Databasesøgning med BLAST

Størrelse: px
Starte visningen fra side:

Download "Databasesøgning med BLAST"

Transkript

1 Databasesøgning med BLAST Denne vejledning giver en introduktion til databasesøgning med forskellige programmer i BLAST-familien. Vejledningen indeholder først en grundig introduktion og gennemgang af de forskellige BLAST-programmer og dernæst en grundig kogebogsgennemgang af en af BLASTprogrammernes mange facetter. Til sidst følger øvelser og opgaver som kan løses ved hjælp af BLAST. Vejledningen er skrevet til brug i MEGA, men kan uden problemer generaliseres til brug i en almindelig internet-browser. Se link 3 i tema 12 i Bioteknologi 6 for en introduktion til MEGA. Introduktion BLAST er en forkortelse for Basic Local Alignment Search Tool. Navnet angiver meget præcist hvad det er BLAST kan, nemlig at finde små stykker sekvens i en database der svarer til en søgesekvens man allerede har. Helt grundlæggende har man en søgesekvens (query sequence) og en database denne søgesekvens skal sammenlignes med. Valg af database skal overvejes nøje da forskellige valg har forskellige fordele og ulemper. Der findes forskellige BLAST-metoder, men fælles for dem alle er at de kun søger efter lokale alignments. En lokal alignment er en alignment mellem en mindre del af en søgesekvens og en mindre del af en databasesekvens der er meget lig hinanden. De mange forskellige BLASTmetoder kan overordnet inddeles i to hovedtyper, de proteinbaserede metoder og de nucleotidbaserede metoder. Herunder følger en grundig introduktion til de forskellige BLASTtyper. Protein BLAST Protein BLAST-metoderne kan ofte finde relevante sekvenser fra meget fjernt beslægtede organismer idet proteinsekvenser udvikler sig meget langsommere end DNA-sekvenser. Der findes i øjeblikket flere forskellige protein BLAST-algoritmer. BLASTP er den letteste at starte med. For de særligt interesserede er der herunder også en gennemgang af flere af alternativerne. Nye brugere af BLAST kan med fordel nøjes med at læse om BLASTP. BLASTP Søgesekvensen er protein og databasen man sammenligner med, indeholder kun proteinsekvenser. Bemærk at søgesekvensen skal angives i et-bogstavs-aminosyrekoderne, se Bioteknologi 6, side 10. Princippet i metoden er at ens søgesekvens sammenlignes med en database med andre proteinsekvenser. Analyserer man den genetiske kode, ses det at ikke alle aminosyresubstitutioner er lige sandsynlige, og mange aminosyreændringer kræver mere end en mutation i det samme codon. Derfor forventer vi at der er forskel på, hvor ofte vi ser forskellige aminosyresubstitutioner. Denne information udnyttes ved at man bruger såkaldte substitutionsmatricer i søgningen. En substitutionsmatrice er en empirisk bestemt matrice der viser, hvor ofte bestemte aminosyrer ændres til andre aminosyrer når man sammenligner homologe sekvenser. Denne information benyttes når man skal finde homologe sekvenser i en database. Benytter man forskellige substitutionsmatricer kan det give forskellige søgeresultater, men med mindre man er ekspert eller af anden årsag har information der gør det relevant at skifte substitutionsmatrice, kan det anbefales blot at benytte standardmatricen (BLOSUM62) der i langt de fleste tilfælde fungerer fornuftigt. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

2 Alternative protein-blast metoder BLASTX Søgesekvensen er en nucleotidsekvens, men denne translateres til en proteinsekvens inden søgningen. Databasen indeholder kun proteinsekvenser. BLASTP-algoritmen bruges med den translaterede søgesekvens. BLASTX bruges ofte når en nucleotidbaseret BLAST-metode som BLASTN ikke har fundet relevante resultater i nucleotiddatabaserne. Metoden kan selvfølgelig kun bruges når ens nucleotidsekvens koder for et protein. Dette kunne eksempelvis være en mrna-sekvens. TBLASTN TBLASTN er en særlig udgave af BLASTP hvor søgesekvensen er en proteinsekvens, og databasen man benytter, er en nucleotiddatabase der oversættes til protein ved hjælp af den genetiske kode. Oversættelsen af nucleotidsekvenserne til proteinsekvenser sker i alle tre mulige læserammer. Bortset fra det er det en helt normal BLASTP-algoritme der køres. Denne metode benyttes primært når BLASTP ikke har fundet relevante resultater. Manglen på resultater med BLASTP kan skyldes at der ikke findes så mange proteinsekvenser i proteindatabaserne som nucleotidsekvenser i nucleotiddatabaserne. Forklaringen på dette er at det i dag er lettere, hurtigere og billigere at lave nucleotidsekventering end proteinsekventering. TBLASTX I TBLASTX er søgesekvensen en nucleotidsekvens, men denne translateres til protein inden søgningen, og databasen indeholder translaterede nucleotidsekvenser som i TBLASTNmetoden. Denne metode er meget lig TBLASTN, den eneste forskel er at søgesekvensen er en nucleotidsekvens. TBLASTX bruges primært til at lede efter sekvenser fra fjernt beslægtede organismer når BLASTN ikke kan finde relevante resultater i nucleotiddatabaserne, og man ved at ens nucleotidsekvens er proteinkodende. PSI-BLAST PSI-BLAST er i dag nok den mest benyttede protein BLAST-metode. Metoden tager udgangspunkt i en standardkørsel med BLASTP og laver så en sekvensprofil baseret på ligheder i BLASTP-resultaterne. Derefter søges databasen igennem igen baseret på denne sekvensprofil. På denne måde findes mere fjernt beslægtede sekvenser der ikke dukker op med en normal BLASTP-søgning. Denne proces gentages så en række gange hvor de nye resultater hver gang bruges til at opdatere sekvensprofilen. Efter et antal søgninger skulle resultaterne gerne pege på det samme sæt proteiner hver gang, og dermed er metoden færdig. PSI-BLAST er en meget følsom algoritme og finder derfor i nogle tilfælde sekvenser der ikke er homologe, men ensartede ved et tilfælde. Derfor er det altid vigtigt at brugeren har en kritisk tilgang til resultaterne af en PSI-BLAST-søgning. PHI-BLAST og DELTA-BLAST PHI-BLAST er en udvidelse af PSI-BLAST hvor man kan definere, at man leder efter særlige proteinmotiver. Et motiv er i denne sammenhæng blot et kort stykke af proteinsekvensen man ved er meget bevaret i mange arter. Det kan eksempelvis være et bestemt motiv der findes i en række membranreceptorproteiner. Et eksempel kunne være et ni aminosyrer langt motiv hvor de fem centrale aminosyrer varierer, men de to yderste er bevarede i alle undersøgte organismer. Et sådant motiv kunne fx skrives på denne måde: MW?????NG. Til at definere motivet man leder efter, bruges et simpelt programmeringssprog. Ovenstående motiv skrives eksempelvis sådan: M-W-x(5)-N-G. Med lidt træning kan man hurtigt lære at bruge dette simple programmeringssprog. DELTA-BLAST er en nyudviklet metode meget lig PHI-BLAST. Metoden skulle ifølge udviklerne være markant hurtigere og lidt bedre end PHI-BLAST. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

3 Nucleotid BLAST BLASTN I BLASTN er søgesekvensen en nucleotidsekvens, enten RNA eller DNA, og databasen man sammenligner med, indeholder kun nucleotidsekvenser. Nucleotid BLAST-metoderne har den store fordel i forhold til de proteinbaserede metoder, at de kan bruges til at undersøge de store dele af genomet, der ikke koder for proteiner. I menneskets tilfælde drejer det sig om ca. 99 % af genomet. Den mest almindeligt benyttede nucleotid BLAST kaldes BLASTN. Derudover findes der et væld af alternative metoder hvor der her kun nævnes MegaBLAST, og i langt de fleste tilfælde kan man nøjes med at bruge BLASTN. I modsætning til BLASTP baserer BLASTN sig ikke på en empirisk bestemt substitutionsmatrice, men blot på en simpel lokal alignment algoritme. BLASTN kan bruges til at sammenligne og finde homologe sekvenser i alle kombinationer af RNA- og DNA-sekvenser, ligegyldigt om de er proteinkodende eller ej. MegaBLAST MegaBLAST er en markant hurtigere nucleotidbaseret algoritme end BLASTN. Metoden kan dog kun benyttes til at finde meget ensartede sekvenser. Hvis forskellen mellem søgesekvensen og databasesekvenserne overskrider et par procent, er MegaBLAST ikke følsom nok til at finde de homologe sekvenser, og man bør i stedet benytte den mere generelle, men også markant langsommere BLASTN. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

