Indholdsfortegnelse. Login 1. Glemt password 2. Ændre personlige oplysninger 2. Min side 3. Global meldingsboks 5. Administrerede sager 7

Indholdsfortegnelse. Login 1. Glemt password 2. Ændre personlige oplysninger 2. Min side 3. Global meldingsboks 5. Administrerede sager 7 Klient Indholdsfortegnelse Login 1 Glemt password 2 Ændre personlige oplysninger 2 Min side 3 Global meldingsboks 5 Administrerede sager 7 Sagsoversigt 9 Oversigt sager 11 Statistik sager 12 Beskeder 14

Læs mere

Vejledning til udskrivning af etiketter/labels og konvolutter i Blåt Medlem

Vejledning til udskrivning af etiketter/labels og konvolutter i Blåt Medlem Vejledning til udskrivning af etiketter/labels og konvolutter i Blåt Medlem Blåt Medlem giver mulighed for at udskrive etiketter/labels og kuverter til medlemmerne af den enhed man er medlemsansvarlig

Læs mere

Lønstigning mellem to selvvalgte perioder (Rapport-ID: 67)

Lønstigning mellem to selvvalgte perioder (Rapport-ID: 67) Lønstigning mellem to selvvalgte perioder (Rapport-ID: 67) 1. Hvad er formålet med rapporten? I denne rapport kan du sammenligne lønnen på to forskellige selvvalgte tidspunkter (to løngenerationer) pr.

Læs mere

Indholdsoversigt. Emne. Side

Indholdsoversigt. Emne. Side Indholdsoversigt Emne o Log-in på din Idify Tidslinje Åben Idify Timeline på din ipad Indtast dine log-in oplysninger o Navigation af din tidslinje Tidslinjens oversigt Åbne Favorit erindring Navigér og

Læs mere

Detection of gene doping. Roskilde Universitetscenter. 1.semesterprojekt, hus 13.1 Naturvidenskabelig Basisstudium Efteråret 2007

Detection of gene doping. Roskilde Universitetscenter. 1.semesterprojekt, hus 13.1 Naturvidenskabelig Basisstudium Efteråret 2007 Sporing af gendoping Detection of gene doping Roskilde Universitetscenter 1.semesterprojekt, hus 13.1 Naturvidenskabelig Basisstudium Efteråret 2007 Gruppe 8 Anders Samsøe-Petersen Annika Vilstrup Aras

Læs mere

Qbrick s krav til video filtyper

Qbrick s krav til video filtyper Indhold Qbrick s krav til video filtyper... 1 Krav til ordningen/området... 1 Qbrick s krav til video leverandør... 1 Video og billede størrelser i WCM:... 1 Upload en video... 2 Trin 1: Mediefiler...

Læs mere

En nem vej til viden - www.statistikbanken.dk

En nem vej til viden - www.statistikbanken.dk En nem vej til viden - www.statistikbanken.dk Kom i gang med Statistikbanken Statistikbanken er Danmarks Statistiks offentlige database, hvor alle kan få adgang til relevant statistik, der beskriver det

Læs mere

Guide til upload af ruter og interessepunkter på Endomondo

Guide til upload af ruter og interessepunkter på Endomondo Guide til upload af ruter og interessepunkter på Endomondo Denne guide indeholder følgende emner: A. Rettigheder B. Oprettelse af profil på Endomondo C. Oprettelse af selve ruten D. Redigering af oprettet

Læs mere

EVALUERING I SURVEYXACT TRIN FOR TRIN

EVALUERING I SURVEYXACT TRIN FOR TRIN EVALUERING I SURVEYXACT TRIN FOR TRIN LÆR AT TACKLE 2015 KOMITEEN FOR SUNDHEDSOPLYSNING 1 INDLEDNING Komiteen for Sundhedsoplysning stiller SurveyXact et internetbaseret redskab til kvalitetssikring til

Læs mere

Når du har logget dig ind, ser du Randers Kommunes byvåben midt på siden. I venstre side er der en række mapper:

Når du har logget dig ind, ser du Randers Kommunes byvåben midt på siden. I venstre side er der en række mapper: DXP vejledning Generelt: DXP er et værktøj til at fremstille præsentationsmaterialer (foldere, brochurer, løbesedler mv.) DXP egner sig kun til mindre brochurer og lign., da den største skabelon kan rumme

Læs mere

Kvadratrodsberegning ved hjælp af de fire regningsarter

Kvadratrodsberegning ved hjælp af de fire regningsarter Kvadratrodsberegning ved hjælp af de fire regningsarter Tidligt i historien opstod et behov for at beregne kvadratrødder med stor nøjagtighed. Kvadratrødder optræder i forbindelse med retvinklede trekanter,

Læs mere

Hjemmeside manual. Indholdsfortegnelse. Noter: - 1 -

Hjemmeside manual. Indholdsfortegnelse. Noter: - 1 - Hjemmeside manual Indholdsfortegnelse Login... - 2 - Login på din hjemmeside og generel support info... - 2 - Kontrolpanel... - 3 - Opdatering af profil oplysninger... - 3 - Menu... - 4 - Menupunkter...