4 BLAST i praksis I denne del af vejledningen gennemgås en BLASTP-søgning. Desuden præsenteres forskellige funktioner og muligheder for at tilpasse søgealgoritmen. Der findes en lang række forskellige databaser online som man kan sammenligne sin søgesekvens med. En af de mest benyttede databaser er Genbank der kan findes på adressen: Når man åbner ovenstående link, kommer man til et skærmbillede som vist herunder, hvor man kan vælge hvilken type BLAST, man ønsker at udføre. BLAST kan køres direkte fra alignment explorer delen af MEGA. BLAST-funktionen findes under fanebladet Web og funktionen Do BLAST search. Hvis man markerer en sekvens i alignment explorer og vælger Do BLAST search, åbnes Genbanks BLAST-side i et specielt MEGA-browser-vindue. Dette har den fordel at sekvenser man måtte finde og ønske at tilføre sin alignment, let kan tilføjes ved at trykke på knappen med det røde plus og teksten Add to alignment. Hvorvidt man ønsker at benytte MEGA eller blot en almindelig browser er principielt ligegyldigt. MEGA giver dog en let og hurtig måde at tilføje nye sekvenser til en alignment på, så i den resterende del af denne vejledning vil denne metode blive benyttet. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

5 Min første protein-blast i MEGA I denne øvelse bruges BLASTP til at lede efter homologe sekvenser til menneskets præproinsulin-protein og danne en multipel alignment ud fra resultaterne. Denne øvelse er lavet som en grundig kogebogsgennemgang af BLASTP-programmets mange facetter. 1. Åbn MEGA og opret en ny protein-alignment, dette gøres ved at vælge knappen Align og herefter funktionen Edit/Build Alignment. Vælg herefter protein, og så skulle der gerne være en blank alignment explorer klar til brug. 2. Download søgesekvensen fra linket: 3. Indlæs sekvensen ved hjælp af fanebladet Edit og herefter funktionen Insert Sequence From File. Dit skærmbillede skulle nu gerne se nogenlunde ud som vist herunder: 4. Markér sekvensen ved at trykke på navnet og vælg Web og funktionen Do BLAST Search. Nu åbnes et MEGA browser-vindue hvor den øverste del ser ud som vist herunder: Læg mærke til at søgesekvensfeltet Enter Query Sequence allerede er udfyldt med den ønskede sekvens. Under feltet Job Title kan man give søgningen et navn. Hvis ikke man navngiver søgningen, får den et standardnavn. Læg også mærke til at man let kan skifte mellem de forskellige BLAST-programmer. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

6 5. Brug nu scroll-knappen til at gå længere ned på siden og find de to underafsnit der hedder Choose Search Set og Program Selection. Skærmbilledet herunder viser dette. Her skal kan man træffe en række valg som for eksempel hvilken database man vil sammenligne med søgesekvensen. I feltet Organism kan man tilvælge eller fravælge arter i databasen. Dette er særligt nyttigt hvis man har prøvet at køre en søgning og fået hundredvis af resultater fra eksempelvis mennesket, og man ikke er interesseret i disse. Ved at skrive human og trykke på exclude-knappen undgår man sekvenser fra mennesket i næste søgning. Sidst, men ikke mindst skal man vælge hvilken algoritme man ønsker at benytte blandt BLASTP, PSI-BLAST, PHI-BLAST eller DELTA-BLAST. De forskellige databaser opdateres løbende, og der vil derfor forekomme ændringer med tiden, men da denne vejledning blev skrevet, var der følgende database-muligheder: Non-redundant protein sequences (nr) Standarddatabasen med alle sekvenser i Genbank Reference proteins (refseq_protein) Kun sekvenser hvis funktion kendes UniprotKB/Swissprot (swissprot) Kun sekvenser hvis funktion er eksperimentelt bestemt Patented protein sequences (pat) En database over sekvenser der er søgt patent på Protein Data Bank proteins (pdb) En database over sekvenser med kendte proteinstrukturer Metagenomic proteins (env_nr) Sekvenser fundet i økologiske undersøgelser, art ofte ukendt 6. Vælg databasen Reference proteins (refseq_protein) og algoritmen BLASTP til at lave søgningen i databasen. Hvis du har valgt dette, bør det se ud som vist på skærmbilledet ovenfor. Det er værd at afprøve hvad der sker, hvis du søger i forskellige databaser eller bruger forskellige algoritmer. 7. Brug nu scroll-knappen til at gå længere ned på siden og find de tre underafsnit der hedder General parameters, Scoring parameters og Filters and Masking. Skærmbilledet på næste side viser dette. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

7 General Parameters Her anbefaler jeg at man i langt de fleste tilfælde beholder standardværdierne, men hvis man vil ændre dem er her en kort beskrivelse af nogle af de væsentligste af funktionerne. Max target sequences Hvis man ønsker flere eller færre resultater end de 100, som er standard, kan det ændres her. Word size Hvis man ønsker en mere følsom søgning på mindre dele af ens søgesekvens, kan man ændre denne fra 3 til 2, dette resulterer i længere søgetid og højere sensitivitet, men måske også i et mindre overskueligt resultat. Expect threshold Denne funktion definerer søgningens specificitet ved at sætte en grænse for hvor statistisk signifikant et resultat skal være, før det medtages i resultaterne. Her betyder værdien 10 at vi kan forvente, at der i gennemsnit vil dukke 10 ikke-homologe sekvenser op der ved et rent tilfælde er ens nok med søgesekvenser, til at de kommer frem. Hvis man ønsker større sikkerhed for, at de fundne sekvenser er homologe med ens søgesekvens, skal værdien sættes ned. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

8 Scoring parameters Også her foreslår jeg at standardværdierne benyttes, men bemærk at MEGA desværre ikke benytter BLAST-standardværdierne. Ændringer fra standardværdierne er markeret med gult. 1. I feltet Compositional adjustments vælges standardværdien som er Composition-based statistics 2. I feltet Matrix kan man vælge mellem flere forskellige empirisk baserede substitutionsmatricer, BLOSUM62 er standardvalget og bør bibeholdes med mindre man har god grund til andet. 3. Den sidste funktion Gap Costs kontrollerer hvor mange og lange gaps - der kan indsættes i sekvensalignments, før en alignment i stedet deles i to. Heller ikke her bør den uøvede bruger ændre på standardværdien. Filters and Masking De tre funktioner herunder har alle at gøre med repetitive elementer i søgesekvensen. Repetitive elementer er dele af en sekvens der findes mange forskellige steder i genomet, og bliver de ikke ignoreret (maskeret) i søgningen, vil resultatet blive en lang række ofte ikke homologe sekvenser. Se siderne i bioteknologi 6 for en grundigere gennemgang af forskellige typer af repetitive elementer. Hvis man ved at en del af ens søgesekvens er repetitiv, kan man markere dette ved at skrive denne del af søgesekvensen i søgesekvensfeltet med små bogtaver og herefter markere Mask lower case letters. Man kan også lade søgeprogrammet definere dele af sekvensen der ser repetitiv ud ved at markere Low complexity regions. Hvis man vælger at lade programmet lede efter repetitive regioner, anbefaler jeg at man også vælger Mask for lookup table only. 4. Marker alle tre ovenævnte muligheder. 5. Sæt kryds i feltet Show results in a new window. 6. Start BLASTP-søgningen ved at trykke på den blå BLAST-knap. Nu dukker følgende vindue op, vinduet er et såkaldt ventevindue der opdateres løbende, mens søgningen er i gang: Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

9 BLAST-Resultater Efter forhåbentlig kort tid ændres vinduet til at vise resultaterne af din søgning. Øverste del af resultatvinduet er vist herunder: Det vigtige her er at du kan få forskellige analyser af dine resultater, og du kan ændre på hvordan dine resultater bliver vist. Ændringer til resultatopsætningen gøres i Formatting options. Du kan desuden downloade resultaterne til en fil med Download -funktionen. På linjen i bunden af billedet der starter med Other reports, kan du få en række interessante oversigter over dine resultater. 1. Scroll ned til skærmbilledet ser ud som vist her til højre. Hver linje repræsenterer et resultat, og jo højere oppe på listen, jo større lighed har resultatet med ens søgesekvens. 2. Placer musen henover den øverste røde linje. Nu vises information omkring denne sekvens i det øverste hvide felt. Her ses at sekvensen har Genbanknavnet NP_000198, er et insulin-præproprotein fra mennesket, alignment scoren er 231 og E-værdien er 1,6 x E-værdien siger groft sagt hvor mange ikke-homologe sekvenser i databasen vi forventer, vil være lige så godt et match med søgesekvensen ved et tilfælde. Eller sagt på en anden måde, det er et mål for hvor sandsynligt det er, at den fundne sekvens ikke er homolog med søgesekvensen, og denne værdi er ekstrem lav hvilket indikerer, at der er meget stærkt statistisk belæg for at den fundne sekvens er homolog med søgesekvensen. Jo lavere E-værdi, jo mere sandsynligt er det at søgesekvensen og resultatsekvensen er homologe sekvenser. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

10 3. Scroll lidt længere ned på resultatsiden til underafsnittet Descriptions. Se billedet herunder. Læg mærke til at jeg her har valgt øverst på siden under Formatting options kun at vise 10 resultater. Her er de 10 bedste resultater opsummeret. I forhold til før er der tre kolonner mere. Den ene hedder Query coverage og viser hvor stor en procentdel af søgesekvensen der er alignet til denne resultatsekvens. E- værdien (E-value) er ekstremt lille for alle 10 resultater. Kolonnen Max ident viser i hvor mange procent søgesekvensen og resultatsekvensen er ens i den dannede parvise alignment. Nederste match på listen har beskrivelsen PREDICTED: insulin-like og er fra en hest Equus caballus. At en sekvens kaldes predicted betyder at den ikke er eksperimentelt undersøgt, men at bioinformatiske undersøgelser tyder på at dette er et insulinlignende protein. Generelt er sekvens-id-navne der starter med NP eksperimentelt undersøgte, mens ID-navne der starter med XP, kun er undersøgt ved hjælp af bioinformatik. 4. Undersøg hvilke arter de 10 sekvenser kommer fra og hvilken funktion de enkelte proteiner har. 5. Der er flere sekvenser fra heste på listen, hvad kan årsagen til dette være? 6. Scroll længere ned på siden til underafsnittet Alignments. Nu ses følgende som en del af skærmbilledet: Nederst ser vi den dannede parvise alignment mellem søgesekvensen og resultatsekvensen. Scroller man endnu længere ned på siden, vises resten af resultatsekvenserne også. Ser man nærmere på den parvise alignment, ser man at søgesekvensen (query) er øverst og resultatsekvensen (Sbjct) er nederst, mens der mellem dem er en såkaldt konsensussekvens. I dette tilfælde hvor de to sekvenser er ens, er konsensussekvensen blot den samme sekvens. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

11 En anden ting der er værd at bemærke, er at første del af søgesekvensen, bortset fra den første methioninaminosyre, er skrevet med små bogstaver i en grå farve. Dette betyder at BLASTP har behandlet denne del af sekvensen som et repetitivt område, og derfor har denne del af søgesekvensen ikke været brugt til at finde de resulterende sekvenser, men som jeg nævnte tidligere kan man stadig få programmet til at udvide den parvise alignment til at dække hele søgesekvensen, hvis det giver mening. Det er præcis det der er sket i dette tilfælde. 7. Hvor mange aminosyrer er henholdsvis ens og forskellige i de to viste sekvenser? 8. Tryk på det blå GENE ID: 3630 INS link. Du kommer nu til PubMed-artikeldatabasen hvor du kan finde og læse videnskabelige artikler om denne sekvens. 9. Vend tilbage til BLAST-resultaterne og scroll ned til alignment nummer 6. Databasesekvensen er fra en hund (Canis lupus familiaris). Den del ser ud som vist på nedenstående skærmbillede: Vi ser med det samme at der i dette tilfælde kun er 97 ud af de 110 aminosyrer, der er i søgesekvensen som er ens i resultatsekvensen, hvilket giver en identitet på ca. 88 %. Hvis vi ser på den viste alignment, kan vi nu se at konsensussekvensen har 12 felter, hvor der ikke står noget bogstav, det skyldes at søgesekvensen og resultatsekvensen i denne alignmentposition er forskellige. Et enkelt sted ser vi et + i konsensussekvensen, på billedet har jeg valgt at fremhæve dette med gult. Aminosyrerne i de to sekvenser er henholdsvis S (serin) og A(alanin). Et sådan + betegnes som en positiv. Positive er summen af identiske aminosyrer og nogle særlige forskelle i enkelte positioner i alignmenten, disse forklares nærmere i boksen øverst på næste side. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

12 Positive En positiv i en BLAST-alignment indikerer at denne aminosyre har udviklet sig specielt interessant. Forklaringen findes ved at sammenligne den substitionsmatrice der bruges i søgningen (BLOSUM62), og den fulde liste af resultater. Hvis en bestemt ændring oftere forekommer mellem søgesekvensen og forskellige sekvenser i databasen end hvad man statistisk ville forvente ud fra substitutionsmatricen, kalder vi den for en positiv. En positiv er en indikation af at netop denne aminosyre tilsyneladende er så funktionel vigtig, at den samme ændring er sket flere gange igennem evolutionen i flere forskellige arter end vi vil forvente sker ved et tilfælde. 10. Undersøg hvorvidt den samme aminosyreændring S/A i samme position i proteinet kan findes i andre sekvensalignments. Hvis du finder nogle, så forklar hvorvidt der er tale om parallel evolution. 11. Tryk nu på linket ud for hundens sekvens gi NP_ Nu kommer du ind på Genbanksiden for denne sekvens. Der er mange informationer i disse databaser, her vil vi kun fokusere på to ting. Skærmbilledet bør nu se ud som vist herunder: Hvis vi starter med det med rødt markerede link, så er det et link til mrna for dette protein. Hvis man skulle ønske at arbejde med mrna et i stedet for proteinsekvensen, kan den findes ved at trykke på dette link. Den anden vigtige ting er FASTA -linket der er markeret med gult på skærmbilledet. FASTA er et sekvensformat og trykker man på linket, får man proteinsekvensen frem i et let tilgængeligt format der nemt kan tilføjes til ens alignment. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

13 12. Tryk på FASTA linket, nu bør skærmbilledet se ud som vist herunder: Nu ser du den 110 aminosyrer lange sekvens. 13. Tryk på knappen øverst med det røde plus og titlen Add to alignment. Nu kommer alignment explorer-vinduet frem samt et vindue hvor du kan indtaste information om den tilføjede sekvens. 14. Det eneste der skal ændres, er den nederste tekstboks hvor der står Sequence Label. Erstat det skrevne med Insulin-preproprotein-hund og tryk på OK-knappen. Dit alignment explorer-vindue skulle nu gerne have to sekvenser, den oprindelige fra mennesket og den nye fra hunden. Skærmbilledet bør se ud i stil med det viste øverst på næste side. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

14 Da de to sekvenser var præcis lige lange, er de allerede alignet ganske fornuftigt. Læg mærke til at der flere steder er en forskellig aminosyre i de to proteinsekvenser. I alt kan vi tælle 13 forskelle ud af de 110 aminosyrer, altså ca. 88 % identitet. Dette passer meget godt med det vi ser med andre gener fra mennesket og hunden, og er resultatet af to udviklingslinjer der sidst havde en fælles forfar for ca. 100 mio. år siden. 15. Vend tilbage til BLASTP-resultatsiden. Vinduet ser ud som vist herunder. Hvis ikke det kan genfindes, kan det altid genskabes ved at køre en ny BLASTP med den oprindelige søgesekvens, resultatet skulle meget gerne blive det samme som før! Vi vil nu se nærmere på resten af resultatinformationerne. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

15 Yderligere resultatsider 1. Vælg det link der hedder Taxonomy reports. Et nyt vindue åbner med en oversigt over hvilke arter resultatsekvenserne kommer fra og disse arters taksonomiske placering i livets træ. Hvis man kun vælger at se på 10 sekvenser, ser det ud som vist herunder. Denne rapport viser at der er fundet sekvenser fra otte forskellige organismer. Man kan også se i den øverste hierarkiske opbygning at alle otte organismer er placentale pattedyr. Derudover kan man se at det bedste match er mennesket, efterfulgt af chimpanse, gibbon, bavian, orangutang, hund, hest og kinesisk hamster. Har man flere end 10 sekvenser med, vil der også være ikke-pattedyr på listen. Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