Læs mere

Søgeeksempel i PubMed:

Søgeeksempel i PubMed: 1 Søgeeksempel i PubMed: Tværfagligt samarbejde omkring genoptræning efter udskrivning fra hospital Første skridt: Opløs problemformuleringen i de søgeord som dækker problemstillingen og endelig ikke flere

Læs mere

Fra Blåt Medlem til Open Office regneark.

Fra Blåt Medlem til Open Office regneark. Fra Blåt Medlem til Open Office regneark. Kopi fra Blåt Medlem til Open Office regneark 1 Eksport fra Blåt Medlem til Open Office regneark 2 Hvad kan du bruge det til 4 Eksempler: Medlemsdelen: Afdelingsopdelt

Læs mere

APPENDIX A INTRODUKTION TIL DERIVE

APPENDIX A INTRODUKTION TIL DERIVE APPENDIX A INTRODUKTION TIL DERIVE z x y z=exp( x^2 0.5y^2) CAS er en fællesbetegnelse for matematikprogrammer, som foruden numeriske beregninger også kan regne med symboler og formler. Det betyder: Computer

Læs mere

PHP 3 UGERS FORLØB PHP, MYSQL & SQL

PHP 3 UGERS FORLØB PHP, MYSQL & SQL PHP 3 UGERS FORLØB PHP, MYSQL & SQL Uge 1 & 2 Det basale: Det primære mål efter uge 1 og 2, er at få forståelse for hvordan AMP miljøet fungerer i praksis, og hvordan man bruger PHP kodesproget til at

Læs mere

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på politi.dk. Rigspolitiets websektion

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på politi.dk. Rigspolitiets websektion RIGSPOLITIET Vejledning i konvertering fra Word -dokument til PDF-fil på politi.dk Rigspolitiets websektion Indledning Da vi skal leve op til kravene om tilgængelighed på Internettet, skal alle tekster

Læs mere

BEGREBER I DANTEK... 2 LOG IND PÅ DANTEK WEBBOOKING... 3 SØGNING... 5 SØGERESULTATET... 8 LÅN FRA UDLÅNSSAMLINGEN... 11

BEGREBER I DANTEK... 2 LOG IND PÅ DANTEK WEBBOOKING... 3 SØGNING... 5 SØGERESULTATET... 8 LÅN FRA UDLÅNSSAMLINGEN... 11 BEGREBER I DANTEK... 2 SAMLINGER... 2 Informationssamlingen... 2 Udlånssamlingen (sætsamlingen)... 2 BOOKING... 2 RESERVERING... 2 LOG IND PÅ DANTEK WEBBOOKING... 3 SØGNING... 5 SIMPEL SØGNING... 5 AVANCERET

Læs mere

http://www.fya.byethost13.com/forside.html

http://www.fya.byethost13.com/forside.html I dette dokument forklares den basale brug af TeX, et programmeringssprog velegnet til at skrive matematiske dokumenter i, som det foregår i TeXnicCenter. De programmer, der skal bruges kan findes via

Læs mere

Billeder på hjemmeside

Billeder på hjemmeside Billeder på hjemmeside Indholdsfortegnelse Emne 1. Billedredigering (Microsoft Picture Manager) Side 3 a. Komprimer billeder b. Beskæring af billeder 3 9 2. Billeder og tekst ved hjælp af en skabelon (Template

Læs mere

IT-manual August 2014

IT-manual August 2014 IT-manual August 2014 Indhold IT-pixibog Opgave i brug af Lectio At skrive store opgaver i Word Opgave i at bruge Words specialfunktioner 1 IT-pixibog Skolens computere - låner jeg en computer? - hente

Læs mere

Indholdsfortegnelse Databaser og PHP... 3 Opgave... 4 Opgave... 5 Opgave... 6 Sidste opgave er en lille gæstebog... 7 Kilder og nyttige links:...