16 2. Gå tilbage til resultatsiden og tryk på linket Distance tree of results. Nedenstående skærmbillede viser resultatet: Det er muligt du får et noget mere rodet resultat frem på skærmen med mange flere sekvenser. Dette kan ændres under menuen Max. Seq Difference, markeret med rødt på billedet, hvor jeg har valgt 0.2 svarende til at jeg kun vil se resultater fra de sekvenser, der er mindre end 20 % forskellige fra min søgesekvens. Søgesekvensen er markeret med gult. Hvordan skal dette fylogenetiske træ så analyseres? Umiddelbart er det let at se at søgesekvensen er identisk med en fra mennesket. Vandrette afstande i træet viser genetisk afstand mellem sekvenserne. Grønne trekanter betyder at der er flere end en sekvens, og dem kan man få at se ved at trykke på en grøn trekant og vælge Expand/Collapse. Man kan også manipulere på træets form og udseende på andre måder, men ikke dets biologiske indhold! Indholdet er bestemt af den biologiske information gemt i sekvenslighederne. For mere information omkring fylogenetiske træer, se Bioteknologi 6, link 5-7 i tema 12, eller siderne Hvilke to sekvenser, udover menneskesekvensen, er mest ens med søgesekvensen? 4. Fra hvilken art stammer den sekvens der er mindst ens med søgesekvensen? Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

17 Opgaver til databasesøgning Herunder er der tre opgaver der alle kan løses ved hjælp af databasesøgninger med BLASTP. Opgave 1 Fusk med fiskesalget Et supermarked sælger en fisk der ifølge reklamen er frit fanget atlanterhavslaks (Salmo salar), men er den nu også det? Du er udsendt af Fødevarestyrelsen for at undersøge et rygte om at dette supermarked nogle gange snyder og sælger billigere dambrugsopdrættede fisk under påstanden at det er frit fanget laks. Ud fra en vævsprøve fra en af fiskene i køledisken har du udvundet og sekventeret følgende korte proteinsekvens på 40 aminosyrer: Proteinsekvens fra fisk i køledisken: LEMYCAPVKSGKAARSVRAQRHTDMPRTPKVSTAVQSVDR 1. Har supermarkedet rent mel i posen? Og hvis ikke kødet er fra Atlanterhavslaksen, hvilken art er det så fra? Opgave 2 Undersøgelse af resistente bakterier I en gymnasieklasse har man dyrket to stammer af E. coli-bakterier på petriskåle hvoraf den ene viste resistens overfor penicillin, mens den anden ikke gjorde. Ved hjælp af proteingelelektroforese undersøgte man hvilke proteiner de to bakteriestammer hver i sær producerede. Eleverne identificerede og oprensede et unikt proteinbånd der kun var til stede hos den resistente bakteriestamme. Eleverne indsendte det oprensede protein til sekventering på Århus Universitet og fik følgende proteinsekvens tilbage: MFKTTLCALLITASCSTFAAPQKINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADI AKKQPV 1. Hvilket protein er der tale om, og kan det have noget at gøre med den resistente E. coli stammes evne til at overleve i et miljø hvor der er tilsat penicillin? Opgave 3 Er odderen derude? En forsker arbejder med at undersøge odderens (Lutra lutra) udbredelse i Danmark. Ifølge lokale naturinteresserede har de set oddere i to mindre søer på Fyn. Disse folk har fundet ekskrementer ved begge søbredder der måske er fra oddere. Fra ekskrementerne er det lykkedes forskeren at udvinde følgende proteinsekvenser: Sø-1 sekvens: MVLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK KVADALTTA Sø-2 sekvens: MVLSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLGFPTTKTYFPHFDFTHGSEQIKAHGKK VSEALTKA 1. Hvilket protein er sekvenserne fra, og er det bevis på at der er oddere i de to søer som de lokale påstår? Frank Grønlund Jørgensen Bioteknologi by Nucleus Forlag ISBN

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13

Side 1 af 13. Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Side1af13 Eksamen: Bioinformatik It og Sundhed 27 Jan 2011 kl 9-13 Navn: Studie nummer: Dette eksamenssæt vil også kunne ses som en pdf fil nederst på kursus-hjemmesiden udfor den sidste dag d. 27 Jan

Læs mere

27611 Eksamen Sommer 2007

27611 Eksamen Sommer 2007 - Side 1 af 10-27611 Eksamen Sommer 2007 Dette sæt indeholder 4 opgaver. En online version af opgavesættet vil være tilgængeligt fra kursets lektionsplan, under selve eksamen (25. Maj 2007 klokken 9:00

Læs mere

Danmarks Tekniske Universitet

Danmarks Tekniske Universitet Side 1 of 17 Danmarks Tekniske Universitet Skriftlig prøve, den 21/1-2013 Kursus navn: Kursus nr. 27633 Introduktion til Bioinformatik Tilladte hjælpemidler: Alle "Vægtning" Angivet ved de individuelle

Læs mere

Immunologisk bioinformatik

Immunologisk bioinformatik Immunologisk bioinformatik Øvelsesvejledning Introduktion til øvelsen Når man i dagligdagen taler om influenza, bliver virussen ofte forbundet med forbigående og ufarlig sygdom. Som regel har mennesker

Læs mere

MANUAL - Joomla! Version 1

MANUAL - Joomla! Version 1 MANUAL - Joomla! Version 1 Indhold Retningslinjer for hjemmesiden... 3 Log ind... 3 Ret i en artikel, der allerede er oprettet... 4 Opret ny artikel... 8 a) Skriv direkte i tekstfelt... 9 b) Indsæt tekst

Læs mere

Brugervejledning til hurtig start af EasyBusiness Online Indholdsfortegnelse:

Brugervejledning til hurtig start af EasyBusiness Online Indholdsfortegnelse: Brugervejledning til hurtig start af EasyBusiness Online Indholdsfortegnelse: 1. Hvordan du bliver tilsluttet EasyBusiness...2 2. Hvordan du foretager en søgning...2 3. Hvordan du gemmer og åbner en søgning...4

Læs mere

Åbn Paint, som er et lille tegne- og billedbehandlingsprogram der findes under Programmer i mappen Tilbehør. Åbn også Word.

Åbn Paint, som er et lille tegne- og billedbehandlingsprogram der findes under Programmer i mappen Tilbehør. Åbn også Word. 75 Paint & Print Screen (Skærmbillede med beskæring) Åbn Paint, som er et lille tegne- og billedbehandlingsprogram der findes under Programmer i mappen Tilbehør. Åbn også Word. 1. Minimer straks begge

Læs mere

BEGREBER I DANTEK... 2 LOG IND PÅ DANTEK WEBBOOKING... 3 SØGNING... 5 SØGERESULTATET... 8 LÅN FRA UDLÅNSSAMLINGEN... 11

BEGREBER I DANTEK... 2 LOG IND PÅ DANTEK WEBBOOKING... 3 SØGNING... 5 SØGERESULTATET... 8 LÅN FRA UDLÅNSSAMLINGEN... 11 BEGREBER I DANTEK... 2 SAMLINGER... 2 Informationssamlingen... 2 Udlånssamlingen (sætsamlingen)... 2 BOOKING... 2 RESERVERING... 2 LOG IND PÅ DANTEK WEBBOOKING... 3 SØGNING... 5 SIMPEL SØGNING... 5 AVANCERET

Læs mere

IT-Brugerkursus. Modul 1 - Introduktion til skolens netværk og FC. Modul 1 - Introduktion til FC og Lectio. Printvenligt format. Indholdsfortegnelse

IT-Brugerkursus. Modul 1 - Introduktion til skolens netværk og FC. Modul 1 - Introduktion til FC og Lectio. Printvenligt format. Indholdsfortegnelse Modul 1 - Introduktion til FC og Lectio IT-Brugerkursus Modul 1 - Introduktion til skolens netværk og FC Printvenligt format Indholdsfortegnelse Formål og opbygning Opgave Vejledning til intranettet Åbne

Læs mere

Sådan indlægges nyheder på DSqF s hjemmeside trin for trin

Sådan indlægges nyheder på DSqF s hjemmeside trin for trin Sådan indlægges nyheder på DSqF s hjemmeside trin for trin Systemkrav For at kunne bruge Composite kræves: Windows 95 eller nyere (bemærk - kun Windows kan bruges) Browseren Internet Explorer 6.0 eller

Læs mere

Manual til Dynamicweb Februar 2010

Manual til Dynamicweb Februar 2010 Manual til Dynamicweb Februar 2010 Login... 2 Skabeloner og formater... 3 Filarkivet... 4 Lav en PDF... 5 Opret en ny side... 7 Navngiv siden... 9 Aktiver siden... 9 Sorter sider... 9 Flyt siden... 11

Læs mere

1. Opret din nye Google konto

1. Opret din nye Google konto Indhold 1. Opret din nye Google konto... 2 2. Test din nye konto... 5 3. Kom i gang med Gmail indstil sprog til dansk... 6 4. Gmail indhold på skærmen... 8 5. Skriv og send en mail... 9 Til:... 9 Cc:...

Læs mere

Annemette Søgaard Hansen/www.dinwebvejleder.dk

Annemette Søgaard Hansen/www.dinwebvejleder.dk Google Docs Dokumenter Indholdsfortegnelse Værktøjer... Side 3 Menuer... Side 5 Opgave... Side 8 Få adgang til filerne fra din computer... Side 16 Vejledende løsning... Side 17 GoogleDocs Dokumenter 2

Læs mere

MANUAL. Siteloom CMS

MANUAL. Siteloom CMS MANUAL Siteloom CMS www.hjerteforeningen.dk/cms Brugernavn: Password: 3. september, 2012 BASIS FUNKTIONER 1. Kalender... 4 1.a. Opret... 5 1.b. Rediger eller slet... 8 2. Sider... 10 2.a Opret side...

Læs mere

BRUGERMANUAL FOR KLUBKOORDINATORER. Version 2.0

BRUGERMANUAL FOR KLUBKOORDINATORER. Version 2.0 BRUGERMANUAL FOR KLUBKOORDINATORER Version 2.0 Login Du skal vælge den klub som du tilhøre og dernæst indtaste din kode i feltet: Password. Regionsgolf-Danmark Administration Når du er logget ind i system

Læs mere

Indhold. 1. Adgang og afslutning

Indhold. 1. Adgang og afslutning 1 Indhold 1. Adgang og afslutning 2. Menupunkter 3. Tekst 4. Billeder 5. Video 6. Lyd 7. Bannere 8. Bokse 9. Dokumenter 10. Links 11. Iframe 12. Markedspladsen 13. Nyheder 14. Job 15. Kalender 16. Selvbetjeningsbjælken

Læs mere

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle

Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle BIOINFORMATIK Kresten Cæsar Torp Supplerende materiale til Biokemibogen liv, funktion, molekyle indhold DNA 2 Hvilke databaser skal man vælge? 2 Søgning på en nukleotidsekvens 2 Proteiner 4 Søgning på

Læs mere

Advanced Word Template Brugermanual

Advanced Word Template Brugermanual Advanced Word Template Brugermanual Forord: Advanced Word Template er et værktøj, der anvendes sammen med Microsoft Word til at opbygge ensartet beskrivelser på en mere intelligent måde end Copy and Paste

Læs mere

7DVWHYHMOHGQLQJ#²#,QWHUQHW#([SORUHU

7DVWHYHMOHGQLQJ#²#,QWHUQHW#([SORUHU 7DVWHYHMOHGQLQJ#²#,QWHUQHW#([SORUHU,QGKROGVIRUWHJQHOVH BROWSEREN - DE VIGTIGSTE FUNKTIONER OG BEGREBER.... 2 TILPAS BROWSEREN... 3 GÅ DIREKTE TIL EN KENDT ADRESSE... 5 LAV ET BOGMÆRKE... 6 ORGANISÉR DINE

Læs mere

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på politi.dk. Rigspolitiets websektion

RIGSPOLITIET. Vejledning i konvertering. fra. Word -dokument. til. PDF-fil. på politi.dk. Rigspolitiets websektion RIGSPOLITIET Vejledning i konvertering fra Word -dokument til PDF-fil på politi.dk Rigspolitiets websektion Indledning Da vi skal leve op til kravene om tilgængelighed på Internettet, skal alle tekster

Læs mere

Upload af billeder til hjemmesiden m.m.

Upload af billeder til hjemmesiden m.m. Upload af billeder til hjemmesiden m.m. Fremgangsmåde VVS-inst.dk Upload af billeder m.m., Side 1 Så går vi i gang Åben Firefox browseren Gå ind på denne adresse, for at komme til hjemmeside programmet.

Læs mere

Manual til hjemmeside i Typo3

Manual til hjemmeside i Typo3 Manual til hjemmeside i Typo3 Gode tips og genvejstaster Ét linieskift Ctrl + A Ctrl + C Ctrl + X Ctrl + V shift + enter (tasten du normalt bruger til linieskift) Markér alt Kopier Klip Sæt ind Oprettelse

Læs mere

RefWorks en vejledning fra UCL Biblioteket. Indholdsfortegnelse

RefWorks en vejledning fra UCL Biblioteket. Indholdsfortegnelse Indholdsfortegnelse Hvad er RefWorks?... 2 Opret dig som bruger... 2 Inden du går i gang... 3 Klargøring af computer til download af Write-N-Cite v. 4.2... 3 Installation af Write-N-Cite... 4 Installation

Læs mere

1. Opbygning af et regneark

1. Opbygning af et regneark 1. Opbygning af et regneark Et regneark er et skema. Vandrette rækker og lodrette kolonner danner celler, hvori man kan indtaste tal, tekst, datoer og formler. De indtastede tal og data kan bearbejdes

Læs mere

Indholdsfortegnelse. Indhold

Indholdsfortegnelse. Indhold Indholdsfortegnelse Indhold Login... 2 Registrér komme / gå tider... 4 Flere arbejdsperioder på samme dag?... 6 Frokostpause / ret Frokostpause... 7 Sletning... 8 Afslut uge... 9 Godkendte/afviste ugesedler...

Læs mere

Daglig brug af JitBesked 2.0

Daglig brug af JitBesked 2.0 Daglig brug af JitBesked 2.0 Indholdsfortegnelse Oprettelse af personer (modtagere)...3 Afsendelse af besked...4 Valg af flere modtagere...5 Valg af flere personer der ligger i rækkefølge...5 Valg af flere

Læs mere

vejman.dk Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9

vejman.dk Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Brugerdokumentation - kortmodul 14. marts 2012 Version 1.9 Indholdsfortegnelse 1 Indledning... 3 1.1 Anbefalinger... 4 1.2 Datahjælp... 4 1.3 Brugerindstillinger... 5 2 Generel funktionalitet... 6 2.1

Læs mere

FSFIs lynguide til DFRs elektronisk bevissystem

FSFIs lynguide til DFRs elektronisk bevissystem FSFIs lynguide til DFRs elektronisk bevissystem Dette er en kort guide i anvendelsen af Dansk Førstehjælpsråd elektroniske bevissystem. Guiden viser og forklarer hvordan du som instruktør og medlem af

Læs mere

MANUAL. Siteloom CMS

MANUAL. Siteloom CMS MANUAL Siteloom CMS www.hjerteforeningen.dk/cms Brugernavn: Password: 3. oktober, 2013 BASIS FUNKTIONER 1. Kalender... 4 1.a. Opret... 5 1.b. Rediger eller slet... 9 2. Sider...12 2.a. Opret side...13

Læs mere

Web MTC manual. Version 1.1 08-11-2012

Web MTC manual. Version 1.1 08-11-2012 Web MTC manual Version 1.1 08-11-2012 1 Revisioner: Version 1.0, 11-10-2012: Oprettelse af dokument Version 1.1, 08-11-2012: Afsnit om udskrivning af rapport tilføjet. 2 Indhold Sideopbygning... 5 Startside...

Læs mere

Outlook 2010 opsætning

Outlook 2010 opsætning Outlook 2010 opsætning Personlig Workflow Nå mere og arbejd mindre Personlig Workflow www.personligworkflow.com kontakt@personligworkflow.com Introduktion til Outlook 2010 guide Microsoft Outlook 2010

Læs mere

Vejledning KPK Online Prøverum

Vejledning KPK Online Prøverum Vejledning KPK Online Prøverum INDHOLD Introduktion side 2 Funktionsliste side 2 Få adgang til systemet side 3 Opload dine billeder side 4 Sådan bruges systemet side 5 Gem dine eksempler side 7 Side 1/7

Læs mere

STINA-vejledning STINA Online

STINA-vejledning STINA Online DANMARKS NATIONALBANK Statistisk Afdeling Version 2.2 November 2008 STINA-vejledning STINA Online Indledning Vejledningen henvender sig til personer i virksomheder, der indberetter til Nationalbanken via

Læs mere

MANUAL. Siteloom CMS

MANUAL. Siteloom CMS MANUAL Siteloom CMS www.hjerteforeningen.dk/cms Brugernavn: Password: 13. marts, 2014 BASIS FUNKTIONER 1. Kalender... 4 1.a. Opret... 5 1.b. Rediger eller slet... 9 2. Sider...12 2.a. Opret side...13 2.b.