Indholdsfortegnelse Databaser og PHP... 3 Opgave... 4 Opgave... 5 Opgave... 6 Sidste opgave er en lille gæstebog... 7 Kilder og nyttige links:... Indholdsfortegnelse Databaser og PHP... 3 Opgave... 4 Opgave... 5 Opgave... 6 Sidste opgave er en lille gæstebog... 7 Kilder og nyttige links:... 9 Nogle HTML tags... 9 Databaser og PHP Når vi snakker

Læs mere

Eksamensspørgsmål til biocu til mandag d. 10. juni 2013

Eksamensspørgsmål til biocu til mandag d. 10. juni 2013 Eksamensspørgsmål til biocu til mandag d. 10. juni 2013 Nr. 1. Fra gen til protein. Hvordan er sammenhængen mellem DNA ets nukleotider og proteinets aminosyrer? Beskriv hvad der sker ved henholdsvis transskription

Læs mere

SDBF QUICKGUIDE SKOLERNES DIGITALE BLANKET FLOW 1. - SUPERBRUGERE OG MEDLEMMER AF RETTIGHEDSGRUPPER -

SDBF QUICKGUIDE SKOLERNES DIGITALE BLANKET FLOW 1. - SUPERBRUGERE OG MEDLEMMER AF RETTIGHEDSGRUPPER - SDBF QUICKGUIDE SKOLERNES DIGITALE BLANKET FLOW 1. - SUPERBRUGERE OG MEDLEMMER AF RETTIGHEDSGRUPPER - INTRODUKTION TIL SKOLERNES DIGITALE BLANKET FLOW Vi er glade for at kunne byde velkommen til opdateret

Læs mere

Oprette en AMS route til andet TwinCAT System

Oprette en AMS route til andet TwinCAT System APP-NOTE 609015 Beckhoff Application Note Date: 6/7/2010 Document Status: Rev. 1.0 Beckhoff Automation Aps Naverland 2, DK-2600 Glostrup Phone +45 43 46 76 20 Fax +45 43 46 63 35 OVERVIEW Denne applikations

Læs mere

RESPONSE 2.0. Kursusmanual til grundlæggende funktioner ASPEKT R&D

RESPONSE 2.0. Kursusmanual til grundlæggende funktioner ASPEKT R&D RESPONSE 2.0 Kursusmanual til grundlæggende funktioner ASPEKT R&D Indholdsfortegnelse Indholdsfortegnelse...2 Kort om Response:... 3 Lektion 1: Indledende overvejelser...4 Strategiske overvejelser...4

Læs mere

IT-Brugerkursus. Modul 1 - Introduktion til skolens netværk og FC. Modul 1 - Introduktion til FC og Lectio. Printvenligt format. Indholdsfortegnelse

IT-Brugerkursus. Modul 1 - Introduktion til skolens netværk og FC. Modul 1 - Introduktion til FC og Lectio. Printvenligt format. Indholdsfortegnelse Modul 1 - Introduktion til FC og Lectio IT-Brugerkursus Modul 1 - Introduktion til skolens netværk og FC Printvenligt format Indholdsfortegnelse Formål og opbygning Opgave Vejledning til intranettet Åbne

Læs mere

Quickguide til skoleadministrator Skriftsproglig udvikling. Administrators rolle. Kom godt i gang

Quickguide til skoleadministrator Skriftsproglig udvikling. Administrators rolle. Kom godt i gang Quickguide til skoleadministrator Skriftsproglig udvikling Denne quickguide gennemgår de vigtigste trin, du som skoleadministrator skal igennem, når du benytter Skoleportalen til afvikling af prøver i

Læs mere

Åbn Paint, som er et lille tegne- og billedbehandlingsprogram der findes under Programmer i mappen Tilbehør. Åbn også Word.

Åbn Paint, som er et lille tegne- og billedbehandlingsprogram der findes under Programmer i mappen Tilbehør. Åbn også Word. 75 Paint & Print Screen (Skærmbillede med beskæring) Åbn Paint, som er et lille tegne- og billedbehandlingsprogram der findes under Programmer i mappen Tilbehør. Åbn også Word. 1. Minimer straks begge

Læs mere

TRAKA21 MANUAL 10/2/2015 - VERSION 1.1

TRAKA21 MANUAL 10/2/2015 - VERSION 1.1 TRAKA21 MANUAL 10/2/2015 - VERSION 1.1 1 2 INDHOLD Afsnit Omhandler Side 1 Kontakt information Ruko 3 2 Hvad og hvem er denne guide for? 3 3 Hvad indeholder pakken, når Traka21 leveres? 3 4 Montering af

Læs mere