Læs mere

Vejledning til udskrivning af etiketter/labels og konvolutter i Blåt Medlem

Vejledning til udskrivning af etiketter/labels og konvolutter i Blåt Medlem Vejledning til udskrivning af etiketter/labels og konvolutter i Blåt Medlem Blåt Medlem giver mulighed for at udskrive etiketter/labels og kuverter til medlemmerne af den enhed man er medlemsansvarlig

Læs mere

Introduktion til EXCEL med øvelser

Introduktion til EXCEL med øvelser Side 1 af 10 Introduktion til EXCEL med øvelser Du kender en almindelig regnemaskine, som kan være til stort hjælp, når man skal beregne resultater med store tal. Et regneark er en anden form for regnemaskine,

Læs mere

Billeder på hjemmeside

Billeder på hjemmeside Billeder på hjemmeside Indholdsfortegnelse Emne 1. Billedredigering (Microsoft Picture Manager) Side 3 a. Komprimer billeder b. Beskæring af billeder 3 9 2. Billeder og tekst ved hjælp af en skabelon (Template

Læs mere

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler.

PubMed er en stor sundhedsfaglig database med henvisninger til videnskabelige artikler. 0 Indholdsfortegnelse 1) Basens indhold... 1 2) Adgang til basen... 1 3) Søgemetoder... 2 a. Fritekstsøgning... 2 a. i. Muligheder for afgrænsning... 5 a. ii. Adgang til den fulde tekst eller ej / Ændring

Læs mere

Sådan redigerer du en hjemmeside i Umbraco

Sådan redigerer du en hjemmeside i Umbraco Brugermanual til din boligafdelings hjemmeside Sådan redigerer du en hjemmeside i Umbraco Indhold Introduktion... 2 Log på Umbraco og redigér din hjemmeside... 3 Opret ny side... 7 Gem side uden at udgive/publicere

Læs mere

Elektroniske tidsskrifter og databaser via Regionslicenser

Elektroniske tidsskrifter og databaser via Regionslicenser Vejledning Elektroniske tidsskrifter og databaser via Regionslicenser Via Regionslicenser kan hver region tilbyde alle hospitalsansatte og praksissektoren adgang til en række elektroniske ressourcer Adgangen

Læs mere

Du får her en kort beskrivelse af, hvordan du kommer i gang med at oprette en opkrævning som elektronisk faktura e Faktura i Business Online.

Du får her en kort beskrivelse af, hvordan du kommer i gang med at oprette en opkrævning som elektronisk faktura e Faktura i Business Online. Afsendelse af e Faktura Du får her en kort beskrivelse af, hvordan du kommer i gang med at oprette en opkrævning som elektronisk faktura e Faktura i Business Online. 1. Opret stamoplysninger (Fakturerings-

Læs mere

Roskilde Tekniske Gymnasium. Eksamensprojekt. Programmering C niveau

Roskilde Tekniske Gymnasium. Eksamensprojekt. Programmering C niveau Roskilde Tekniske Gymnasium Eksamensprojekt Programmering C niveau Andreas Sode 09-05-2014 Indhold Eksamensprojekt Programmering C niveau... 2 Forord... 2 Indledning... 2 Problemformulering... 2 Krav til

Læs mere

Kursusbeskrivelse. Forarbejde. Oprettelse af en Access-database

Kursusbeskrivelse. Forarbejde. Oprettelse af en Access-database Kursusbeskrivelse Oprettelse af en Access-database Som eksempel på en Access-database oprettes en simpelt system til administration af kurser. Access-databasen skal indeholde: et instruktørkartotek et

Læs mere

Det Naturvidenskabelige Fakultet. Introduktion til Blackboard (Øvelser) Naturvidenskabeligt Projekt 2006 Prøv at forske

Det Naturvidenskabelige Fakultet. Introduktion til Blackboard (Øvelser) Naturvidenskabeligt Projekt 2006 Prøv at forske Det Naturvidenskabelige Fakultet Introduktion til Blackboard (Øvelser) Naturvidenskabeligt Projekt 2006 Prøv at forske Indholdsfortegnelse Introduktion til Blackboard Content System...3 Øvelse 01 individuel:

Læs mere

Brugervejledning til Design Manager Version 1.02

Brugervejledning til Design Manager Version 1.02 Brugervejledning til Design Manager Version 1.02 Indholdsfortegnelse 1. Introduktion... 3 1.1 Det kan du med HostedShop Design Manager... 3 1.2 Feature list... 3 2. Design... 4 3. Filer og CSS... 4 3.1

Læs mere

Sådan opretter du en elektronisk aflevering

Sådan opretter du en elektronisk aflevering Sådan arbejder du med opgaver i Gradebook/karakterbog Denne vejledning indeholder en detaljeret beskrivelse af hvordan du bruger gradebook/karakterbogen når du vil arbejde med opgaver og give karakterer

Læs mere

Introduktion til de praktiske øvelser

Introduktion til de praktiske øvelser Introduktion til de praktiske øvelser Vi vil i dag fokusere på tre forskellige online software til SNP analyser snptree NDtree CSIphylogony Introduktion til SNP analyser http://cge.cbs.dtu.dk/services/all.php

Læs mere

Kom godt igang med Inventar registrering

Kom godt igang med Inventar registrering Kom godt igang med Inventar registrering (InventoryDB) (Med stregkodesupport) programmet fra PetriSoft Introduktion... 1 Inventar registrering... 2 Værktøjsudleje... 3 Service database til reperationer

Læs mere

Sådan opretter du et EXPORT certifikat i TRACES

Sådan opretter du et EXPORT certifikat i TRACES 16-04-2014 J.nr.: 2014-14-1119-00002/AJK Sådan opretter du et EXPORT certifikat i TRACES Log på TRACES Hvis du og din virksomhed/bedrift mv. ikke allerede er oprettet som henholdsvis bruger og organisation

Læs mere

RESPONSE 2.0. Kursusmanual til grundlæggende funktioner ASPEKT R&D

RESPONSE 2.0. Kursusmanual til grundlæggende funktioner ASPEKT R&D RESPONSE 2.0 Kursusmanual til grundlæggende funktioner ASPEKT R&D Indholdsfortegnelse Indholdsfortegnelse...2 Kort om Response:... 3 Lektion 1: Indledende overvejelser...4 Strategiske overvejelser...4

Læs mere

09/03 2009 Version 1.4 Side 1 af 37

09/03 2009 Version 1.4 Side 1 af 37 Login til DJAS Gå ind på adressen http://www.djas.dk I feltet Brugernavn skrives den e-mail adresse som brugeren er registeret med i systemet. I feltet Password skrives brugerens adgangskode. Ved at sætte

Læs mere

TESTPORTAL: BRUGERVEJLEDNING LOG IND ADGANGSKODE

TESTPORTAL: BRUGERVEJLEDNING LOG IND ADGANGSKODE TESTPORTAL: BRUGERVEJLEDNING LOG IND Testportalen befinder sig på internetadressen http://www.testportal.hogrefe.dk/default.aspx. På denne adresse mødes man af ovenstående skærmbillede. Indtast her dit

Læs mere

Introduktion til Calc Open Office med øvelser

Introduktion til Calc Open Office med øvelser Side 1 af 8 Introduktion til Calc Open Office med øvelser Introduktion til Calc Open Office... 2 Indtastning i celler... 2 Formler... 3 Decimaler... 4 Skrifttype... 5 Skrifteffekter... 6 Justering... 6

Læs mere

Typo3 vejledning BMI af 1 Typo3 vejledning for redaktører og skribenter i BMI

Typo3 vejledning BMI af 1 Typo3 vejledning for redaktører og skribenter i BMI af 1 side 1 Typo3 vejledning for redaktører og skribenter i BMI GENERELT...3 LOGIN...3 STARTSIDEN...4 SIDE...5 SIDE ELEMENTER...6 SIDE LAYOUT...7 STJÆL MED ARME OG BEN HEL SIDE...8 STJÆL MED ARME OG BEN

Læs mere

PORTFOLIO Version 2.0

PORTFOLIO Version 2.0 Nikolaj Lisberg Hansen Løsningsarkitekt og partner nikolaj.hansen@empisto.dk Tlf. 22 90 91 22 PORTFOLIO Version 2.0 Kvalitetsstyring med sags og dokumenthåndtering Teknisk revision af energimærker Portfolio

Læs mere

Indholdsfortegnelse. Indledning System krav side 1

Indholdsfortegnelse. Indledning System krav side 1 Indholdsfortegnelse Indledning System krav side 1 Brugerflade Hovedvindue side 2 Sprog side 2 Funktionsknapper side 2 Programmér kort side 3 Rapport side 4 Program menu Comport, login side 5 Rev.1.1 2014

Læs mere

Vejledning i brug af GMAIL (Google)

Vejledning i brug af GMAIL (Google) Vejledning i brug af GMAIL (Google) Send meddelelser Har du ikke prøvet Gmail før? Her har du en trinvis vejledning i, hvordan du skriver og sender meddelelser: Klik på knappen Skriv i venstre side i Gmail.

Læs mere

1.TILBUD NYT TILBUD 1.1 TRIN FORUDSÆTNINGER

1.TILBUD NYT TILBUD 1.1 TRIN FORUDSÆTNINGER 1.TILBUD Fanen Tilbud giver en oversigt over alle de tilbud, der ligger i din database. Det er også herfra, at du har mulighed for at oprette, kopiere eller redigere et eksisterende tilbud. Det følgende

Læs mere

Redaktørvejledning for www.bredstrup-pjedsted.dk Skriv en artikel

Redaktørvejledning for www.bredstrup-pjedsted.dk Skriv en artikel Arbejdsgang - Skriv artiklens tekst - Gør billeder klar - Log-in på hjemmesiden - Opret ny artikel - Vælg kategori - Skriv overskrift - Indsæt tekst - Tilføj billeder - Gennemgå artiklens indstillinger

Læs mere

Vejledning for LOF s afdelingshjemmeside

Vejledning for LOF s afdelingshjemmeside Vejledning for LOF s afdelingshjemmeside - redigeret i Umbraco Marts 2012 Adresse: http://dinafdeling.lof.dk/ Rediger hjemmeside i Umbraco: http://dinafdeling.lof.dk/umbraco/ Mobilside: Der er lavet en

Læs mere

KMA-oplysninger. 1 Introduktion

KMA-oplysninger. 1 Introduktion KMA-oplysninger MADS MENU: KODER SYSTEMET KMA-OPLYSNINGER (E.1.1.) Revideret 07-02-2011 1 Introduktion I programmet KMA-oplysninger sættes en række grundlæggende indstillinger for MADS i afdelingen, fx

Læs mere

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature.

CINAHL er en forkortelse for Cumulative Index to Nursing and Allied Health Literature. 0 Indhold 1) Basens indhold... 1 2) Adgang til basen... 1 3) Sign In / My EBSCOhost... 2 4) Søgemetoder... 3 4.a Fritekstsøgning... 3 4. b Begrænsning / afgrænsning... 4 4.c Er der adgang til artiklens

Læs mere

Når du på Pro2tal Bager s hjemmeside: www.bagernettet.dk klikker på ikonet

Når du på Pro2tal Bager s hjemmeside: www.bagernettet.dk klikker på ikonet Når du på Pro2tal Bager s hjemmeside: www.bagernettet.dk klikker på ikonet kommer følgende login billede til Bagersystemet: Indtast dit brugernavn og adgangskode og tryk Enter eller klik på knappen Logon.

Læs mere

Sider, indlæg og projekter

Sider, indlæg og projekter Sider, indlæg og projekter I Divi-temaet er der tre forskellige måder at lægge artikler op på sitet; Sider, indlæg og projekter. På Villybruun.dk bruges Sider til alle artikler. Man kan oprette eller redigere

Læs mere

Den digitale Underviser. DOF deltagernet

Den digitale Underviser. DOF deltagernet Den digitale Underviser DOF deltagernet Sabine Kramer juli 2014 Indhold Kursusindhold... 2 Log ind på Deltagernet, se og rediger dine aktuelle kurser... 3 Skift fra uge- til emneformat... 5 Redigér første

Læs mere

Sådan opdaterer og vedligeholder du din hjemmeside i Wordpress.

Sådan opdaterer og vedligeholder du din hjemmeside i Wordpress. Wordpress manual Sådan opdaterer og vedligeholder du din hjemmeside i Wordpress. Dette er en manual til de mest grundlæggende ting og funktioner i Wordpress, så du selv kan redigere indholdet eller tilføje

Læs mere

Installation af MySQL server på PC

Installation af MySQL server på PC Installation af MySQL server på PC (Udgave 0.02 2013-Oktober-06 @ 22:30 Chris Bagge, Mindre rettelser) Dette er en kort beskrivelse af hvordan man får installeret en MySQL server på en PC med Windows 7.

Læs mere

Quick Guide Ditmer edagsorden Oktober 2013

Quick Guide Ditmer edagsorden Oktober 2013 Quick Guide Ditmer edagsorden Oktober 2013 Quick Guide Indhold For dig der skal i gang med at bruge ditmer edagsorden på ipad eller web 1. Sådan får du adgang til ditmer edagsorden... 2 2. Find udvalg

Læs mere

Family Tree Maker Hints omkring det at lave træer

Family Tree Maker Hints omkring det at lave træer Nærværende vejledning vil omfatte hints til forfædretræ (vifte, standard & vertikalt), efterkommertræ (vifte & standard), timeglastræ (vifte & standard) og alle-i-et træ. Da mange af tingene er identiske

Læs mere

RM Info vejledning for Den Ortopædiske Fællesdatabase

RM Info vejledning for Den Ortopædiske Fællesdatabase RM Info vejledning for Den Ortopædiske Fællesdatabase RM Info kan anvendes til at se indikatorresultater, mangellister med komplethed, samt trække afdelings data for Den Ortopædiske Fællesdatabase, herunder

Læs mere

5. OPSÆTNING DOKUMENTSKABELONER 5.1 TRIN

5. OPSÆTNING DOKUMENTSKABELONER 5.1 TRIN 5. OPSÆTNING DOKUMENTSKABELONER Under fanen Dok. skabeloner kan du arbejde med de skabeloner som du har i systemet, eller du kan oprette nye. I denne vejledning kigger vi på hvordan du kan tilrette selve

Læs mere

OIOXML. Du får her en kort beskrivelse af, hvordan du kommer i gang med at oprette en opkrævning som Elektronisk faktura OIOXML i Business Online.

OIOXML. Du får her en kort beskrivelse af, hvordan du kommer i gang med at oprette en opkrævning som Elektronisk faktura OIOXML i Business Online. Forløbet for en opkrævning Du får her en kort beskrivelse af, hvordan du kommer i gang med at oprette en opkrævning som Elektronisk faktura OIOXML i Business Online. 1. Opret stamoplysninger (Fakturerings-

Læs mere

Brug af Office365 med Onedrive, nyeste Officepakke mv

Brug af Office365 med Onedrive, nyeste Officepakke mv Egedal Gymnasium og HF september 2014 Brug af Office365 med Onedrive, nyeste Officepakke mv Dette dokument beskriver, hvordan du kan opnå adgang til nogle resurser i skyen og hente ny software. Hvordan

Læs mere

How to do in rows and columns 8

How to do in rows and columns 8 INTRODUKTION TIL REGNEARK Denne artikel handler generelt om, hvad regneark egentlig er, og hvordan det bruges på et principielt plan. Indholdet bør derfor kunne anvendes uden hensyn til, hvilken version

Læs mere

Vejledning til referencehåndteringssystemet. Forsvarets Bibliotekscenter Anita Elleby

Vejledning til referencehåndteringssystemet. Forsvarets Bibliotekscenter Anita Elleby Vejledning til referencehåndteringssystemet Forsvarets Bibliotekscenter Anita Elleby Jeg håber, at du vil få glæde af denne vejledning til referencehåndteringssystemet Zotero. Hvis du får problemer undervejs

Læs mere

Vejledning til indsendelse af artikler via Manuscript Central

Vejledning til indsendelse af artikler via Manuscript Central Vejledning til indsendelse af artikler via Manuscript Central Adgang til Manuscript Central o Login o Har du glemt dit password? o Velkomstsiden o Din forfatterside (Author Dashboard) Krav til manuskriptet

Læs mere

En blog med dansk brugerflade. Opret en Smartlog konto Gå til http://www.smartlog.dk/ Opret en konto ved at skrive din e-mailadresse

En blog med dansk brugerflade. Opret en Smartlog konto Gå til http://www.smartlog.dk/ Opret en konto ved at skrive din e-mailadresse Blogs Om blogs http://www.it-borger.dk/den-nye-it-verden/internet/blogs Om at oprette blogs http://www.it-borger.dk/laer-om-it/internet/nar-du-vil-pa-nettet/blogs/sadan-laver-du-en-blog Råd når du laver

Læs mere

Programmeringseksempel til CX/IPC

Programmeringseksempel til CX/IPC APP-NOTE 610004 Beckhoff Application Note Date: 7/17/2009 Document Status: 1.1 Beckhoff Automation Aps Naverland 2, DK-2600 Glostrup Phone +45 43 46 76 20 Fax +45 43 46 63 35 Programmeringseksempel til

Læs mere

Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync

Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync Foreløbig version af Brugervejledning for datamodtagere til GS1Trade Sync v 0.1 maj 2014 www.gs1.dk/gs1tradesync Indhold Log på... 3 Søg produkter... 4 Hierarkiopbygning... 7 Subskriptioner (Selektioner)

Læs mere

Vejledning om tilmelding til Register for køb af ammoniumnitratgødning

Vejledning om tilmelding til Register for køb af ammoniumnitratgødning Vejledning om tilmelding til Register for køb af ammoniumnitratgødning Kolofon Denne vejledning er udarbejdet af Center for Kontrol, Enhed for Jordbrugskontrol i 2015 Ministeriet for Fødevarer, Landbrug

Læs mere

Introduktion til webanalyser.dk

Introduktion til webanalyser.dk Introduktion til webanalyser.dk Hvis du udskriver og følger denne introduktion, vil du få et godt overblik over systemet på ca. 20 minutter. Når du har fulgt beskrivelsen, har du oprettet dit første skema,

Læs mere

NYHEDSBREVE MED MAILCHIMP

NYHEDSBREVE MED MAILCHIMP VÆRKTØJSKASSEN: NYHEDSBREVE MED MAILCHIMP VED JENS GRIEBEL DIGITAL KONSULENT, JENS@GRIEBEL.DK 1 Velkommen til MailChimp Denne guide vil hjælpe dig med at opsætte din første e-mail kampagne. Den vil også

Læs mere

Manual til AVG Antivirus

Manual til AVG Antivirus Manual til AVG Antivirus Det anbefales, at alle brugere benytter sig af et antivirus-program. Formålet med programmet er at forhindre din computer i at blive smittet med virus. Virus-inficerede computere

Læs mere

Fra Blåt Medlem til Open Office regneark.

Fra Blåt Medlem til Open Office regneark. Fra Blåt Medlem til Open Office regneark. Kopi fra Blåt Medlem til Open Office regneark 1 Eksport fra Blåt Medlem til Open Office regneark 2 Hvad kan du bruge det til 4 Eksempler: Medlemsdelen: Afdelingsopdelt

Læs mere

Gå ind på forsiden til hjemmesiden. Skriv typo3 i adresselinjen og tryk på retur.

Gå ind på forsiden til hjemmesiden. Skriv typo3 i adresselinjen og tryk på retur. Adgang til Back-end Gå ind på forsiden til hjemmesiden. Skriv typo3 i adresselinjen og tryk på retur. typo3 Skriv herefter brugernavn og adgangskode i de respektive felter og klik på Login Den følgende

Læs mere

18/11 2010 Version 2.0 Side 1 af 36

18/11 2010 Version 2.0 Side 1 af 36 Login til DJAS Gå ind på adressen http://www.djas.dk I feltet Brugernavn skrives den e-mail adresse som brugeren er registeret med i systemet. I feltet Password skrives brugerens adgangskode. Ved at sætte

Læs mere

Indtast prøvetypen og vælg den [F12] (valg). Dyrkning (urin - vækst) 1

Indtast prøvetypen og vælg den [F12] (valg). Dyrkning (urin - vækst) 1 Indtast prøvetypen og vælg den [F12] (valg). 1 Indtast prøvenummer og søg prøven med [F8] (udfør søg). 2 Grundoplysninger, registreret i Forside-programmet, står nu i øverste blok, og indtastning af dyrkningssvar

Læs mere

Arrangementer i Listevisning

Arrangementer i Listevisning Kort introduktion til Typo3-plugin ARRANGEMENTER. De indledende øvelser er fuldstændig de samme som i TYPO3 TRIN FOR TRIN 1 side 1-2. Du åbner altså din browser (Internet Explorer er den almindeligste),

Læs mere

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste

Tre sideopsætninger: 1 Forside. 2 Standard 3 Liste. 1 Forside. 2 Underside. 3 Liste 1 Forside Tre sideopsætninger: 1 Forside 2 Standard 3 Liste 2 Underside 3 Liste Ret indhold på en side I systemet kan du let rette tekst, link og billeder på hjemmesiden Først skal du logge ind i systemet

Læs mere

NP Ecommerce. Produktguide for NaviConnect. Ecommerce

NP Ecommerce. Produktguide for NaviConnect. Ecommerce NP Ecommerce Produktguide for NaviConnect Ecommerce Indhold Varekort - Magento:... 2 Grundlæggende vareinformation:... 2 Priser og specielt fremtræden:... 4 Metainformation:... 5 Attributsæt, billeder,

Læs mere

Qbrick s krav til video filtyper

Qbrick s krav til video filtyper Indhold Qbrick s krav til video filtyper... 1 Krav til ordningen/området... 1 Qbrick s krav til video leverandør... 1 Video og billede størrelser i WCM:... 1 Upload en video... 2 Trin 1: Mediefiler...

Læs mere

Vejledning til brug af Foreningsportalen

Vejledning til brug af Foreningsportalen Børne- og Kulturforvaltningen Kultur- og Fritidsafdelingen Vejledning til brug af Foreningsportalen Foreningsportalen kan benyttes af både borgere og foreninger til søgning af foreningsoplysninger. Som

Læs mere

1. Større opgaver i word

1. Større opgaver i word Indholdsfortegnelse 1. Større opgaver i word...1 1.1. Typografier... 1 1.1.1. Normal... 1 1.1.2. Overskrifter... 5 1.2. Dispositionsvisning... 6 1.3. Indholdsfortegnelse... 6 1.4. Krydshenvisninger...

Læs mere

Hjemmesiden er opdelt i et sidehoved, en sidefod og mellem disse 3 kolonner: venstre, midterste og højre. Højre kolonne vises dog kun på forsiden.

Hjemmesiden er opdelt i et sidehoved, en sidefod og mellem disse 3 kolonner: venstre, midterste og højre. Højre kolonne vises dog kun på forsiden. Hjemmesiden er opdelt i et sidehoved, en sidefod og mellem disse 3 kolonner: venstre, midterste og højre. Højre kolonne vises dog kun på forsiden. VENSTRE kolonne indeholder flere elementer (se illustration

Læs mere

Nogle metoder ved arbejdet med Brothers Keeper.

Nogle metoder ved arbejdet med Brothers Keeper. Villy Andersen Frederiksberg den 8. september 2014. Nogle metoder ved arbejdet med Brothers Keeper. For at få samling på nogle af de tidligere udsendte beskrivelser og vejledninger om Brothers Keeper (BK)

Læs mere

Først skal du oprette dig i systemet, d. v. s. du skal have en såkaldt Googlekonto bestående af en mailadresse og et kodeord.

Først skal du oprette dig i systemet, d. v. s. du skal have en såkaldt Googlekonto bestående af en mailadresse og et kodeord. Gmail Indhold Indhold...1 Introduktion...2 Opret dig i systemet...2 At skrive mails...5 Sende en mail til flere personer...8 Vedhæfte en fil...9 Kladde...10 Signatur...11 Modtagne mails...12 Stjernemarkering...14

Læs mere

Vejledning til Google Analytics rapporter

Vejledning til Google Analytics rapporter Vejledning til Google Analytics rapporter Internet statistik kan godt være svært at forstå specielt hvis man ikke er vant til at arbejde med sådanne ting. For at gøre det nemmere for vores kunder at forstå

Læs mere

LW313 Sweex Wireless 300N Adapter USB

LW313 Sweex Wireless 300N Adapter USB LW313 Sweex Wireless 300N Adapter USB Bemærk venligst! Udsæt ikke Sweex Wireless 300N Adapter USB for ekstreme temperaturer. Placér ikke adapteren i direkte sollys eller i nærheden af radiatorer eller

Læs mere

3 Tilføj printer "HP-GL/2 devices, ADI 4.3 - for Autodesk by HP" 5 Klik "Printer ikonet" - Print/Plot configuration

3 Tilføj printer HP-GL/2 devices, ADI 4.3 - for Autodesk by HP 5 Klik Printer ikonet - Print/Plot configuration Plot filer fra AutoCad 14. 1 Åben Autocad 14 2 Klik "Filer" og vælg "Printer setup" 3 Tilføj printer "HP-GL/2 devices, ADI 4.3 - for Autodesk by HP" 4 Klik "Ok" 5 Klik "Printer ikonet" - Print/Plot configuration

Læs mere